| Basic Information | |
|---|---|
| Family ID | F034984 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 1.16 % |
| % of genes near scaffold ends (potentially truncated) | 42.77 % |
| % of genes from short scaffolds (< 2000 bps) | 64.74 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (76.879 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.717 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.104 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.584 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.79% β-sheet: 0.00% Coil/Unstructured: 59.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 12.14 |
| PF00106 | adh_short | 4.05 |
| PF00155 | Aminotran_1_2 | 3.47 |
| PF00582 | Usp | 2.31 |
| PF01361 | Tautomerase | 2.31 |
| PF01118 | Semialdhyde_dh | 1.73 |
| PF01656 | CbiA | 1.73 |
| PF03186 | CobD_Cbib | 1.73 |
| PF00226 | DnaJ | 1.73 |
| PF13473 | Cupredoxin_1 | 1.16 |
| PF02774 | Semialdhyde_dhC | 1.16 |
| PF14470 | bPH_3 | 1.16 |
| PF13847 | Methyltransf_31 | 1.16 |
| PF06662 | C5-epim_C | 0.58 |
| PF01545 | Cation_efflux | 0.58 |
| PF03725 | RNase_PH_C | 0.58 |
| PF08240 | ADH_N | 0.58 |
| PF07883 | Cupin_2 | 0.58 |
| PF06197 | DUF998 | 0.58 |
| PF02133 | Transp_cyt_pur | 0.58 |
| PF01904 | DUF72 | 0.58 |
| PF01789 | PsbP | 0.58 |
| PF07332 | Phage_holin_3_6 | 0.58 |
| PF08327 | AHSA1 | 0.58 |
| PF00266 | Aminotran_5 | 0.58 |
| PF01920 | Prefoldin_2 | 0.58 |
| PF09754 | PAC2 | 0.58 |
| PF14947 | HTH_45 | 0.58 |
| PF01243 | Putative_PNPOx | 0.58 |
| PF13459 | Fer4_15 | 0.58 |
| PF00353 | HemolysinCabind | 0.58 |
| PF01780 | Ribosomal_L37ae | 0.58 |
| PF13412 | HTH_24 | 0.58 |
| PF04055 | Radical_SAM | 0.58 |
| PF01063 | Aminotran_4 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.31 |
| COG1270 | Cobalamin biosynthesis protein CobD/CbiB | Coenzyme transport and metabolism [H] | 1.73 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 1.16 |
| COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.16 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 1.16 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.58 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.58 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.58 |
| COG1997 | Ribosomal protein L37AE/L43A | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.58 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.58 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.46 % |
| Unclassified | root | N/A | 22.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908021|BSRL3_Contig_8519 | All Organisms → cellular organisms → Archaea | 637 | Open in IMG/M |
| 2140918013|NODE_215139_length_1325_cov_5.547925 | All Organisms → cellular organisms → Archaea | 1357 | Open in IMG/M |
| 2162886006|SwRhRL3b_contig_4030015 | All Organisms → cellular organisms → Archaea | 1403 | Open in IMG/M |
| 2162886007|SwRhRL2b_contig_1230565 | All Organisms → cellular organisms → Archaea | 1057 | Open in IMG/M |
| 3300000041|ARcpr5oldR_c000861 | All Organisms → cellular organisms → Archaea | 3406 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11017632 | All Organisms → cellular organisms → Archaea | 1357 | Open in IMG/M |
| 3300000559|F14TC_100962336 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1583 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1002639 | All Organisms → cellular organisms → Archaea | 2117 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1008280 | All Organisms → cellular organisms → Archaea | 1160 | Open in IMG/M |
| 3300000652|ARCol0yngRDRAFT_1002263 | All Organisms → cellular organisms → Archaea | 1472 | Open in IMG/M |
| 3300000890|JGI11643J12802_11928434 | All Organisms → cellular organisms → Archaea | 1136 | Open in IMG/M |
| 3300001990|JGI24737J22298_10104636 | Not Available | 838 | Open in IMG/M |
| 3300002090|JGI24806J26614_1003998 | All Organisms → cellular organisms → Archaea | 4261 | Open in IMG/M |
| 3300002090|JGI24806J26614_1011468 | Not Available | 1278 | Open in IMG/M |
| 3300002896|JGI24802J43972_1019760 | All Organisms → cellular organisms → Archaea | 543 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10000274 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera gargensis | 6269 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10006638 | All Organisms → cellular organisms → Archaea | 1883 | Open in IMG/M |
| 3300004463|Ga0063356_100599990 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 1488 | Open in IMG/M |
| 3300004479|Ga0062595_100624448 | All Organisms → cellular organisms → Archaea | 846 | Open in IMG/M |
| 3300005105|Ga0066812_1001914 | All Organisms → cellular organisms → Archaea | 1047 | Open in IMG/M |
| 3300005161|Ga0066807_1020317 | All Organisms → cellular organisms → Archaea | 675 | Open in IMG/M |
| 3300005168|Ga0066809_10000488 | All Organisms → cellular organisms → Archaea | 5240 | Open in IMG/M |
| 3300005169|Ga0066810_10008393 | All Organisms → cellular organisms → Archaea | 1459 | Open in IMG/M |
| 3300005186|Ga0066676_10081234 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1925 | Open in IMG/M |
| 3300005186|Ga0066676_10649865 | All Organisms → cellular organisms → Archaea | 716 | Open in IMG/M |
| 3300005269|Ga0065706_1000165 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 9763 | Open in IMG/M |
| 3300005269|Ga0065706_1001242 | All Organisms → cellular organisms → Archaea | 825 | Open in IMG/M |
| 3300005269|Ga0065706_1001812 | All Organisms → cellular organisms → Archaea | 2078 | Open in IMG/M |
| 3300005276|Ga0065717_1002959 | All Organisms → cellular organisms → Archaea | 1499 | Open in IMG/M |
| 3300005276|Ga0065717_1003461 | All Organisms → cellular organisms → Archaea | 1258 | Open in IMG/M |
| 3300005277|Ga0065716_1006309 | Not Available | 817 | Open in IMG/M |
| 3300005289|Ga0065704_10016538 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3448 | Open in IMG/M |
| 3300005289|Ga0065704_10088317 | All Organisms → cellular organisms → Archaea | 2949 | Open in IMG/M |
| 3300005293|Ga0065715_10089024 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 16483 | Open in IMG/M |
| 3300005294|Ga0065705_10000011 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 13580 | Open in IMG/M |
| 3300005294|Ga0065705_10006481 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 5243 | Open in IMG/M |
| 3300005294|Ga0065705_10237033 | Not Available | 1248 | Open in IMG/M |
| 3300005294|Ga0065705_10676154 | All Organisms → cellular organisms → Archaea | 664 | Open in IMG/M |
| 3300005295|Ga0065707_10000034 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7617 | Open in IMG/M |
| 3300005328|Ga0070676_10005179 | All Organisms → cellular organisms → Archaea | 6927 | Open in IMG/M |
| 3300005338|Ga0068868_100138996 | Not Available | 1992 | Open in IMG/M |
| 3300005343|Ga0070687_100017939 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3265 | Open in IMG/M |
| 3300005364|Ga0070673_100803671 | Not Available | 868 | Open in IMG/M |
| 3300005455|Ga0070663_101676736 | Not Available | 568 | Open in IMG/M |
| 3300005459|Ga0068867_100109951 | All Organisms → cellular organisms → Archaea | 2116 | Open in IMG/M |
| 3300005539|Ga0068853_100180992 | All Organisms → cellular organisms → Archaea | 1911 | Open in IMG/M |
| 3300005543|Ga0070672_100013067 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 5852 | Open in IMG/M |
| 3300005543|Ga0070672_100271041 | All Organisms → cellular organisms → Archaea | 1433 | Open in IMG/M |
| 3300005545|Ga0070695_100156681 | All Organisms → cellular organisms → Archaea | 1594 | Open in IMG/M |
| 3300005615|Ga0070702_100177417 | All Organisms → cellular organisms → Archaea | 1391 | Open in IMG/M |
| 3300005615|Ga0070702_100461633 | Not Available | 924 | Open in IMG/M |
| 3300005937|Ga0081455_10001363 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 30136 | Open in IMG/M |
| 3300005937|Ga0081455_10004263 | All Organisms → cellular organisms → Archaea | 16115 | Open in IMG/M |
| 3300005937|Ga0081455_10456189 | All Organisms → cellular organisms → Archaea | 872 | Open in IMG/M |
| 3300005937|Ga0081455_10798420 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006049|Ga0075417_10001062 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales | 7187 | Open in IMG/M |
| 3300006049|Ga0075417_10094372 | All Organisms → cellular organisms → Archaea | 1350 | Open in IMG/M |
| 3300006058|Ga0075432_10007117 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 3811 | Open in IMG/M |
| 3300006196|Ga0075422_10177567 | Not Available | 864 | Open in IMG/M |
| 3300006844|Ga0075428_100123654 | All Organisms → cellular organisms → Archaea | 2816 | Open in IMG/M |
| 3300006845|Ga0075421_100485436 | Not Available | 1470 | Open in IMG/M |
| 3300006846|Ga0075430_101009455 | Not Available | 685 | Open in IMG/M |
| 3300006852|Ga0075433_10399561 | Not Available | 1213 | Open in IMG/M |
| 3300006854|Ga0075425_102367345 | All Organisms → cellular organisms → Archaea | 590 | Open in IMG/M |
| 3300006881|Ga0068865_100064747 | All Organisms → cellular organisms → Archaea | 2573 | Open in IMG/M |
| 3300006904|Ga0075424_100049864 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 4374 | Open in IMG/M |
| 3300006904|Ga0075424_101885934 | Not Available | 631 | Open in IMG/M |
| 3300006904|Ga0075424_102679973 | Not Available | 520 | Open in IMG/M |
| 3300006969|Ga0075419_10089588 | All Organisms → cellular organisms → Archaea | 1967 | Open in IMG/M |
| 3300009036|Ga0105244_10190806 | Not Available | 969 | Open in IMG/M |
| 3300009094|Ga0111539_10257038 | All Organisms → cellular organisms → Archaea | 2034 | Open in IMG/M |
| 3300009147|Ga0114129_11019818 | All Organisms → cellular organisms → Archaea | 1041 | Open in IMG/M |
| 3300009156|Ga0111538_11088530 | All Organisms → cellular organisms → Archaea | 1011 | Open in IMG/M |
| 3300009162|Ga0075423_12346135 | Not Available | 581 | Open in IMG/M |
| 3300009176|Ga0105242_10073956 | All Organisms → cellular organisms → Archaea | 2834 | Open in IMG/M |
| 3300009545|Ga0105237_10129431 | All Organisms → cellular organisms → Archaea | 2519 | Open in IMG/M |
| 3300009553|Ga0105249_10367961 | All Organisms → cellular organisms → Archaea | 1460 | Open in IMG/M |
| 3300009553|Ga0105249_10461620 | Not Available | 1310 | Open in IMG/M |
| 3300009553|Ga0105249_10477246 | All Organisms → cellular organisms → Archaea | 1289 | Open in IMG/M |
| 3300010043|Ga0126380_11793241 | Not Available | 555 | Open in IMG/M |
| 3300010362|Ga0126377_10387214 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 1405 | Open in IMG/M |
| 3300010375|Ga0105239_10326796 | All Organisms → cellular organisms → Archaea | 1730 | Open in IMG/M |
| 3300012355|Ga0137369_10013872 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7824 | Open in IMG/M |
| 3300012473|Ga0157340_1004268 | All Organisms → cellular organisms → Archaea | 819 | Open in IMG/M |
| 3300012474|Ga0157356_1000050 | All Organisms → cellular organisms → Archaea | 4315 | Open in IMG/M |
| 3300012477|Ga0157336_1006315 | All Organisms → cellular organisms → Archaea | 809 | Open in IMG/M |
| 3300012480|Ga0157346_1012805 | All Organisms → cellular organisms → Archaea | 640 | Open in IMG/M |
| 3300012480|Ga0157346_1015005 | Not Available | 616 | Open in IMG/M |
| 3300012483|Ga0157337_1002738 | All Organisms → cellular organisms → Archaea | 1020 | Open in IMG/M |
| 3300012487|Ga0157321_1000144 | All Organisms → cellular organisms → Archaea | 3065 | Open in IMG/M |
| 3300012492|Ga0157335_1000520 | All Organisms → cellular organisms → Archaea | 1785 | Open in IMG/M |
| 3300012493|Ga0157355_1000509 | All Organisms → cellular organisms → Archaea | 1780 | Open in IMG/M |
| 3300012493|Ga0157355_1030871 | Not Available | 553 | Open in IMG/M |
| 3300012499|Ga0157350_1000481 | All Organisms → cellular organisms → Archaea | 1955 | Open in IMG/M |
| 3300012501|Ga0157351_1000083 | All Organisms → cellular organisms → Archaea | 4320 | Open in IMG/M |
| 3300012503|Ga0157313_1049702 | Not Available | 542 | Open in IMG/M |
| 3300012510|Ga0157316_1057995 | Not Available | 553 | Open in IMG/M |
| 3300012512|Ga0157327_1003336 | All Organisms → cellular organisms → Archaea | 1177 | Open in IMG/M |
| 3300012948|Ga0126375_10002762 | All Organisms → cellular organisms → Archaea | 6164 | Open in IMG/M |
| 3300012948|Ga0126375_10026859 | All Organisms → cellular organisms → Archaea | 2789 | Open in IMG/M |
| 3300012948|Ga0126375_10544562 | Not Available | 875 | Open in IMG/M |
| 3300012951|Ga0164300_10042579 | All Organisms → cellular organisms → Archaea | 1749 | Open in IMG/M |
| 3300012951|Ga0164300_10095637 | All Organisms → cellular organisms → Archaea | 1292 | Open in IMG/M |
| 3300012960|Ga0164301_10647645 | Not Available | 787 | Open in IMG/M |
| 3300012984|Ga0164309_10033733 | All Organisms → cellular organisms → Archaea | 2836 | Open in IMG/M |
| 3300012984|Ga0164309_10046227 | All Organisms → cellular organisms → Archaea | 2494 | Open in IMG/M |
| 3300012985|Ga0164308_10291830 | All Organisms → cellular organisms → Archaea | 1291 | Open in IMG/M |
| 3300013102|Ga0157371_10018852 | All Organisms → cellular organisms → Archaea | 5097 | Open in IMG/M |
| 3300013307|Ga0157372_10261107 | All Organisms → cellular organisms → Archaea | 2011 | Open in IMG/M |
| 3300013307|Ga0157372_10769902 | All Organisms → cellular organisms → Archaea | 1119 | Open in IMG/M |
| 3300015371|Ga0132258_11047512 | Not Available | 2062 | Open in IMG/M |
| 3300015371|Ga0132258_11348688 | All Organisms → cellular organisms → Archaea | 1802 | Open in IMG/M |
| 3300015371|Ga0132258_12403118 | Not Available | 1320 | Open in IMG/M |
| 3300015372|Ga0132256_100180470 | Not Available | 2145 | Open in IMG/M |
| 3300015372|Ga0132256_103085751 | Not Available | 560 | Open in IMG/M |
| 3300015372|Ga0132256_103702914 | Not Available | 514 | Open in IMG/M |
| 3300015373|Ga0132257_100537427 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 1438 | Open in IMG/M |
| 3300015373|Ga0132257_103644687 | Not Available | 560 | Open in IMG/M |
| 3300015374|Ga0132255_100309832 | Not Available | 2275 | Open in IMG/M |
| 3300017656|Ga0134112_10101374 | All Organisms → cellular organisms → Archaea | 1082 | Open in IMG/M |
| 3300017792|Ga0163161_10469153 | Not Available | 1020 | Open in IMG/M |
| 3300018000|Ga0184604_10002301 | All Organisms → cellular organisms → Archaea | 3005 | Open in IMG/M |
| 3300018027|Ga0184605_10016342 | All Organisms → cellular organisms → Archaea | 2918 | Open in IMG/M |
| 3300018052|Ga0184638_1158405 | Not Available | 814 | Open in IMG/M |
| 3300018056|Ga0184623_10238615 | All Organisms → cellular organisms → Archaea | 831 | Open in IMG/M |
| 3300018072|Ga0184635_10272518 | All Organisms → cellular organisms → Archaea | 668 | Open in IMG/M |
| 3300018074|Ga0184640_10020067 | All Organisms → cellular organisms → Archaea | 2541 | Open in IMG/M |
| 3300018082|Ga0184639_10067096 | All Organisms → cellular organisms → Archaea | 1871 | Open in IMG/M |
| 3300018465|Ga0190269_10592533 | All Organisms → cellular organisms → Archaea | 747 | Open in IMG/M |
| 3300019233|Ga0184645_1124514 | All Organisms → cellular organisms → Archaea | 1158 | Open in IMG/M |
| 3300019279|Ga0184642_1572992 | All Organisms → cellular organisms → Archaea | 1156 | Open in IMG/M |
| 3300019869|Ga0193705_1082253 | Not Available | 618 | Open in IMG/M |
| 3300021080|Ga0210382_10040240 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1800 | Open in IMG/M |
| 3300021344|Ga0193719_10000354 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 16782 | Open in IMG/M |
| 3300025315|Ga0207697_10006041 | Not Available | 5537 | Open in IMG/M |
| 3300025315|Ga0207697_10018422 | All Organisms → cellular organisms → Archaea | 2864 | Open in IMG/M |
| 3300025901|Ga0207688_10000719 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 16407 | Open in IMG/M |
| 3300025907|Ga0207645_10000427 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 34904 | Open in IMG/M |
| 3300025914|Ga0207671_10703078 | All Organisms → cellular organisms → Archaea | 804 | Open in IMG/M |
| 3300025926|Ga0207659_10001090 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 16109 | Open in IMG/M |
| 3300025933|Ga0207706_10001459 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 23645 | Open in IMG/M |
| 3300025938|Ga0207704_10052756 | All Organisms → cellular organisms → Archaea | 2467 | Open in IMG/M |
| 3300025940|Ga0207691_10002045 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 19731 | Open in IMG/M |
| 3300025940|Ga0207691_10085603 | All Organisms → cellular organisms → Archaea | 2829 | Open in IMG/M |
| 3300025960|Ga0207651_10044340 | All Organisms → cellular organisms → Archaea | 2976 | Open in IMG/M |
| 3300025961|Ga0207712_10742798 | Not Available | 859 | Open in IMG/M |
| 3300026067|Ga0207678_11513297 | Not Available | 592 | Open in IMG/M |
| 3300026324|Ga0209470_1023795 | All Organisms → cellular organisms → Archaea | 3255 | Open in IMG/M |
| 3300026750|Ga0207483_101887 | All Organisms → cellular organisms → Archaea | 831 | Open in IMG/M |
| 3300027560|Ga0207981_1002305 | All Organisms → cellular organisms → Archaea | 3410 | Open in IMG/M |
| 3300027873|Ga0209814_10000969 | All Organisms → cellular organisms → Archaea | 9946 | Open in IMG/M |
| 3300027873|Ga0209814_10082489 | All Organisms → cellular organisms → Archaea | 1356 | Open in IMG/M |
| 3300027873|Ga0209814_10084890 | All Organisms → cellular organisms → Archaea | 1337 | Open in IMG/M |
| 3300027880|Ga0209481_10018790 | All Organisms → cellular organisms → Archaea | 3040 | Open in IMG/M |
| 3300027907|Ga0207428_10006076 | All Organisms → cellular organisms → Archaea | 11169 | Open in IMG/M |
| 3300027948|Ga0209858_1006814 | Not Available | 850 | Open in IMG/M |
| 3300028796|Ga0307287_10178584 | All Organisms → cellular organisms → Archaea | 807 | Open in IMG/M |
| 3300028814|Ga0307302_10125328 | All Organisms → cellular organisms → Archaea | 1236 | Open in IMG/M |
| 3300028819|Ga0307296_10034734 | All Organisms → cellular organisms → Archaea | 2660 | Open in IMG/M |
| 3300030829|Ga0308203_1007316 | All Organisms → cellular organisms → Archaea | 1195 | Open in IMG/M |
| 3300030903|Ga0308206_1007643 | All Organisms → cellular organisms → Archaea | 1521 | Open in IMG/M |
| 3300030993|Ga0308190_1018180 | All Organisms → cellular organisms → Archaea | 1124 | Open in IMG/M |
| 3300031091|Ga0308201_10016416 | All Organisms → cellular organisms → Archaea | 1477 | Open in IMG/M |
| 3300031716|Ga0310813_10639271 | All Organisms → cellular organisms → Archaea | 945 | Open in IMG/M |
| 3300031720|Ga0307469_10230920 | All Organisms → cellular organisms → Archaea | 1472 | Open in IMG/M |
| 3300031908|Ga0310900_11424810 | Not Available | 582 | Open in IMG/M |
| 3300032174|Ga0307470_10246360 | All Organisms → cellular organisms → Archaea | 1177 | Open in IMG/M |
| 3300032180|Ga0307471_100919631 | All Organisms → cellular organisms → Archaea | 1042 | Open in IMG/M |
| 3300033412|Ga0310810_10056951 | All Organisms → cellular organisms → Archaea | 4747 | Open in IMG/M |
| 3300033412|Ga0310810_10247232 | All Organisms → cellular organisms → Archaea | 1965 | Open in IMG/M |
| 3300033412|Ga0310810_11349910 | All Organisms → cellular organisms → Archaea | 553 | Open in IMG/M |
| 3300034681|Ga0370546_031112 | All Organisms → cellular organisms → Archaea | 759 | Open in IMG/M |
| 3300034818|Ga0373950_0071061 | All Organisms → cellular organisms → Archaea | 713 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.78% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.78% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.89% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 2.89% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.31% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.31% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.58% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908021 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk Soil | Environmental | Open in IMG/M |
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Host-Associated | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300002090 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA | Environmental | Open in IMG/M |
| 3300002896 | Soil microbial communities from Manhattan, Kansas, USA - Sample 300um Nextera | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005269 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk Soil | Environmental | Open in IMG/M |
| 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026750 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BSRL3_00196070 | 2124908021 | Switchgrass Rhizosphere | MDALISYAIVIGAFIAFAAILFGSRAKRVAKKKESPVGTPEEIKHSPA |
| Iowa-Corn-GraphCirc_00095570 | 2140918013 | Soil | MDAPISYAIVAGVFIALAVICFVARAKRRAPKKETPKRSAEQIKHSPA |
| SwRhRL3b_0381.00001110 | 2162886006 | Switchgrass Rhizosphere | MDALISYAIVIGAFIVFAAILFGSRAKRVAKKKESPVGTPEEIKHSPA |
| SwRhRL2b_0001.00006470 | 2162886007 | Switchgrass Rhizosphere | MDAPISYAIVIGFFVGLVVILFSARAKRVADKKKETPKGSAEEIKHSPA |
| ARcpr5oldR_0008612 | 3300000041 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPVGSSEEIKHSPA* |
| ICChiseqgaiiFebDRAFT_110176322 | 3300000363 | Soil | MDAPISYAIVAGVFIALAVICFVARAKRRAPKKETPKRSAEQIKHSPA* |
| F14TC_1009623363 | 3300000559 | Soil | MDAPISYAIVIGFFIGLVVILFSARAKRVAGSKKETPVGSAEEIKHSPA* |
| KanNP_Total_noBrdU_T14TCDRAFT_10026391 | 3300000596 | Soil | IGLVVILFSARAKRVAGSKKETPVGSAEEIKHSPA* |
| KanNP_Total_noBrdU_T14TCDRAFT_10082802 | 3300000596 | Soil | MDAPISYAIVFGVFIALVAILFGSRAKRVAKKESPVGTPEEIKHSPA* |
| ARCol0yngRDRAFT_10022632 | 3300000652 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLAPKKETPKRSAEEIKHSPT* |
| JGI11643J12802_119284342 | 3300000890 | Soil | MDAPISYAIVIGFFIGFAAILFGSRAKRLAKKKESPVGTPEQIKHSPA* |
| JGI24737J22298_101046361 | 3300001990 | Corn Rhizosphere | IVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT* |
| JGI24806J26614_10039986 | 3300002090 | Soil | MDAPISYAIVAGVFIALAVICFVARAKRRAPKKETPKRSAEEIKHSPA* |
| JGI24806J26614_10114682 | 3300002090 | Soil | MDAPISYAIVIGFFIGLVVILFSARAKRVAGTKKETPKGSTEEIKHSPA* |
| JGI24802J43972_10197602 | 3300002896 | Soil | FVYYIIKSMDALISYAIVFGVFIAFVAILFGSRAKRLAKKESPVGTPEEIKHSPA* |
| JGIcombinedJ43975_1000027410 | 3300002899 | Soil | SFVYYIIKSMDALISYAIVFGVFIAFVAILFGSRAKRLAKKESPVGTPEEIKHSPA* |
| JGIcombinedJ43975_100066381 | 3300002899 | Soil | DAPISYAIVAGVFIALAVICFVARAKRRAPKKETPKRSAEEIKHSPA* |
| Ga0063356_1005999905 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDAPISYAIVLGVFIALVAILFASRAKRKRVAKKETPAQSPEEIKHSPA* |
| Ga0062595_1006244482 | 3300004479 | Soil | MADALISYTIVIGVFIGFVAILFGSRAKRVAKKKESPVGTPEEIKHSTA* |
| Ga0066812_10019142 | 3300005105 | Soil | MADALISYAIVIGVFIGFVAILFGSRAKRVAKKKESPVGTPEEIKHSTA* |
| Ga0066807_10203172 | 3300005161 | Soil | FVYYTIKSMADALISYAIVIGVFIGFVAILFGSRAKRVAKKKESPVGTPEEIKHSTA* |
| Ga0066809_100004888 | 3300005168 | Soil | MDAPISYAIVIGFFIGLVVIFFSARAKRVADKKKETPKGSAEEIKHSPA* |
| Ga0066810_100083931 | 3300005169 | Soil | ISYAIVIGFFIGLVVILFSARAKRVADKKKETPKGSAEEIKHSPA* |
| Ga0066676_100812342 | 3300005186 | Soil | MADALISYAIVIGVFIAFVAILFGSRAKRLAKKESPVGTPEKIKHSPA* |
| Ga0066676_106498652 | 3300005186 | Soil | MADALISYAIVIGAFIAFAAILFGSRAKRLAKKESPVGTPEEIKHSPA* |
| Ga0065706_10001659 | 3300005269 | Switchgrass Rhizosphere | MADALISYAIVIGAFIAFAAILFGSRAKRVAKKKESPVGTPEEIKHSPA* |
| Ga0065706_10012421 | 3300005269 | Switchgrass Rhizosphere | SFVYYIIKSMADALISYAIVIGVFIGLVAILFGSRAKRVAKKKESPLGTPEEIKHSTA* |
| Ga0065706_10018123 | 3300005269 | Switchgrass Rhizosphere | MDAPISYAIVIGFFVGLVVILFSARAKRVADKKKETPKGSAEEIKHSPA* |
| Ga0065717_10029593 | 3300005276 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSPA* |
| Ga0065717_10034612 | 3300005276 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT* |
| Ga0065716_10063092 | 3300005277 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0065704_100165382 | 3300005289 | Switchgrass Rhizosphere | MDALISYAIVIGAFIAFAAILFGSRAKRVAKKKESPVGTPEEIKHSPX* |
| Ga0065704_100883172 | 3300005289 | Switchgrass Rhizosphere | VYYIIKSMADALISYAIVIGVFIGLVAILFGSRAKRVAKKKESPLGTPEEIKHSTA* |
| Ga0065715_100890242 | 3300005293 | Miscanthus Rhizosphere | MDAPISYAIVASVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0065705_100000119 | 3300005294 | Switchgrass Rhizosphere | MDALISYAIVIGAFIAFAAILFGSRAKRVAKKKESPVGTPEEIKHSPA* |
| Ga0065705_100064811 | 3300005294 | Switchgrass Rhizosphere | MADALISYAIVIGVFIGLVAILFGSRAKRVAKKKESPLGTPEEIKHSTA* |
| Ga0065705_102370331 | 3300005294 | Switchgrass Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVAGKKKETPVGSAEEIKHSPA* |
| Ga0065705_106761541 | 3300005294 | Switchgrass Rhizosphere | MDALISYAIVFGVFIAFVAILFGSRAKRLSKKKESPVGTPEEIKHSPA* |
| Ga0065707_1000003410 | 3300005295 | Switchgrass Rhizosphere | VYYIIKSMDALISYAIVIGAFIXFAAILFGSRAKRVAKKKESPVGTPEEIKHSPA* |
| Ga0070676_100051797 | 3300005328 | Miscanthus Rhizosphere | MDVPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0068868_1001389964 | 3300005338 | Miscanthus Rhizosphere | VAGVFIAFAVICFAARAKRVAPKKEKPIGSPEEMKRSPA* |
| Ga0070687_1000179397 | 3300005343 | Switchgrass Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEELKHSPT* |
| Ga0070673_1008036711 | 3300005364 | Switchgrass Rhizosphere | SYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT* |
| Ga0070663_1016767361 | 3300005455 | Corn Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAE |
| Ga0068867_1001099514 | 3300005459 | Miscanthus Rhizosphere | VAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0068853_1001809924 | 3300005539 | Corn Rhizosphere | VASVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0070672_1000130671 | 3300005543 | Miscanthus Rhizosphere | MDAPISYAIVASVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSPA* |
| Ga0070672_1002710413 | 3300005543 | Miscanthus Rhizosphere | LAGVFIALAVICFGARAKRVAPKKKPIGIAEGKRSPA* |
| Ga0070695_1001566811 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKH |
| Ga0070702_1001774172 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARVKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0070702_1004616333 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT* |
| Ga0081455_100013634 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDALISYAIVVGFFTGFVAILFGSRAKRVARKESPVGTPEEIKHPPA* |
| Ga0081455_1000426311 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDALISYAIVAGFLIGFAVICFAARGKRLAPKKETPKGSAEEIKHSPA* |
| Ga0081455_104561892 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDSPLSYAIVAGFFIGFAVILFSARAKRVAGKKKETPKGSAEEIKHSPA* |
| Ga0081455_107984201 | 3300005937 | Tabebuia Heterophylla Rhizosphere | YMDAPISYAIVTGIFIALLVICLAARAKRVASKKEPPKSSAEEIKHSPA* |
| Ga0075417_100010625 | 3300006049 | Populus Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVAGKKKETPTGSAEEIKHSTA* |
| Ga0075417_100943721 | 3300006049 | Populus Rhizosphere | YMDAPISYAIVIGFFIGLVVILFSARAKRVGGKKKETPTGSAEEIKHSPA* |
| Ga0075432_100071171 | 3300006058 | Populus Rhizosphere | SYAIVIGFFIGLVVILFSARAKRVGGKKKETPTGSAEEIKHSPA* |
| Ga0075422_101775671 | 3300006196 | Populus Rhizosphere | APISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT* |
| Ga0075428_1001236543 | 3300006844 | Populus Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVGGKKKETPTGSAEEIKHSPA* |
| Ga0075421_1004854363 | 3300006845 | Populus Rhizosphere | YMDAPISYAIVIGFFIGLVVILFSARAKRVAGKKKETPTGSAEEIKHSTA* |
| Ga0075430_1010094552 | 3300006846 | Populus Rhizosphere | ISYAIVIGFFIGLVVILFSARAKRVAGKKKETPTGSAEEIKHSTA* |
| Ga0075433_103995611 | 3300006852 | Populus Rhizosphere | MDSPLSYAIVAGFFIGFAVILFSARAKRITGKKKETRVGSAEEIKHSPA* |
| Ga0075425_1023673451 | 3300006854 | Populus Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVADKKKETPKGSAEEIKHSPS* |
| Ga0068865_1000647471 | 3300006881 | Miscanthus Rhizosphere | YAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0075424_1000498641 | 3300006904 | Populus Rhizosphere | PISYAIVIGFFIGLVVILFSARAKRVAGKKKETPTGSAEEIKHSTA* |
| Ga0075424_1018859341 | 3300006904 | Populus Rhizosphere | MDTPISYAIVIGFFIGLVVILFSARAKRVAGKKKETPTGSAE |
| Ga0075424_1026799732 | 3300006904 | Populus Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVAGKKKETPTGSAE |
| Ga0075419_100895885 | 3300006969 | Populus Rhizosphere | APISYAIVIGFFIGLVVILFSARAKRVGGKKKETPTGSAEEIKHSPA* |
| Ga0105244_101908062 | 3300009036 | Miscanthus Rhizosphere | MDVPISYAIVAGVFIALAVICFVARAKRLAPKKEMPKRSAEEIKHSPA* |
| Ga0111539_102570383 | 3300009094 | Populus Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLVPKKQTPKRSAEEIKHSPT* |
| Ga0114129_110198182 | 3300009147 | Populus Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVGGKKKETLKGSAEEIKHSPA* |
| Ga0111538_110885303 | 3300009156 | Populus Rhizosphere | PISYAIVIGFFIGLVVILFSARAKRVADKKKETPKGSAEEIKHSPS* |
| Ga0075423_123461352 | 3300009162 | Populus Rhizosphere | AIAIGFFIGLVVILFSARAKRVAGKKKETPTGNAEEIKHSTA* |
| Ga0105242_100739565 | 3300009176 | Miscanthus Rhizosphere | PISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT* |
| Ga0105237_101294315 | 3300009545 | Corn Rhizosphere | YYMDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSPA* |
| Ga0105249_103679613 | 3300009553 | Switchgrass Rhizosphere | VASVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKH |
| Ga0105249_104616202 | 3300009553 | Switchgrass Rhizosphere | YMDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSPEEMKRSPA* |
| Ga0105249_104772461 | 3300009553 | Switchgrass Rhizosphere | SVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0126380_117932411 | 3300010043 | Tropical Forest Soil | MADAPISYAIVAGVLIAFAVICFAGRAKRVAPKKEKPVGSAEEIKHS |
| Ga0126377_103872141 | 3300010362 | Tropical Forest Soil | YAIVAGVLIAFAVICFAARAKRVAPKKEKPVGSAEEIKHSPA* |
| Ga0105239_103267961 | 3300010375 | Corn Rhizosphere | AGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0137369_100138727 | 3300012355 | Vadose Zone Soil | MDALISYAIVFGVFIAFVAILFGSRAKRLAKKESPVGTPEKIKHSPA* |
| Ga0157340_10042681 | 3300012473 | Arabidopsis Rhizosphere | MDAPISYAIVACVFIALAVICIVARAKRLAPKKETPKRSAEEIKHSPA* |
| Ga0157356_10000504 | 3300012474 | Unplanted Soil | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEMNRSPA* |
| Ga0157336_10063153 | 3300012477 | Arabidopsis Rhizosphere | MDAPISYAIVAFVFIALAVICFVARAKRLAPKKETPKRSAEEIKHSPT* |
| Ga0157346_10128052 | 3300012480 | Arabidopsis Rhizosphere | YYMDAPISYAVLSGIFIAFAVICFAARAKRVAPKKEKPMESAEEMKRSPA* |
| Ga0157346_10150051 | 3300012480 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSPEEMKRSPT* |
| Ga0157337_10027382 | 3300012483 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPVGSSEELKHSPA* |
| Ga0157321_10001446 | 3300012487 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLAPKKETPKRSAEEIKHSPA* |
| Ga0157335_10005203 | 3300012492 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPA* |
| Ga0157355_10005091 | 3300012493 | Unplanted Soil | MDAPISYAIVAGVFIALAVICFVARAKRVAPKKETPKRSAEEIKHSPA* |
| Ga0157355_10308711 | 3300012493 | Unplanted Soil | YYMDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0157350_10004811 | 3300012499 | Unplanted Soil | ISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0157351_10000831 | 3300012501 | Unplanted Soil | DAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0157313_10497021 | 3300012503 | Arabidopsis Rhizosphere | AGVFFALAVICFVARAKRLAPKKETPKRTAEEIKHSPA* |
| Ga0157316_10579951 | 3300012510 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPMGSAEEMKHSPA* |
| Ga0157327_10033361 | 3300012512 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIALAVICFVARTKRLAPKKETPKRSAEEIKHSPT* |
| Ga0126375_100027624 | 3300012948 | Tropical Forest Soil | MDAPISYAIVAGVLIAFAVICFAARAKRLAPEKKTPKSSAEEIKHSPA* |
| Ga0126375_100268591 | 3300012948 | Tropical Forest Soil | MDAPISYAIVAGVLIAFAVICFAGRAKRVAPKKEKPVGSAEEIKHSPA* |
| Ga0126375_105445622 | 3300012948 | Tropical Forest Soil | MDAPISYAIVAGVLIAFAVICFAARAKRIAPKKEKPVGSAEEIKHSPA* |
| Ga0164300_100425791 | 3300012951 | Soil | GVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSPA* |
| Ga0164300_100956374 | 3300012951 | Soil | MDAPISYAIVAGVFIALAVICFVARAKRLALKKETPKRSAEEIKHSPT* |
| Ga0164301_106476451 | 3300012960 | Soil | MDAPISYAIVASVFIAFAVICFAARAKRVAPKKEKPIESAEEMNRSPA* |
| Ga0164309_100337332 | 3300012984 | Soil | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKTIENAEEMKRSPA* |
| Ga0164309_100462275 | 3300012984 | Soil | APISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA* |
| Ga0164308_102918301 | 3300012985 | Soil | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEKMNRSPA* |
| Ga0157371_100188521 | 3300013102 | Corn Rhizosphere | ISYAIVAGVFIALAVICFVARAKRLVPKQETPKRSAEEIKHSPT* |
| Ga0157372_102611071 | 3300013307 | Corn Rhizosphere | MDAPISYAIVAGVFIALAVICFVARSKRLVPKKETPKRSAEEIKHSPT* |
| Ga0157372_107699022 | 3300013307 | Corn Rhizosphere | YYYMDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSPA* |
| Ga0132258_110475121 | 3300015371 | Arabidopsis Rhizosphere | ISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKRSPA* |
| Ga0132258_113486883 | 3300015371 | Arabidopsis Rhizosphere | VIGFFIGLVVILFSARAKRVAGKKKETPTGSAEEIKHSTA* |
| Ga0132258_124031181 | 3300015371 | Arabidopsis Rhizosphere | SYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSPEEMKRSPT* |
| Ga0132256_1001804702 | 3300015372 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLPPKKETPKRSAEEIKHSPA* |
| Ga0132256_1030857512 | 3300015372 | Arabidopsis Rhizosphere | VAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKRSPA* |
| Ga0132256_1037029141 | 3300015372 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLALKKETPKRSAEEIKNSPT* |
| Ga0132257_1005374273 | 3300015373 | Arabidopsis Rhizosphere | GVFIAFAVICFAARAKRVAPKKEKPVGSSEEIKHSPA* |
| Ga0132257_1036446871 | 3300015373 | Arabidopsis Rhizosphere | PISYAIVAGVFIALAVICFVARAKRLAPKKETPKRSAEEIKHSPA* |
| Ga0132255_1003098321 | 3300015374 | Arabidopsis Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEM |
| Ga0134112_101013742 | 3300017656 | Grasslands Soil | MDALISYAIVFGVFIAFAAILFGSRAKRVAKKESPVGTPEEIKHSPA |
| Ga0163161_104691532 | 3300017792 | Switchgrass Rhizosphere | IVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT |
| Ga0184604_100023013 | 3300018000 | Groundwater Sediment | MDALISYAIVIGFFIAFVAILFGSRAKRLANKKESPVGTPEKIKHSPA |
| Ga0184605_100163423 | 3300018027 | Groundwater Sediment | MADALISYAIVIGAFIAFAAILFGSRAKRLAKKKESPVGTPEEIKHSPA |
| Ga0184638_11584051 | 3300018052 | Groundwater Sediment | MADALISYAIVTGVFIALVVILFASRAKRLAGKKETPVGTAEEIKHSPA |
| Ga0184623_102386152 | 3300018056 | Groundwater Sediment | MADALISYAIVIGAFIAFAAILFGSRAKRVAKKESPVGTPEEIK |
| Ga0184635_102725182 | 3300018072 | Groundwater Sediment | MADALISYAIVIGAFIAFAAILFGSRAKRLAKKESPVGTPEEIKHSPA |
| Ga0184640_100200673 | 3300018074 | Groundwater Sediment | MADALVSYAIVIGAFIAFAAILFGSRAKRVAKKESPVGTPEEIKHSPA |
| Ga0184639_100670961 | 3300018082 | Groundwater Sediment | DALISYAIVIGAFIAFAAILFGSRAKRVAKKESPVGTPEEIKHSPA |
| Ga0190269_105925332 | 3300018465 | Soil | MDALISYAIVFGFFIAFAAILFGSRAKRVAKNKESPVGTPEKIKHSPA |
| Ga0184645_11245141 | 3300019233 | Groundwater Sediment | IKSMADALISYAIVIGAFIAFAAILFGSRAKRLAKKESPVGTPEEIKHSPA |
| Ga0184642_15729922 | 3300019279 | Groundwater Sediment | ALISYAIVIGFFIAFVAILFGSRAKRLANKKESPVGTPEKIKHSPA |
| Ga0193705_10822531 | 3300019869 | Soil | MADALISYAIVIGAFIAFAAILFGSRAKRVAKKESPVGTPEEIKHSPA |
| Ga0210382_100402401 | 3300021080 | Groundwater Sediment | MDALISYAIVIGFFIAFVAILFGSRAKRLANKKESPVGTP |
| Ga0193719_1000035411 | 3300021344 | Soil | VYYIIKSIADALISYAIVIGAFIAFAAILFGSRAKRLAKKESPVGTPEEIKHSPA |
| Ga0207697_100060418 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIKHSPT |
| Ga0207697_100184222 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA |
| Ga0207688_100007199 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAPISYAIVAGVFIALAVICFVARAKRLAPKKETPKRSAEEIKHSPT |
| Ga0207645_100004275 | 3300025907 | Miscanthus Rhizosphere | VAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA |
| Ga0207671_107030783 | 3300025914 | Corn Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMK |
| Ga0207659_1000109020 | 3300025926 | Miscanthus Rhizosphere | MDAPISYAIVASVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA |
| Ga0207706_100014598 | 3300025933 | Corn Rhizosphere | VASVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA |
| Ga0207704_100527561 | 3300025938 | Miscanthus Rhizosphere | APISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSAEEMKHSPA |
| Ga0207691_100020459 | 3300025940 | Miscanthus Rhizosphere | MDAPISYAIVASVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSPA |
| Ga0207691_100856034 | 3300025940 | Miscanthus Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPVGSSEEIKHSPA |
| Ga0207651_100443401 | 3300025960 | Switchgrass Rhizosphere | LVGVFIALAVICFGARAKRVAPKKEKPVGSSEEIKHSPA |
| Ga0207712_107427981 | 3300025961 | Switchgrass Rhizosphere | MDVPITYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSPEEMKRSPA |
| Ga0207678_115132971 | 3300026067 | Corn Rhizosphere | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSP |
| Ga0209470_10237952 | 3300026324 | Soil | MADALISYAIVIGVFIAFVAILFGSRAKRLAKKESPVGTPEKIKHSPA |
| Ga0207483_1018871 | 3300026750 | Soil | MDAPISYAIVIGFFIGFAAILFGSRAKRVAKKKESPVGTPEEIKHSPA |
| Ga0207981_10023056 | 3300027560 | Soil | MDAPISYAIVIGFFIGLVVIFFSARAKRVADKKKETPKGSAEEIKHSPA |
| Ga0209814_100009699 | 3300027873 | Populus Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVAGKKKETPTGSAEEIKHSTA |
| Ga0209814_100824892 | 3300027873 | Populus Rhizosphere | MDALISYAIVFGVFIAFVAILFGSRAKRLSKKKESPVGTPEEIKHSPA |
| Ga0209814_100848901 | 3300027873 | Populus Rhizosphere | SYAIVIGFFIGLVVILFSARAKRVGGKKKETPTGSAEEIKHSPA |
| Ga0209481_100187901 | 3300027880 | Populus Rhizosphere | ISYAIVIGFFIGLVVILFSARAKRVGGKKKETPTGSAEEIKHSPA |
| Ga0207428_100060763 | 3300027907 | Populus Rhizosphere | MDAPISYAIVIGFFIGLVVILFSARAKRVGGKKKETPTGSAEEIKHSPA |
| Ga0209858_10068142 | 3300027948 | Groundwater Sand | MADALISYAIVTGVFIALVVILFASRAKRLRAGKKETPVGTSEEIKHSPA |
| Ga0307287_101785841 | 3300028796 | Soil | VIGAFIAFAAILFGSRAKRVAKKESPVGTPEEIKHSPA |
| Ga0307302_101253281 | 3300028814 | Soil | MADALISYAIVIGAFIAFAAILFGSRAKRVAKKESPVGTPEEIKHSH |
| Ga0307296_100347341 | 3300028819 | Soil | MADALISYAIVIGAFIAFAAILFGSRAKRLAKKKESPVGT |
| Ga0308203_10073161 | 3300030829 | Soil | DALISYAIVIGAFIAFAAILFGSRAKRLAKKKESPVGTPEEIKHSPA |
| Ga0308206_10076431 | 3300030903 | Soil | LISYAIVIGFFIAFVAILFGSRAKRLANKKESPVGTPEKIKHSPA |
| Ga0308190_10181801 | 3300030993 | Soil | ALISYAIVIGAFIAFAAILFGSRAKRLAKKESPVGTPEEIKHSPA |
| Ga0308201_100164162 | 3300031091 | Soil | ISYAIVIGAFIAFAAILFGSRAKRLAKKKESPVGTPEEIKHSPA |
| Ga0310813_106392712 | 3300031716 | Soil | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSPEEMKRS |
| Ga0307469_102309202 | 3300031720 | Hardwood Forest Soil | MADALISYAIVIGVFIGLVAILFGSRAKRVAKKKESPLGTPEEIKHSTA |
| Ga0310900_114248102 | 3300031908 | Soil | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEMNRSPA |
| Ga0307470_102463603 | 3300032174 | Hardwood Forest Soil | LISYAIVIGVFIGLVAILFGSRAKRVAKKKESPLGTPEEIKHSTA |
| Ga0307471_1009196311 | 3300032180 | Hardwood Forest Soil | VGLVVILFSARAKRVADKKKETPKGSAEEIKHSPA |
| Ga0310810_100569514 | 3300033412 | Soil | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIESAEEMKRSPA |
| Ga0310810_102472321 | 3300033412 | Soil | MDAPISYAIVAGVFIAFAVICFAARAKRVAPKKEKPIGSPEEMKRSPT |
| Ga0310810_113499101 | 3300033412 | Soil | MDAPISYAIVAGVFIALAVICFVARAKRLAPKKETPKRSAEEIKHSPA |
| Ga0370546_031112_648_758 | 3300034681 | Soil | AFIAFAAILFGSRAKRLAKKKESPVGTPEEIKHSPA |
| Ga0373950_0071061_581_712 | 3300034818 | Rhizosphere Soil | MDAPISYAIVAGVFIALAVICFVARAKRLVPKKETPKRSAEEIK |
| ⦗Top⦘ |