| Basic Information | |
|---|---|
| Family ID | F034907 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVTAILGGVILTTFSILFYLEDREGGGLYDPDPSASYRYRNRK |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 172 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 41.62 % |
| % of genes near scaffold ends (potentially truncated) | 15.61 % |
| % of genes from short scaffolds (< 2000 bps) | 63.58 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (45.087 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient (20.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.260 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (50.289 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 172 Family Scaffolds |
|---|---|---|
| PF10979 | DUF2786 | 2.33 |
| PF07275 | ArdA | 2.33 |
| PF01541 | GIY-YIG | 1.74 |
| PF04851 | ResIII | 1.74 |
| PF04965 | GPW_gp25 | 1.16 |
| PF12098 | DUF3574 | 1.16 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.16 |
| PF02086 | MethyltransfD12 | 1.16 |
| PF09568 | RE_MjaI | 0.58 |
| PF06685 | DUF1186 | 0.58 |
| PF13508 | Acetyltransf_7 | 0.58 |
| PF07460 | NUMOD3 | 0.58 |
| PF00170 | bZIP_1 | 0.58 |
| PF01555 | N6_N4_Mtase | 0.58 |
| PF13175 | AAA_15 | 0.58 |
| PF04984 | Phage_sheath_1 | 0.58 |
| PF16724 | T4-gp15_tss | 0.58 |
| PF03330 | DPBB_1 | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
|---|---|---|---|
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 2.33 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.16 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.16 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.58 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.58 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.90 % |
| Unclassified | root | N/A | 34.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199907319 | All Organisms → Viruses → Predicted Viral | 2981 | Open in IMG/M |
| 3300001274|B570J13895_1001359 | All Organisms → Viruses → Predicted Viral | 3502 | Open in IMG/M |
| 3300001580|Draft_10278627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 726 | Open in IMG/M |
| 3300001843|RCM34_1011574 | All Organisms → Viruses → Predicted Viral | 1975 | Open in IMG/M |
| 3300001968|GOS2236_1012487 | Not Available | 876 | Open in IMG/M |
| 3300001968|GOS2236_1040037 | Not Available | 539 | Open in IMG/M |
| 3300001968|GOS2236_1047790 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300001968|GOS2236_1054367 | All Organisms → Viruses → Predicted Viral | 2901 | Open in IMG/M |
| 3300001968|GOS2236_1056619 | All Organisms → Viruses → Predicted Viral | 4481 | Open in IMG/M |
| 3300001968|GOS2236_1091981 | All Organisms → Viruses → Predicted Viral | 1871 | Open in IMG/M |
| 3300001968|GOS2236_1092566 | Not Available | 7066 | Open in IMG/M |
| 3300001968|GOS2236_1099829 | Not Available | 861 | Open in IMG/M |
| 3300001968|GOS2236_1103345 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
| 3300002040|GOScombined01_104212405 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300002040|GOScombined01_106686560 | All Organisms → Viruses → Predicted Viral | 2348 | Open in IMG/M |
| 3300002144|M2t2BS2_10184769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5027 | Open in IMG/M |
| 3300002145|S2t7BSb_10650937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5080 | Open in IMG/M |
| 3300002835|B570J40625_100097450 | Not Available | 3656 | Open in IMG/M |
| 3300002835|B570J40625_100233449 | All Organisms → Viruses → Predicted Viral | 1942 | Open in IMG/M |
| 3300004051|Ga0055492_10137038 | Not Available | 575 | Open in IMG/M |
| 3300004481|Ga0069718_15695989 | All Organisms → Viruses → Predicted Viral | 1704 | Open in IMG/M |
| 3300005527|Ga0068876_10064539 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
| 3300005662|Ga0078894_11664682 | Not Available | 524 | Open in IMG/M |
| 3300005739|Ga0076948_1066096 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300005805|Ga0079957_1000157 | Not Available | 56093 | Open in IMG/M |
| 3300005805|Ga0079957_1003023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14466 | Open in IMG/M |
| 3300005805|Ga0079957_1004354 | Not Available | 11767 | Open in IMG/M |
| 3300005805|Ga0079957_1019568 | All Organisms → Viruses → Predicted Viral | 4771 | Open in IMG/M |
| 3300005805|Ga0079957_1028325 | All Organisms → Viruses → Predicted Viral | 3751 | Open in IMG/M |
| 3300005805|Ga0079957_1056068 | All Organisms → Viruses → Predicted Viral | 2374 | Open in IMG/M |
| 3300005805|Ga0079957_1062464 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
| 3300005805|Ga0079957_1337346 | Not Available | 666 | Open in IMG/M |
| 3300006639|Ga0079301_1027311 | All Organisms → Viruses → Predicted Viral | 1945 | Open in IMG/M |
| 3300006810|Ga0070754_10438089 | Not Available | 568 | Open in IMG/M |
| 3300007214|Ga0103959_1197293 | All Organisms → Viruses → Predicted Viral | 3827 | Open in IMG/M |
| 3300007344|Ga0070745_1286821 | Not Available | 589 | Open in IMG/M |
| 3300007538|Ga0099851_1024538 | All Organisms → Viruses → Predicted Viral | 2432 | Open in IMG/M |
| 3300007538|Ga0099851_1255359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 626 | Open in IMG/M |
| 3300007539|Ga0099849_1374412 | Not Available | 503 | Open in IMG/M |
| 3300007541|Ga0099848_1007448 | Not Available | 4928 | Open in IMG/M |
| 3300007541|Ga0099848_1056799 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
| 3300007541|Ga0099848_1063907 | All Organisms → Viruses → Predicted Viral | 1458 | Open in IMG/M |
| 3300007541|Ga0099848_1152486 | Not Available | 854 | Open in IMG/M |
| 3300007960|Ga0099850_1052318 | Not Available | 1740 | Open in IMG/M |
| 3300007973|Ga0105746_1109202 | Not Available | 913 | Open in IMG/M |
| 3300008113|Ga0114346_1046434 | Not Available | 3355 | Open in IMG/M |
| 3300008116|Ga0114350_1000066 | Not Available | 58460 | Open in IMG/M |
| 3300008116|Ga0114350_1046532 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
| 3300008996|Ga0102831_1322547 | Not Available | 511 | Open in IMG/M |
| 3300009111|Ga0115026_11709039 | Not Available | 530 | Open in IMG/M |
| 3300009149|Ga0114918_10489165 | Not Available | 660 | Open in IMG/M |
| 3300009179|Ga0115028_11759605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 537 | Open in IMG/M |
| 3300009218|Ga0103848_1000106 | Not Available | 9073 | Open in IMG/M |
| 3300009218|Ga0103848_1000106 | Not Available | 9073 | Open in IMG/M |
| 3300009218|Ga0103848_1011353 | All Organisms → Viruses → Predicted Viral | 1584 | Open in IMG/M |
| 3300009218|Ga0103848_1043159 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300009218|Ga0103848_1080947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 649 | Open in IMG/M |
| 3300009223|Ga0103850_1001851 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
| 3300009223|Ga0103850_1043887 | Not Available | 543 | Open in IMG/M |
| 3300009239|Ga0103858_10029164 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300009469|Ga0127401_1035035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae | 1447 | Open in IMG/M |
| 3300010299|Ga0129342_1123909 | All Organisms → Viruses | 957 | Open in IMG/M |
| 3300010318|Ga0136656_1180161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 714 | Open in IMG/M |
| 3300010354|Ga0129333_10005223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12172 | Open in IMG/M |
| 3300010354|Ga0129333_10039646 | All Organisms → Viruses → Predicted Viral | 4437 | Open in IMG/M |
| 3300010354|Ga0129333_10064885 | All Organisms → Viruses → Predicted Viral | 3398 | Open in IMG/M |
| 3300010354|Ga0129333_10077388 | All Organisms → Viruses → Predicted Viral | 3087 | Open in IMG/M |
| 3300010354|Ga0129333_10103637 | Not Available | 2628 | Open in IMG/M |
| 3300010354|Ga0129333_10126592 | All Organisms → Viruses → Predicted Viral | 2351 | Open in IMG/M |
| 3300010354|Ga0129333_10150269 | All Organisms → Viruses → Predicted Viral | 2137 | Open in IMG/M |
| 3300010354|Ga0129333_10165292 | All Organisms → Viruses → Predicted Viral | 2026 | Open in IMG/M |
| 3300010354|Ga0129333_10201070 | All Organisms → Viruses → Predicted Viral | 1812 | Open in IMG/M |
| 3300010354|Ga0129333_10224319 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
| 3300010354|Ga0129333_10347864 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
| 3300010354|Ga0129333_10382341 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300010354|Ga0129333_10411152 | All Organisms → Viruses → Predicted Viral | 1196 | Open in IMG/M |
| 3300010354|Ga0129333_10440474 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300010354|Ga0129333_10459619 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300010354|Ga0129333_10479240 | All Organisms → Viruses | 1093 | Open in IMG/M |
| 3300010354|Ga0129333_10700682 | All Organisms → Viruses | 870 | Open in IMG/M |
| 3300010354|Ga0129333_10840752 | Not Available | 780 | Open in IMG/M |
| 3300010354|Ga0129333_10940240 | Not Available | 729 | Open in IMG/M |
| 3300010354|Ga0129333_10957654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage SynMITS9220M01 | 721 | Open in IMG/M |
| 3300010354|Ga0129333_10983219 | Not Available | 710 | Open in IMG/M |
| 3300010354|Ga0129333_11011110 | Not Available | 698 | Open in IMG/M |
| 3300010354|Ga0129333_11294398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 602 | Open in IMG/M |
| 3300010354|Ga0129333_11314941 | Not Available | 597 | Open in IMG/M |
| 3300010354|Ga0129333_11391216 | Not Available | 577 | Open in IMG/M |
| 3300010354|Ga0129333_11693621 | Not Available | 514 | Open in IMG/M |
| 3300010354|Ga0129333_11723660 | Not Available | 509 | Open in IMG/M |
| 3300010354|Ga0129333_11774715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 500 | Open in IMG/M |
| 3300010370|Ga0129336_10041560 | All Organisms → Viruses → Predicted Viral | 2763 | Open in IMG/M |
| 3300010370|Ga0129336_10055132 | All Organisms → Viruses → Predicted Viral | 2372 | Open in IMG/M |
| 3300010370|Ga0129336_10084169 | All Organisms → Viruses → Predicted Viral | 1875 | Open in IMG/M |
| 3300010370|Ga0129336_10196234 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300010370|Ga0129336_10375359 | Not Available | 779 | Open in IMG/M |
| 3300011268|Ga0151620_1000011 | Not Available | 70193 | Open in IMG/M |
| 3300011268|Ga0151620_1112645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 852 | Open in IMG/M |
| 3300012000|Ga0119951_1026235 | All Organisms → Viruses → Predicted Viral | 1979 | Open in IMG/M |
| 3300012968|Ga0129337_1163071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 554 | Open in IMG/M |
| 3300012968|Ga0129337_1275247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 548 | Open in IMG/M |
| 3300012970|Ga0129338_1417182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 868 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10221931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 1171 | Open in IMG/M |
| 3300014050|Ga0119952_1018645 | All Organisms → Viruses → Predicted Viral | 2385 | Open in IMG/M |
| 3300014819|Ga0119954_1001340 | Not Available | 8180 | Open in IMG/M |
| 3300014819|Ga0119954_1004426 | All Organisms → Viruses → Predicted Viral | 3842 | Open in IMG/M |
| 3300018420|Ga0181563_10255732 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300019076|Ga0188856_1000106 | All Organisms → Viruses → Predicted Viral | 1243 | Open in IMG/M |
| 3300020074|Ga0194113_10707339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-H38 | 698 | Open in IMG/M |
| 3300020074|Ga0194113_11123405 | Not Available | 517 | Open in IMG/M |
| 3300020084|Ga0194110_10237987 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300020109|Ga0194112_10633873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-H38 | 723 | Open in IMG/M |
| 3300020159|Ga0211734_10491484 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300020172|Ga0211729_10878481 | All Organisms → Viruses → Predicted Viral | 2861 | Open in IMG/M |
| 3300020193|Ga0194131_10025771 | Not Available | 5194 | Open in IMG/M |
| 3300020214|Ga0194132_10463980 | Not Available | 632 | Open in IMG/M |
| 3300020498|Ga0208050_1000719 | All Organisms → Viruses → Predicted Viral | 4994 | Open in IMG/M |
| 3300021091|Ga0194133_10002598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 27500 | Open in IMG/M |
| 3300021141|Ga0214163_1010446 | All Organisms → Viruses → Predicted Viral | 3096 | Open in IMG/M |
| 3300021376|Ga0194130_10008667 | Not Available | 10738 | Open in IMG/M |
| 3300021379|Ga0213864_10265479 | Not Available | 872 | Open in IMG/M |
| 3300021952|Ga0213921_1004148 | All Organisms → Viruses → Predicted Viral | 3066 | Open in IMG/M |
| 3300021961|Ga0222714_10000308 | Not Available | 58527 | Open in IMG/M |
| 3300021961|Ga0222714_10334060 | Not Available | 820 | Open in IMG/M |
| 3300021961|Ga0222714_10364330 | Not Available | 773 | Open in IMG/M |
| 3300021961|Ga0222714_10543223 | Not Available | 589 | Open in IMG/M |
| 3300021962|Ga0222713_10558456 | Not Available | 675 | Open in IMG/M |
| 3300021963|Ga0222712_10140698 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300021963|Ga0222712_10152416 | All Organisms → Viruses → Predicted Viral | 1558 | Open in IMG/M |
| 3300021963|Ga0222712_10320999 | Not Available | 964 | Open in IMG/M |
| 3300022198|Ga0196905_1023341 | All Organisms → Viruses → Predicted Viral | 1915 | Open in IMG/M |
| 3300022198|Ga0196905_1140670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 625 | Open in IMG/M |
| 3300022200|Ga0196901_1279166 | Not Available | 509 | Open in IMG/M |
| 3300022747|Ga0228703_1055374 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300022748|Ga0228702_1003480 | Not Available | 8245 | Open in IMG/M |
| 3300022748|Ga0228702_1026391 | All Organisms → Viruses → Predicted Viral | 1820 | Open in IMG/M |
| 3300022752|Ga0214917_10004615 | Not Available | 15220 | Open in IMG/M |
| 3300022752|Ga0214917_10015135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6721 | Open in IMG/M |
| 3300022752|Ga0214917_10039449 | All Organisms → Viruses → Predicted Viral | 3376 | Open in IMG/M |
| 3300022752|Ga0214917_10358959 | Not Available | 619 | Open in IMG/M |
| 3300023174|Ga0214921_10138243 | All Organisms → Viruses → Predicted Viral | 1693 | Open in IMG/M |
| 3300024262|Ga0210003_1017841 | Not Available | 4440 | Open in IMG/M |
| 3300024262|Ga0210003_1217387 | Not Available | 773 | Open in IMG/M |
| 3300025646|Ga0208161_1000015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 83104 | Open in IMG/M |
| 3300027547|Ga0209864_1043853 | Not Available | 575 | Open in IMG/M |
| 3300027762|Ga0209288_10005349 | All Organisms → Viruses → Predicted Viral | 3625 | Open in IMG/M |
| 3300027917|Ga0209536_101229325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 918 | Open in IMG/M |
| 3300031539|Ga0307380_11396677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SCSM1 | 528 | Open in IMG/M |
| 3300031566|Ga0307378_10623753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 941 | Open in IMG/M |
| 3300031669|Ga0307375_10240281 | All Organisms → Viruses | 1191 | Open in IMG/M |
| 3300031707|Ga0315291_10517318 | All Organisms → Viruses → Predicted Viral | 1103 | Open in IMG/M |
| 3300031758|Ga0315907_10059782 | All Organisms → Viruses → Predicted Viral | 3325 | Open in IMG/M |
| 3300031857|Ga0315909_10712434 | Not Available | 649 | Open in IMG/M |
| 3300031951|Ga0315904_10191199 | All Organisms → Viruses | 2021 | Open in IMG/M |
| 3300031999|Ga0315274_11013619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 847 | Open in IMG/M |
| 3300033418|Ga0316625_100150069 | All Organisms → Viruses → Predicted Viral | 1437 | Open in IMG/M |
| 3300033521|Ga0316616_101664247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 834 | Open in IMG/M |
| 3300033557|Ga0316617_100146185 | All Organisms → Viruses → Predicted Viral | 1784 | Open in IMG/M |
| 3300033557|Ga0316617_100333003 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300033816|Ga0334980_0354298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 561 | Open in IMG/M |
| 3300033981|Ga0334982_0043058 | All Organisms → Viruses → Predicted Viral | 2527 | Open in IMG/M |
| 3300033994|Ga0334996_0002381 | Not Available | 12815 | Open in IMG/M |
| 3300034012|Ga0334986_0040880 | All Organisms → Viruses → Predicted Viral | 3000 | Open in IMG/M |
| 3300034062|Ga0334995_0055717 | All Organisms → Viruses → Predicted Viral | 3197 | Open in IMG/M |
| 3300034063|Ga0335000_0580664 | Not Available | 633 | Open in IMG/M |
| 3300034066|Ga0335019_0047423 | All Organisms → Viruses → Predicted Viral | 2946 | Open in IMG/M |
| 3300034072|Ga0310127_088911 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300034101|Ga0335027_0029474 | All Organisms → Viruses → Predicted Viral | 4597 | Open in IMG/M |
| 3300034102|Ga0335029_0763281 | Not Available | 515 | Open in IMG/M |
| 3300034109|Ga0335051_0038002 | All Organisms → Viruses → Predicted Viral | 2602 | Open in IMG/M |
| 3300034272|Ga0335049_0134977 | All Organisms → Viruses → Predicted Viral | 1774 | Open in IMG/M |
| 3300034272|Ga0335049_0213605 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
| 3300034355|Ga0335039_0172796 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 20.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.98% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.83% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.20% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 4.62% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 4.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.73% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.73% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.73% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.73% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.16% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.16% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.16% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.58% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.58% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.58% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.58% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.58% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.58% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.58% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.58% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.58% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.58% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.58% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.58% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.58% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001274 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002145 | S2t7BSb (114f) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009223 | Microbial communities of water from Amazon river, Brazil - RCM3 | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019076 | Metatranscriptome of marine microbial communities from Baltic Sea - GS683_0p8 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200087970 | 2199352004 | Freshwater | MSALILGGVIISTFLTMFYLEDRDGGGIYDPDPSASYRNRNRK |
| B570J13895_10013599 | 3300001274 | Freshwater | MSTLILGGVIISTFLTMFYLEDRDGGGIYDPDPSASYRNRNRK* |
| Draft_102786272 | 3300001580 | Hydrocarbon Resource Environments | MITLAIGGGIITLFSILFYLEDREGGGIYDPDPSASYRYNQSKIK* |
| RCM34_10115741 | 3300001843 | Marine Plankton | TAIVGGVILATFGVMFYLDDRAGGGLYDPDPSASDRYRRNRK* |
| GOS2236_10124873 | 3300001968 | Marine | MITAIVGGVILTTFGIMFYLDDRMGGGLYDPDSTAFDRYRRNRK* |
| GOS2236_10400373 | 3300001968 | Marine | MITTIVGGVILATFGIMFYLDDRMGGGLYDPDPSAFDRHRRNRK* |
| GOS2236_10477902 | 3300001968 | Marine | MITAILGGVILATFGVMFYLDDRAGGGLYDPDPSASDRYRRNRK* |
| GOS2236_10543675 | 3300001968 | Marine | MITAIVGGVILSTFGIMFYLDDRMGGGLYDPDPTASDRYRNRK* |
| GOS2236_10566199 | 3300001968 | Marine | MITAIVGGVILTTFGIMFYLDDRMGGGLYDPDPTAFDRYRKNRK* |
| GOS2236_10919812 | 3300001968 | Marine | MITAIVGGIILATFGVMFYLDDRAGGGLYDPDPSASDRYRNHK* |
| GOS2236_10925666 | 3300001968 | Marine | MVTAILGGVILTTFSILFYLEDREGGGLYDPDPSASYRYRNRK* |
| GOS2236_10998293 | 3300001968 | Marine | MITAILGGVILTTFCTMFYLDARDGGGLYDPDPSASARYKQLKKK* |
| GOS2236_11033453 | 3300001968 | Marine | MVTAIVGGVILATFGIMFYLDDRDGGGLYDPDPSASDRYRNRK* |
| GOScombined01_1042124051 | 3300002040 | Marine | IVGGVILATFGVMFYLDDRAGGGLYDPDPSASDRYRRNRK* |
| GOScombined01_1066865606 | 3300002040 | Marine | MITAIVGGVILSTFGIMFYPDDRMGGGLYDPDPTASDRYRNRK* |
| M2t2BS2_101847691 | 3300002144 | Marine | MITLAIGGGIITLFSILFYLEDRDGVGIYDPDPSASYRHNQKRKN |
| S2t7BSb_1065093720 | 3300002145 | Marine | MITLAIGGGIITLFSILFYLEDRDGVGIYDPDPSASYRHNQKRKNRN* |
| B570J40625_1000974504 | 3300002835 | Freshwater | MITAILGGVILTTFSIMFYLDDREGGGLYDPDPRSSYYHQKHK* |
| B570J40625_1002334492 | 3300002835 | Freshwater | MSALILGGVIISTFLTMFYLEDRDGGGIYDPDPSASYRNRNRK* |
| Ga0055492_101370382 | 3300004051 | Natural And Restored Wetlands | MVMGTLILSAGIVAMFCTLFYLEDRDGGGLYDPDPSASFRYRNRK* |
| Ga0069718_156959894 | 3300004481 | Sediment | MITAIIGVTIVTTFCVMFVLEDRDGVGVYDPDPSASDRHRNRNK* |
| Ga0068876_100645395 | 3300005527 | Freshwater Lake | MLILGGFIVTMFAFLFYLEDRSGGGLYDPDPSASYRHKKSKK* |
| Ga0078894_116646823 | 3300005662 | Freshwater Lake | MITLAIGFGILPFLVMFWLEDRYGGGVYDPDPSADFRHRKNK |
| Ga0076948_10660963 | 3300005739 | Lake Water | MITVILGGVILSTFSILWYLEDREGGGLYDPDPTAFDRYRRNRK* |
| Ga0079957_100015751 | 3300005805 | Lake | MITLAIGGVIVTIFCTMFYLEDRDGGGLYDPDPSASYRYKNSKTKV* |
| Ga0079957_100302332 | 3300005805 | Lake | MITLAIAGVILTTFSIMFYLEDRDGGGGGLYDPDPSASYRHKQSR* |
| Ga0079957_100435415 | 3300005805 | Lake | MITAILGGVILSTLGIMFYLEDRDGGGLYDPDPTASERYRKRK* |
| Ga0079957_101956813 | 3300005805 | Lake | MITAIVGGVILATFGIMFYLDDRMGGGLYDPDPTAFDRYRRNRK* |
| Ga0079957_10283258 | 3300005805 | Lake | MITLVIGGVILSTFCIMFYLEDREGGGIYDPDPSASYRHYNPKK* |
| Ga0079957_10560684 | 3300005805 | Lake | MITAIVGGIILTAFSVLWYLEDREGGGLYDPDPSASDRYRRNRK* |
| Ga0079957_10624646 | 3300005805 | Lake | MITAIVGGIILTTFGVMFYLDDRAGGGLYDPDPTASDRYRKHK* |
| Ga0079957_13373461 | 3300005805 | Lake | MIIFGGFSILIFLLLFYLEDRDGGGLYDPDPSASYRHRKLKK* |
| Ga0079301_10273113 | 3300006639 | Deep Subsurface | MITAILGGVILSTFSLLWYLEDREGGGLYDPDPRSSYYHRKHK* |
| Ga0070754_104380893 | 3300006810 | Aqueous | MITMLIGGVILSTFEVLFYLEDRDGGGVYDPDPSAFYRHRNRKI* |
| Ga0103959_11972932 | 3300007214 | Freshwater Lake | MITAILGGVILSTFSILWYLEDREGGGLYDPDPTAFDRYRRNRK* |
| Ga0070745_12868211 | 3300007344 | Aqueous | GGVILSTFEVLFYLEDRDGGGVYDPDPSAFYRHRNRKI* |
| Ga0099851_10245388 | 3300007538 | Aqueous | MITAILGGVILATFSLLWYLEDREGGGLYDPDPTASDRYRRNRK* |
| Ga0099851_12553591 | 3300007538 | Aqueous | GGVILTAFSVLWYLEDREGGGLYDPDPTASDRYRNLNK* |
| Ga0099849_13744121 | 3300007539 | Aqueous | MITAILGGVILSTFSFLWYLEDREGGGLYDPDPTASDRYRRNRKS* |
| Ga0099848_100744811 | 3300007541 | Aqueous | MIIFGGVLISIFLLLFYLEDRDGGGLYDPDPSASYRHRKLKK* |
| Ga0099848_10567995 | 3300007541 | Aqueous | MITAILGGVILTAFSVLWYLEDRDGGGLYDPDPTASDRYRNLNK* |
| Ga0099848_10639072 | 3300007541 | Aqueous | MITAIVGGVILATFSLLWYLEDREGGGLYDPDPTASDRYRRNRK* |
| Ga0099848_11524862 | 3300007541 | Aqueous | MTLTSLVILATFSLLWYLEDREGGGLYDPDPTASDRYRRNRK* |
| Ga0099850_10523186 | 3300007960 | Aqueous | MIIFGGVLISIFLLLFYLEDRDDGGLYDPDPSASYRHRKLK |
| Ga0105746_11092024 | 3300007973 | Estuary Water | MITAIVGGVILTTFGVMFYLDDRAGGGLYDPDPSASDRYRRNK* |
| Ga0114346_10464342 | 3300008113 | Freshwater, Plankton | MIILGAVIIFVFLCMFYLEDRCGGGLYDPDPSASFRHKANKKRR* |
| Ga0114350_100006652 | 3300008116 | Freshwater, Plankton | MITLVIGGVIVSAFLILFYLEDKDGGGLYDPDPSASYRHKKSNK* |
| Ga0114350_10465325 | 3300008116 | Freshwater, Plankton | MLILGGFILTMFAFLFYLEDRSGGGLYDPDPSASYRHKKSKK* |
| Ga0102831_13225472 | 3300008996 | Estuarine | MITAILGGVILTAFSVLWYLEDREGGGLYDPDPTASDRYRNLNK* |
| Ga0115026_117090393 | 3300009111 | Wetland | MITLAIGGVILTTFSIMFYLEDRDGGGLYDPDPSASYRHKQSR* |
| Ga0114918_104891652 | 3300009149 | Deep Subsurface | MGTLIIGAVVITLFGTLFYLEDRDGGGLYDPDPSASFRYNNRKTK* |
| Ga0115028_117596052 | 3300009179 | Wetland | MITLAVGGVILSIFCTMFYLEDRDGGGLYDPDPSASYRYKNSKKVSTN* |
| Ga0103848_100010632 | 3300009218 | River Water | MITAILGGVILSTFGIMFYLEDRMGGGMYDPDPSASYRYRNQNKK* |
| Ga0103848_10001064 | 3300009218 | River Water | MVTAILGGVILATFSVMFYIEDRMGGGVYDPDPRPKHKRR* |
| Ga0103848_10113534 | 3300009218 | River Water | MVTAILGGVILSTFGIMFYLEDRMGGGLYDPDPSASYRYRQRHKKR* |
| Ga0103848_10431592 | 3300009218 | River Water | MVTAILGGVILSTFSILFYMEKRMGCGVYDPDPSASDRYRRNRK* |
| Ga0103848_10809473 | 3300009218 | River Water | MVTAILGGVILSTFGIMFYLEDRMGGGLYDPDPSASYRYRQRNKKR* |
| Ga0103850_10018518 | 3300009223 | River Water | ILGGVILSTFGIMFYLEDRMGGGLYDPDPSASYRYRQRNKKR* |
| Ga0103850_10438873 | 3300009223 | River Water | ILGGVILSTFGIMFYLEDRMGGGLYDPDPSASYRYRQRHKKR* |
| Ga0103858_100291645 | 3300009239 | River Water | MITAIVGGVILATFGVMFYLDDRAGGGLYDPDPSASDRYRRNRK* |
| Ga0127401_10350353 | 3300009469 | Meromictic Pond | MITLAIGGGIITLFSILFYLEDRDGGGIYDPDPSASYRHNQKRKNHN* |
| Ga0129342_11239091 | 3300010299 | Freshwater To Marine Saline Gradient | MITAIIGGVVLSALSLLWYLEDREGAGVYDPDPTASYRYKQSKKK* |
| Ga0136656_11801612 | 3300010318 | Freshwater To Marine Saline Gradient | MITAILGGVILSTFFILFYLEDREGGGLYDPDPSASFRYRNRK* |
| Ga0129333_100052235 | 3300010354 | Freshwater To Marine Saline Gradient | MIIFGGFLISIFLLLFYLEDRDGGGLYDPDPSASYRHRKLKK* |
| Ga0129333_1003964612 | 3300010354 | Freshwater To Marine Saline Gradient | MITAIVGGVILTTFFVLFYLEDRDGGGLYDPDPTASDRYKQSKKK* |
| Ga0129333_100648857 | 3300010354 | Freshwater To Marine Saline Gradient | MSALILGGVIISTFLTMFYLEDRDGGGIYDSDPSASYRHRNRK* |
| Ga0129333_1007738811 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAIIGGIILTTFSVMFYLDDRMGGGLYDPDPSASDRYRQQHKQR* |
| Ga0129333_101036372 | 3300010354 | Freshwater To Marine Saline Gradient | MITAILGGVILATFGTMFYLEDRDGAGLYDPDPTASYRYQQSKKK* |
| Ga0129333_101265928 | 3300010354 | Freshwater To Marine Saline Gradient | MITAILGGVILATFSILFYLDDRAGGGLYDPDPTASDRYRKHK* |
| Ga0129333_101502694 | 3300010354 | Freshwater To Marine Saline Gradient | MITLVIGGVIFFTFLVLFYLEDRDGGGLYDPDPSASYRYRNRKN* |
| Ga0129333_101652925 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAIIGGVILTAFSVLWYLEDREGAGVYDPDPRSSYYHRKCK* |
| Ga0129333_102010704 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAIVGGIILTTFLVMFYLDDRAGGGLYDPDPSASYRYRQHHKQR* |
| Ga0129333_102243191 | 3300010354 | Freshwater To Marine Saline Gradient | MIALLIGGVIFFTFLILFYLEDRDGGGLYDPDPSASYRHHNRKI* |
| Ga0129333_103478641 | 3300010354 | Freshwater To Marine Saline Gradient | MVTMILGGVIISTFLTMFYLEDRDGGGIYDPDPSA |
| Ga0129333_103823415 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAIVGGIILATFSVMFYLDDRAGGGLYDPDPSASYRYRQQHKQR* |
| Ga0129333_104111521 | 3300010354 | Freshwater To Marine Saline Gradient | MVTLVIGGVILSTFLILFYLEDRDGGGLYDPDPSASYRNKKSNK* |
| Ga0129333_104404742 | 3300010354 | Freshwater To Marine Saline Gradient | MITLVIGGVIFFTFLILFYLEDRGSGGLYDPDPSASYRHKKLNK* |
| Ga0129333_104596196 | 3300010354 | Freshwater To Marine Saline Gradient | IILATFSVMFYLDDRMGGGLYDPDPSASDRYRQQHKQR* |
| Ga0129333_104792402 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAIVGGIILATFSVMFYLEDREGGGLYDPAPSASYRYRQQHKQR* |
| Ga0129333_107006822 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAIVGGIILTTFSVMFYLDDRMGGGLYDPDPSASYRYRQQHKQR* |
| Ga0129333_108407524 | 3300010354 | Freshwater To Marine Saline Gradient | MITAIVGGIILATFGVMFYLDDRAGGGLYDPDPSASDRYRRNK* |
| Ga0129333_109402401 | 3300010354 | Freshwater To Marine Saline Gradient | MVTLVIGGVIFSTFLVLFYLEDRDGGGLYDPDPSASYRHKKKSNK* |
| Ga0129333_109576543 | 3300010354 | Freshwater To Marine Saline Gradient | MITAIVGGVILATFGVMFYLDDRAGGGLYDPDPSASDRYRRNK* |
| Ga0129333_109832193 | 3300010354 | Freshwater To Marine Saline Gradient | MITLVIGGVIFFTFLVHFYLEDRNGGGLYDPDPSASYRHKKKSNK* |
| Ga0129333_110111103 | 3300010354 | Freshwater To Marine Saline Gradient | MITLVIGGVIFFTFLVLFYLEDRDGGGLYDPDPSASYRHRNRKN* |
| Ga0129333_112943983 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAILGGVILTTFGIMFYLDDRAGGGLYDPNPRSSYYHRKHK* |
| Ga0129333_113149413 | 3300010354 | Freshwater To Marine Saline Gradient | MITAIVGGIILATFGVMFYLDDRAGGGLYDPDPTASDRYRRYRRNK* |
| Ga0129333_113912163 | 3300010354 | Freshwater To Marine Saline Gradient | MITAILGGVILSTFGIMFYLDDRAGGGLYDPDPTASDRYRRNK* |
| Ga0129333_116936212 | 3300010354 | Freshwater To Marine Saline Gradient | MITAIVGGIILATFGVMFYLDDRAGGGLYDPNPRSADYHRKHR* |
| Ga0129333_117236602 | 3300010354 | Freshwater To Marine Saline Gradient | MITAILGGVILSTFGIMFYLDDRMGGGLYDPDPTAFDRHRRNRK* |
| Ga0129333_117747152 | 3300010354 | Freshwater To Marine Saline Gradient | MVTAIVGGIVLSTFSLLWYLEDREGGGLYDPDPTASDRYRRNRK* |
| Ga0129336_100415601 | 3300010370 | Freshwater To Marine Saline Gradient | MITLVIGGVIFFTFLVLFYLEDRNGGGLYDPDPSASYRHKKKSNK* |
| Ga0129336_100551326 | 3300010370 | Freshwater To Marine Saline Gradient | MVTVIIGGVILTAFSVLWYLEDREGAGVYDPDPRSSYYHRKCK* |
| Ga0129336_100841696 | 3300010370 | Freshwater To Marine Saline Gradient | MTVLILGGVILTTFAILFYLEDREGGGLYDPDPSASYRYRKNRK* |
| Ga0129336_101962345 | 3300010370 | Freshwater To Marine Saline Gradient | MVTMILGGVIISTFLTMFYLEDRDGGGIYDPDPSAS |
| Ga0129336_103753594 | 3300010370 | Freshwater To Marine Saline Gradient | MISLLIGGVIFFTFLILFYLEDRDGGGLYDPDPSASYRHHNRKI* |
| Ga0151620_100001132 | 3300011268 | Freshwater | MITLVIGGVILSTFATMFYLEDRDGGGLYDPDPSASYRHKKSNK* |
| Ga0151620_11126453 | 3300011268 | Freshwater | MVTLVIGGVIFSTFLTLFYLEDRDGGGLYDPDPSATYRHKKSNK* |
| Ga0119951_10262352 | 3300012000 | Freshwater | MITAIVGGVILATFSIMFYLDDRMGGGLYDPDPTASDRYRKHK* |
| Ga0129337_11630712 | 3300012968 | Aqueous | MTVLILGGVILLTFAILFYLEDREGGGLYDPDPSASYRYRKNRK* |
| Ga0129337_12752473 | 3300012968 | Aqueous | MMVTAIVGGIILATFSVMFYLDDRAGGGLYDPDPSASYRYRQQHKQ |
| Ga0129338_14171822 | 3300012970 | Aqueous | MMVTAIVGGIILATFSVMFYLDDRAGGGLYDPDPSASYRYRQQHKQR* |
| (restricted) Ga0172367_102219313 | 3300013126 | Freshwater | VIVTAILGGVIISTFLTMFYLEDRDGVGVYDPDPSASYRHRNHK* |
| Ga0119952_10186457 | 3300014050 | Freshwater | MITAIVGGVILATFSIMFYLDDRMGGGLYDPDPTAFDRYRKHK* |
| Ga0119954_10013409 | 3300014819 | Freshwater | MITAILGGVILTTFSILFYLEDREGGGLYDPDPSASFRHRNRNK* |
| Ga0119954_10044266 | 3300014819 | Freshwater | MITAILGGVILSIFGVMFYLEDRDGGGLYDPDPSASARYKQLKKK* |
| Ga0181563_102557324 | 3300018420 | Salt Marsh | MITAILGGVILTTFSILFYLEDREGGGLYDPDPSASFRHRNRNK |
| Ga0188856_10001062 | 3300019076 | Freshwater Lake | MITLAIGGGIITLFSILFYLEDRDGVGIYDPDPSASYRHNQKRKNRN |
| Ga0194113_107073391 | 3300020074 | Freshwater Lake | VIVTAILGGVIISTFLTMFYLEDRDGVGVYDPDPSASYRHRNYK |
| Ga0194113_111234051 | 3300020074 | Freshwater Lake | VIVTAILGGAIISTFLTMFYLEDRDGVGVYDPDPSAS |
| Ga0194110_102379876 | 3300020084 | Freshwater Lake | VIVTAILGGAIISTFLTMFYLEDRDGVGVYDPDPSASYRHRNYK |
| Ga0194112_106338733 | 3300020109 | Freshwater Lake | VIVTAILGGVIISTFLTMFYLEDRDGVGVYDPDPSAS |
| Ga0211734_104914842 | 3300020159 | Freshwater | MITLVIGGVIVSAFLILFYLEDKDGGGLYDPDPSASYRHCLF |
| Ga0211729_1087848111 | 3300020172 | Freshwater | MLILGGFIVTMFAFLFYLEDRSGGGLYDPDPSASYRHKQHKNK |
| Ga0194131_1002577111 | 3300020193 | Freshwater Lake | MMIEFMFGIFIITFFCIMFYLEDRSGGGLYDPDPSASYRHKQRRNK |
| Ga0194132_104639802 | 3300020214 | Freshwater Lake | MIEFMFGIFIITFFCIMFYLEDRSGGGLYDPDPSASYRHKQRRNK |
| Ga0208050_10007197 | 3300020498 | Freshwater | MITAILGGVILTTFSIMFYLDDREGGGLYDPDPRSSYYHQKHK |
| Ga0194133_100025988 | 3300021091 | Freshwater Lake | MVTLVIGGVIFSTFLTLFYLEDRDGGGVYDPDPSASYRHKKSNK |
| Ga0214163_10104462 | 3300021141 | Freshwater | MSTLILGGVIISTFLTMFYLEDRDGGGIYDPDPSASYRNRNRK |
| Ga0194130_100086679 | 3300021376 | Freshwater Lake | MVTLVIGGVIFSTFLTLFYLEDRDGGGVYDPDPSASYRHKKSNKCELHF |
| Ga0213864_102654791 | 3300021379 | Seawater | MGTLILGGIIISTFLTMFYLEDRDGGGIYDPDPSAHYRNQFK |
| Ga0213921_10041487 | 3300021952 | Freshwater | MITAILGGVIFSTFCTLFYIEDRMGGGLYDPDPSASFRHRNRK |
| Ga0222714_1000030842 | 3300021961 | Estuarine Water | MITLVIGGVILSTFATMFYLEDRDGGGLYDPDPSASYRHKKSNK |
| Ga0222714_103340603 | 3300021961 | Estuarine Water | MITAILGGVILTTFSVLWYLEDREGGGLYDPDPSASFRYRNLNK |
| Ga0222714_103643304 | 3300021961 | Estuarine Water | MITAIIGGVVLSAFSLLWYLEDREGAGVYDPDPTASYRYKQSKKK |
| Ga0222714_105432233 | 3300021961 | Estuarine Water | MVTLVIGGVIFSTFLTLFYLEDRDGGGLYDPDPSATYRHKKSNK |
| Ga0222713_105584563 | 3300021962 | Estuarine Water | MIVTAILGGVIISTFLTMFYLEDRDGVGVYDPDPSASYRHRNHK |
| Ga0222712_101406987 | 3300021963 | Estuarine Water | MIVTAILGGVIVSTFLTMFYLEDRDGVGVYDPDPSASYRHRNHK |
| Ga0222712_101524163 | 3300021963 | Estuarine Water | MGTLIIGAVVITIFGTLFYLEDRDGGGLYDPDPSASFRHNNRNTK |
| Ga0222712_103209994 | 3300021963 | Estuarine Water | MVTAIVGGIILATFSIMFYLDDRAGGGLYDPDPSASDRYRRNK |
| Ga0196905_10233417 | 3300022198 | Aqueous | MTLTSLVILATFSLLWYLEDREGGGLYDPDPTASDRYRRNRK |
| Ga0196905_11406704 | 3300022198 | Aqueous | MITAILGGVILATFSLLWYLEDREGGGLYDPDPTASD |
| Ga0196901_12791662 | 3300022200 | Aqueous | MITAILGGVILTAFSVLWYLEDRDGGGLYDPDPTASDRYRNLNK |
| Ga0228703_10553744 | 3300022747 | Freshwater | MITAILGGVILATFSIMFYLDDRAGGGLYDPDPRSSYYHRKHK |
| Ga0228702_100348021 | 3300022748 | Freshwater | MITAIVGGVILTTFGIMFYLDDRMGGGLYDPDPTASDRYRKHK |
| Ga0228702_10263912 | 3300022748 | Freshwater | MITAIVGGVILATFSIMFYLDDRAGGGLYDPDPRSSYYHRKHK |
| Ga0214917_1000461517 | 3300022752 | Freshwater | MVTAIVGGIILATFSVMFYLEDRMGGGLYDPDPSASYRYRQRHKQR |
| Ga0214917_1001513515 | 3300022752 | Freshwater | MITAIVGGIILATFSILFYLEDREGGGLYDPDPSASFRHRNRNK |
| Ga0214917_1003944910 | 3300022752 | Freshwater | MITAILGGVILSIFGVMFYLEDRDGGGLYDPDPSASARYKQLKKK |
| Ga0214917_103589592 | 3300022752 | Freshwater | MVTAIVGGIILATFFVMFYLEDRMGGGLYDPDPSASYRYRQRHKQR |
| Ga0214921_101382434 | 3300023174 | Freshwater | MGTLIIGAVVITIFGTLFYLEDRDGGGLYDPDPSASFRHNNRKTK |
| Ga0210003_101784112 | 3300024262 | Deep Subsurface | MGTLIIGAVVITLFGTLFYLEDRDGGGLYDPDPSASFRYNNRKTK |
| Ga0210003_12173872 | 3300024262 | Deep Subsurface | MGTLIIGAVVITIFGTLFYLEDRDGGGLYDPDPSASFRYNNRKTK |
| Ga0208161_100001592 | 3300025646 | Aqueous | MIIFGGVLISIFLLLFYLEDRDGGGLYDPDPSASYRHRKLKK |
| Ga0209864_10438533 | 3300027547 | Sand | MITAIVGGVILTTFGVMFYLDDRAGGGLYDPDPSASDRYRRNK |
| Ga0209288_100053492 | 3300027762 | Freshwater Sediment | MLILGGFIVTMFAFLFYLEDRSGGGLYDPDPSASYRHKKSKK |
| Ga0209536_1012293253 | 3300027917 | Marine Sediment | MITVILGGVILSTFGIMFYLEDRDGGGLYDPDPTASERYRKHK |
| Ga0307380_113966772 | 3300031539 | Soil | MITLAIGGGIITLFSILFYLEDRDGGGIYDPDPSASYRHNQKRKNRN |
| Ga0307378_106237534 | 3300031566 | Soil | MGTLIIGAVVIILFGTLFYLEDRDGGGLYDPDPSASFRYNNRKTK |
| Ga0307375_102402812 | 3300031669 | Soil | MITLAIGGGIITLFSILFYLEDRDGGGIYDPDPSASYRHNQKRKNLN |
| Ga0315291_105173183 | 3300031707 | Sediment | MITLAIGGGIITLFSILFYLEDRDGGGIYDPDPSASYRHNQQRKNRN |
| Ga0315907_100597822 | 3300031758 | Freshwater | MITLVIGGVIVSAFLILFYLEDKDGGGLYDPDPSASYRHKKSNK |
| Ga0315909_107124341 | 3300031857 | Freshwater | IMLILGGFIVTMFAFLFYLEDRSGGGLYDPDPSASYRHKKSKK |
| Ga0315904_101911994 | 3300031951 | Freshwater | MITAILGGVIISTFSILFYLEDRDGGGLYDPDPSASYRHQNRK |
| Ga0315274_110136193 | 3300031999 | Sediment | GGIITLFSILFYLEDRDGGGIYDPDPSASYRHNQQRKNRN |
| Ga0316625_1001500693 | 3300033418 | Soil | MITLAIGGVILTTFSIMFYLEDRDGGGLYDPDPSASYRHKQSR |
| Ga0316616_1016642471 | 3300033521 | Soil | ITLAVGGVILTVFCTMFYLEDRDGGGLYDPDPSASYRYKKLKNK |
| Ga0316617_1001461854 | 3300033557 | Soil | MITLAIGGVILTTFSIMFYLEDHMGGGLYDPDPSASYRHKQSR |
| Ga0316617_1003330031 | 3300033557 | Soil | MSTLILGGVIISTFLTMFYLEDRDGGGIYDPDPSASYRNRN |
| Ga0334980_0354298_2_124 | 3300033816 | Freshwater | MITAILGGVILTTFSIMFYLDDREGGGLYDPDPRSSYYHQK |
| Ga0334982_0043058_2116_2256 | 3300033981 | Freshwater | MVTAIVGGIILATFSVMFYLDDRAGGGLYDPDPSASYRYRQQHKQR |
| Ga0334996_0002381_7311_7442 | 3300033994 | Freshwater | MITAILGGVILSTFSFLWYLEDREGGGLYDPDPTASDRYRKHK |
| Ga0334986_0040880_2268_2399 | 3300034012 | Freshwater | MLILGGFIVTILTFLFYLEDRSGGGLYDPDPSASYRYKQHKNK |
| Ga0334995_0055717_1982_2113 | 3300034062 | Freshwater | MITAIVGGVILITFCIMFYLDDRAGGGLYDPDPRSSYYHRKRK |
| Ga0335000_0580664_308_439 | 3300034063 | Freshwater | MITAIVGGVILATFGVMFYLDDRAGGGLYDPDPTASDRYRRNK |
| Ga0335019_0047423_2839_2946 | 3300034066 | Freshwater | MLILGGFIVTILTFLFYLEDRSGGGLYDPDPSASYR |
| Ga0310127_088911_747_881 | 3300034072 | Fracking Water | MITAIVGGVILATFGIMFYLDDRMGGGLYDPDPTAFDRYRRNRK |
| Ga0335027_0029474_3241_3372 | 3300034101 | Freshwater | MITAILGGVILSTFSLLWYLEDREGGGLYDPDPRSSYYHRKHK |
| Ga0335029_0763281_1_126 | 3300034102 | Freshwater | LVIGGVIFFTFLVLFYLEDRDGGGLYDPDPSASYRYRNRKN |
| Ga0335051_0038002_2131_2268 | 3300034109 | Freshwater | MMIEFMFGIFIITFFCIMFYLEDRSGGGLYDPDPSASYRHKKSKK |
| Ga0335049_0134977_1654_1773 | 3300034272 | Freshwater | LGGFIVTMFAFLFYLEDRSGGGLYDPDPSASYRHKKSKK |
| Ga0335049_0213605_52_183 | 3300034272 | Freshwater | MITAILGGVILSTFGIMFYLDDRAGGGLYDPDPTASDRYRRNK |
| Ga0335039_0172796_453_584 | 3300034355 | Freshwater | MITAILGGVILSTFGIMFYLDDRMGGGLYDPDPTASDRYRRNK |
| ⦗Top⦘ |