| Basic Information | |
|---|---|
| Family ID | F034886 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 49 residues |
| Representative Sequence | LIVAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.58 % |
| % of genes near scaffold ends (potentially truncated) | 98.27 % |
| % of genes from short scaffolds (< 2000 bps) | 93.64 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.844 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.607 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.121 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.133 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.95% β-sheet: 0.00% Coil/Unstructured: 46.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF02265 | S1-P1_nuclease | 75.72 |
| PF02580 | Tyr_Deacylase | 2.31 |
| PF00291 | PALP | 1.16 |
| PF06167 | Peptidase_M90 | 1.16 |
| PF00155 | Aminotran_1_2 | 0.58 |
| PF10417 | 1-cysPrx_C | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG1490 | D-aminoacyl-tRNA deacylase | Translation, ribosomal structure and biogenesis [J] | 2.31 |
| COG3228 | Mlc titration factor MtfA, regulates ptsG expression | Signal transduction mechanisms [T] | 1.16 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.84 % |
| Unclassified | root | N/A | 1.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_12358031 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300000955|JGI1027J12803_105997103 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300000956|JGI10216J12902_122184040 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300001160|JGI12654J13325_1016063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
| 3300001661|JGI12053J15887_10475915 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300003995|Ga0055438_10288083 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
| 3300004114|Ga0062593_101807364 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300004114|Ga0062593_102215429 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300004479|Ga0062595_102353202 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300004480|Ga0062592_101350176 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005176|Ga0066679_10350468 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 965 | Open in IMG/M |
| 3300005177|Ga0066690_10971302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 536 | Open in IMG/M |
| 3300005184|Ga0066671_10828593 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005186|Ga0066676_10730461 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005187|Ga0066675_10890894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300005289|Ga0065704_10437504 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005289|Ga0065704_10596128 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005294|Ga0065705_10057379 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005294|Ga0065705_10441129 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005294|Ga0065705_10566313 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005295|Ga0065707_10713245 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005364|Ga0070673_101143448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 728 | Open in IMG/M |
| 3300005434|Ga0070709_11515573 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 3300005436|Ga0070713_102191156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300005437|Ga0070710_11342950 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300005439|Ga0070711_100434205 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300005445|Ga0070708_102099615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300005446|Ga0066686_10130130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1649 | Open in IMG/M |
| 3300005468|Ga0070707_102053628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
| 3300005518|Ga0070699_101627472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 591 | Open in IMG/M |
| 3300005536|Ga0070697_101670799 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
| 3300005536|Ga0070697_101813120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300005564|Ga0070664_100971391 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005576|Ga0066708_10445948 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005618|Ga0068864_101186495 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300005618|Ga0068864_101966148 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005719|Ga0068861_101923716 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006755|Ga0079222_10343160 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300006800|Ga0066660_10051093 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2700 | Open in IMG/M |
| 3300006804|Ga0079221_11010214 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300006864|Ga0066797_1141484 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300006871|Ga0075434_100969046 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300007258|Ga0099793_10463085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 628 | Open in IMG/M |
| 3300009098|Ga0105245_13225203 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 505 | Open in IMG/M |
| 3300009137|Ga0066709_102760608 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 653 | Open in IMG/M |
| 3300009147|Ga0114129_10489937 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300009156|Ga0111538_10317895 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
| 3300010043|Ga0126380_12011153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
| 3300010046|Ga0126384_11876307 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010048|Ga0126373_10769834 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300010048|Ga0126373_11129745 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300010048|Ga0126373_11365234 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010159|Ga0099796_10278459 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300010301|Ga0134070_10119693 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300010301|Ga0134070_10232982 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010320|Ga0134109_10255071 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010325|Ga0134064_10090852 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 993 | Open in IMG/M |
| 3300010326|Ga0134065_10017455 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300010329|Ga0134111_10383505 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 599 | Open in IMG/M |
| 3300010337|Ga0134062_10776597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300010359|Ga0126376_10055321 | Not Available | 2828 | Open in IMG/M |
| 3300010361|Ga0126378_11713943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 714 | Open in IMG/M |
| 3300010362|Ga0126377_10050538 | All Organisms → cellular organisms → Bacteria | 3622 | Open in IMG/M |
| 3300010362|Ga0126377_11351918 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010364|Ga0134066_10367451 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010364|Ga0134066_10440091 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010366|Ga0126379_10883312 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010366|Ga0126379_12081856 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010376|Ga0126381_104768135 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300010398|Ga0126383_13062696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300010403|Ga0134123_10956975 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300011119|Ga0105246_11809388 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300011270|Ga0137391_10956366 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012198|Ga0137364_11408174 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 516 | Open in IMG/M |
| 3300012199|Ga0137383_10504020 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 886 | Open in IMG/M |
| 3300012199|Ga0137383_11062651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300012201|Ga0137365_10016425 | All Organisms → cellular organisms → Bacteria | 5791 | Open in IMG/M |
| 3300012205|Ga0137362_10529590 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1018 | Open in IMG/M |
| 3300012207|Ga0137381_10365684 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300012210|Ga0137378_10058313 | All Organisms → cellular organisms → Bacteria | 3484 | Open in IMG/M |
| 3300012210|Ga0137378_11728606 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 531 | Open in IMG/M |
| 3300012285|Ga0137370_10254871 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1040 | Open in IMG/M |
| 3300012285|Ga0137370_11020736 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
| 3300012351|Ga0137386_10197425 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300012353|Ga0137367_11086830 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012361|Ga0137360_10314351 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012925|Ga0137419_11621572 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012929|Ga0137404_11806682 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 568 | Open in IMG/M |
| 3300012944|Ga0137410_10360447 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300012948|Ga0126375_11364178 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012951|Ga0164300_10621332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 641 | Open in IMG/M |
| 3300012971|Ga0126369_12557936 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012971|Ga0126369_12718507 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 579 | Open in IMG/M |
| 3300012971|Ga0126369_12944263 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 557 | Open in IMG/M |
| 3300012972|Ga0134077_10311738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 663 | Open in IMG/M |
| 3300012985|Ga0164308_11880449 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300013306|Ga0163162_12903904 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 551 | Open in IMG/M |
| 3300014150|Ga0134081_10289368 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 585 | Open in IMG/M |
| 3300014166|Ga0134079_10052191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
| 3300014166|Ga0134079_10614124 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300015241|Ga0137418_10815801 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 697 | Open in IMG/M |
| 3300015241|Ga0137418_11158747 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300015265|Ga0182005_1123672 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300015357|Ga0134072_10058996 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1088 | Open in IMG/M |
| 3300015357|Ga0134072_10233267 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300015357|Ga0134072_10281141 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300015359|Ga0134085_10590460 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300015371|Ga0132258_10502440 | All Organisms → cellular organisms → Bacteria | 3032 | Open in IMG/M |
| 3300015372|Ga0132256_100149340 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
| 3300015373|Ga0132257_101310174 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300015373|Ga0132257_102551379 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300015373|Ga0132257_103183203 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300015374|Ga0132255_102270530 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300016270|Ga0182036_10673932 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300016294|Ga0182041_10026762 | All Organisms → cellular organisms → Bacteria | 3626 | Open in IMG/M |
| 3300016357|Ga0182032_11157755 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300016357|Ga0182032_11996094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
| 3300016404|Ga0182037_10190956 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300018000|Ga0184604_10084033 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300018071|Ga0184618_10386003 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300018078|Ga0184612_10278752 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300018081|Ga0184625_10612008 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018433|Ga0066667_10723337 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300019361|Ga0173482_10736911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
| 3300019999|Ga0193718_1091436 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300020005|Ga0193697_1155538 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
| 3300020579|Ga0210407_11390143 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
| 3300021086|Ga0179596_10687577 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
| 3300021560|Ga0126371_10423788 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300021560|Ga0126371_11810164 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300022534|Ga0224452_1013028 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300024288|Ga0179589_10032683 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300024288|Ga0179589_10561701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300025922|Ga0207646_11024654 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 729 | Open in IMG/M |
| 3300025930|Ga0207701_11166125 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300026315|Ga0209686_1078525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1169 | Open in IMG/M |
| 3300026324|Ga0209470_1057094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1860 | Open in IMG/M |
| 3300026536|Ga0209058_1134001 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300026540|Ga0209376_1096253 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300026547|Ga0209156_10048443 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300026547|Ga0209156_10198356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 957 | Open in IMG/M |
| 3300026557|Ga0179587_10838995 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300027635|Ga0209625_1026876 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300027882|Ga0209590_10489241 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300027903|Ga0209488_10823066 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300028707|Ga0307291_1134477 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300028718|Ga0307307_10116662 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300028799|Ga0307284_10291615 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300028824|Ga0307310_10180352 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300030916|Ga0075386_12065533 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031231|Ga0170824_102568779 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031231|Ga0170824_119584529 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031231|Ga0170824_127858700 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300031469|Ga0170819_10109013 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300031538|Ga0310888_10559396 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031716|Ga0310813_10563001 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300031744|Ga0306918_11316617 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300031820|Ga0307473_10807699 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 669 | Open in IMG/M |
| 3300031820|Ga0307473_11297193 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 3300031833|Ga0310917_10736895 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031854|Ga0310904_10305896 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300031908|Ga0310900_10322557 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300031912|Ga0306921_10456909 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300031912|Ga0306921_10609893 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300031941|Ga0310912_11017328 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031942|Ga0310916_10982220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 705 | Open in IMG/M |
| 3300031946|Ga0310910_11462156 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031954|Ga0306926_11277274 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300032060|Ga0318505_10589995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300032180|Ga0307471_102583417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
| 3300032205|Ga0307472_100035605 | Not Available | 2944 | Open in IMG/M |
| 3300032261|Ga0306920_101204127 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300032261|Ga0306920_102504667 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 710 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.31% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.31% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.16% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001160 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_123580313 | 3300000890 | Soil | FVRLPGHGLWFRAHAILLAMGGIAFGVFAWQHHLLDASLKF* |
| JGI1027J12803_1059971033 | 3300000955 | Soil | LVAAVRFVRLPGRGLWFRAHAILLAIGGIAFGVFAWQYHLLGTSLRF* |
| JGI10216J12902_1221840401 | 3300000956 | Soil | LLITAAVRFVRLPRHGLWFRAHAILLAIGGVAFGVFAWQYHLLDASLKF* |
| JGI12654J13325_10160632 | 3300001160 | Forest Soil | IFGWVMMAGIVLLIIAAVRFARLPGHGLWFRAHAILLAVGGIAFGLFCWQYHLLDASLKF |
| JGI12053J15887_104759151 | 3300001661 | Forest Soil | HIFGWLLMAGVVLLILAAVRFAKLPGHGLWFRVHAILLAIGGIAFGLFAWQYHLLDMSLKF* |
| Ga0055438_102880832 | 3300003995 | Natural And Restored Wetlands | IAAVRFVRLPGHGFWFRTHAILLALGGIAFGMFAWQYHLLSASLRF* |
| Ga0062593_1018073642 | 3300004114 | Soil | VRLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDSSLKF* |
| Ga0062593_1022154292 | 3300004114 | Soil | VLLIITAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHLLDTSLKF* |
| Ga0062595_1023532022 | 3300004479 | Soil | VRFVRLPGHGLWFRAHAILLAIGGIAFGLFAWQYHFLDASLKF* |
| Ga0062592_1013501762 | 3300004480 | Soil | FVRLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDSSLKF* |
| Ga0066679_103504681 | 3300005176 | Soil | MAGLVLLVIAAVRFAKLPGHGLWFRAHAILLAVGGIAFGLFCWQYHLLDMSVKF* |
| Ga0066690_109713021 | 3300005177 | Soil | AIRFATLPGHGLWFRAHAILLAIGGIAFGLFCWQYHLLETSVKF* |
| Ga0066671_108285932 | 3300005184 | Soil | VLLIIAAARFAKLPGHGLWFRLHSILLAIGGIAFGLFAWQYHLLDTSLKF* |
| Ga0066676_107304612 | 3300005186 | Soil | LMAGVVLLIIAAIRFVRLPGQGLWFRADAILLAIGGIAFGVFAWQYHLLDTSLKF* |
| Ga0066675_108908941 | 3300005187 | Soil | TTAGIVVLIVASIRFIRLPGHGFWFRTHAILLALGGIAFGLFCWQYHLLDASLKF* |
| Ga0065704_104375041 | 3300005289 | Switchgrass Rhizosphere | VRLPGHGLWFRAHAILLAIGGIAFAVFAWQYHLLDASLKF* |
| Ga0065704_105961282 | 3300005289 | Switchgrass Rhizosphere | AAVRFVRLPGHGLWFRAHAILLAIGGVAFALFAWQYHLLDASLKF* |
| Ga0065705_100573791 | 3300005294 | Switchgrass Rhizosphere | VRLPGHGLWFRAHAILLAIGGVAFALFAWQYHLLDASLKF* |
| Ga0065705_104411291 | 3300005294 | Switchgrass Rhizosphere | GWVLMAGVVLLIIAAVRFVRLPGHGLWFRAHAILLAIGGIAFAVFAWQYHFLDASLKF* |
| Ga0065705_105663131 | 3300005294 | Switchgrass Rhizosphere | GWVLMAGVVLLIIAAVRFVKLPGHGLWFRAHAILLAIGGIAFGVFAWEYHLLDASLKF* |
| Ga0065707_107132452 | 3300005295 | Switchgrass Rhizosphere | IAAVRFVRLPGHGLWFRAHAILLAIGGVAFALFAWQYHLLDASLKF* |
| Ga0070673_1011434481 | 3300005364 | Switchgrass Rhizosphere | GWVLMAGVVLLIIAAVRFVRLPGHGLWFRADAILLAIGGIAFGVFAWQYHFLDASLKF* |
| Ga0070709_115155731 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | HIFGWATTAGIVVLIVASIRFLMLPGHGFWFRAHAILLALGGIAFGLFCWQYHLLDASLKF* |
| Ga0070713_1021911562 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LVITAIRFARLPGHGLWFRAHAILLAIGGIAFGLFCWQYHLLETSVKF* |
| Ga0070710_113429502 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LLIIAAVRFVRLPGHRLWFRAHAILLAIGGVAFAVFTWQYHLLDASLKF* |
| Ga0070711_1004342051 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF* |
| Ga0070708_1020996152 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLVIAAIRFATLPGHGLWFRTHAILLAIGGITFGLFCWQYHLLDISVKF* |
| Ga0066686_101301303 | 3300005446 | Soil | TAIRFARLPGHGLWFRAHAILLAIGGIAFGLFCWQYHLLETSVKF* |
| Ga0070707_1020536281 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TMAGVLLLVIVAVRFARLPGHGFWFRAHTILLAVGGVAFGLFCWQYHLLGPSLKF* |
| Ga0070699_1016274722 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGVVFLVIAAIRFARLAGHGLWFRIHASLLAIGGIAFGVFAWQYHLL |
| Ga0070697_1016707992 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AIRFARLPGHGLWFRAHAILLAIGGIAFGLFCWQYHLLETSVKF* |
| Ga0070697_1018131201 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLLVIAAIRFAKLPGHGLWFRAHIILLAIGGIAFGLFCWQYHLLDPSLKF* |
| Ga0070664_1009713911 | 3300005564 | Corn Rhizosphere | IIGWILMAGVVLLIVAAVRFARLPGHGLWFRAHTILLAIGGIAFAGFAWQYHFLDASLKF |
| Ga0066708_104459482 | 3300005576 | Soil | MAGVVLLIIAAARFAKVPGHGFWFRIHAILLAIGGIAFGLFAWQYHLLDRSLRF* |
| Ga0068864_1011864951 | 3300005618 | Switchgrass Rhizosphere | GHGLWFRGHAILLAIGGIVFGLFAWQYHLLDASLKF* |
| Ga0068864_1019661482 | 3300005618 | Switchgrass Rhizosphere | VIGWILMAGVVLLIVAAVRFARLPRHGLWFRAHTILLAIGGIAFAVFTWQYHFLDASLKF |
| Ga0068861_1019237162 | 3300005719 | Switchgrass Rhizosphere | HGLWFRAHAILLAIGGIAFGVFAWQYHFLDVSLKF* |
| Ga0079222_103431601 | 3300006755 | Agricultural Soil | QMLHIFGWVTIAGIVVLIVSAIRFARLPGHGVWFRVHAILLAIGGIAFGLFCWQYRLLDTSLKF* |
| Ga0066660_100510937 | 3300006800 | Soil | AGVLLLVYAAVRFARLPGHGFWFHAHAILLAVGGVVFGLFCWQYHLLGPSLKF* |
| Ga0079221_110102142 | 3300006804 | Agricultural Soil | MVGIVLLVIGAIRFARIPGNGFWFRTHAILLAVGGIAFALFCWQYHLLDSSLKF* |
| Ga0066797_11414842 | 3300006864 | Soil | ALMAGVLLLIIAAIRFARLPGRGFWFRAHAILLATGGITFALFAWQYHLLDASLKF* |
| Ga0075434_1009690461 | 3300006871 | Populus Rhizosphere | GLGLWFRAHAILLAIGGVAFGMFAWQYHLLNASLKF* |
| Ga0099793_104630851 | 3300007258 | Vadose Zone Soil | IRFARLPGHGLWLRAHAILLAIGGIAFGLFCWQYHLLETSVKF* |
| Ga0105245_132252031 | 3300009098 | Miscanthus Rhizosphere | HVIGWILIAGVVLLIIAAIRFTRLPGHGLWFRAHAILLAIGGIAFGLFAWQYNLLDASLKF* |
| Ga0066709_1027606082 | 3300009137 | Grasslands Soil | GWILMAGLVLLVISAIRFAKLPGHGLWFRAHAILLAIGGVAFGLFCWQYHLLDASVKF* |
| Ga0114129_104899373 | 3300009147 | Populus Rhizosphere | VVLLIIAAVRFVRLPGLGLWFRAHAILLAIGGVAFGMFAWQYHLLNASLKF* |
| Ga0111538_103178954 | 3300009156 | Populus Rhizosphere | VLLIIAAVRFVRLPGLGLWFRAHAILLAIGGVAFGMFAWQYHLLNASLKF* |
| Ga0126380_120111532 | 3300010043 | Tropical Forest Soil | AGVVLLIIAAVRFVRLPGHGLWFRAHSVFLAIGGIAFGVFAWQYHFLDSSLKF* |
| Ga0126384_118763072 | 3300010046 | Tropical Forest Soil | VVLLVIAAIRFARLAGHGLWFRIHAILLAIGGIAFGVFAWEYHLLDPSLKF* |
| Ga0126373_107698342 | 3300010048 | Tropical Forest Soil | LMAGVLLLIIAALRFARLPGHGLWFRAHAILLAIGGIVFGLFAWQYHFLDASLKF* |
| Ga0126373_111297452 | 3300010048 | Tropical Forest Soil | LDRNVTDYLDFAITAAIRFVRLPGDGLWFRAYAALLPPGGIASGIFAWQYHLLDASLKF* |
| Ga0126373_113652342 | 3300010048 | Tropical Forest Soil | LVAGIVLLLVAAVRFARLPGHGLWFRAHAVLLAIGGIAFGVFAWQYHLLGTSLRF* |
| Ga0099796_102784592 | 3300010159 | Vadose Zone Soil | GWVLMAGVVLLIIAAVRFVRLPGHGLWFRPHAILLAIGGVAFAVFAWQYHLLDASLKF* |
| Ga0134070_101196931 | 3300010301 | Grasslands Soil | RFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF* |
| Ga0134070_102329822 | 3300010301 | Grasslands Soil | GWLLMVGVVVLIVAAARFVRLPGHGLWFRVHAILLAIGGIAFGLFAWQYHLLDTSLRF* |
| Ga0134109_102550712 | 3300010320 | Grasslands Soil | LMAGVVLLIVAAVRFVRLPEHGLWFRAHAILLAIGGIAFAVFAWQYHLLDASLKF* |
| Ga0134064_100908521 | 3300010325 | Grasslands Soil | ATTAGIVVLIVTSIRFIRLPGHGFWFRAHAILLALGGIAFELFCWQYHLLDASLKF* |
| Ga0134065_100174551 | 3300010326 | Grasslands Soil | HGLWFRAHAILLASGGIAIGLFAWQYHFLGASLKF* |
| Ga0134111_103835052 | 3300010329 | Grasslands Soil | LIVTSIRFIRLPGHGFWFRAHAILLALGGIAFELFCWQYHLLDASLKF* |
| Ga0134062_107765971 | 3300010337 | Grasslands Soil | RFLKLPGHGLWFRAHAILLALGGIAFGLFCWQYHLLDMSVKF* |
| Ga0126376_100553214 | 3300010359 | Tropical Forest Soil | WFLMAGVVLLIIAAIRLVRLAGHGLWFRAHAILLAIGGIAFGVFAWQYHLLDTSLKF* |
| Ga0126378_117139431 | 3300010361 | Tropical Forest Soil | IVAAIRFATLPGHGLWFRAHTILLALGGIAFGLFCWQYHLLDLSVKF* |
| Ga0126377_100505381 | 3300010362 | Tropical Forest Soil | VVLLIIAAVRFARLPGHGVWFRTHAILLAIGGIAFGLFAWQYNLLNASLRF* |
| Ga0126377_113519181 | 3300010362 | Tropical Forest Soil | GHGLWFRAHAILLAIGGIIFAVFAWQYHLLDASLKF* |
| Ga0134066_103674512 | 3300010364 | Grasslands Soil | AAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF* |
| Ga0134066_104400911 | 3300010364 | Grasslands Soil | GHGLWFRAHAILLAVGGIAFGLFAWQYHFLDASLKF* |
| Ga0126379_108833122 | 3300010366 | Tropical Forest Soil | LGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF* |
| Ga0126379_120818561 | 3300010366 | Tropical Forest Soil | HGLWFRAHAILLAIAGVAFGLFAWQYHLLDWSLKF* |
| Ga0126381_1047681352 | 3300010376 | Tropical Forest Soil | VLLIIAAIRFVRLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF* |
| Ga0126383_130626962 | 3300010398 | Tropical Forest Soil | AGLILLIVAAIRFATLPGQRFWFRAHTILLALGGIAFGLFCWQYHLLDLSVKF* |
| Ga0134123_109569751 | 3300010403 | Terrestrial Soil | VLLIIAAVRFTRLPGHGLWFRAHAILLAIGGIAFGLFAWQYNLLDASLKF* |
| Ga0105246_118093882 | 3300011119 | Miscanthus Rhizosphere | VVLLIVAAVRFVRLPGHGLWFRAHAILLAIGVIAFGVFAWQYHFLDASLKF* |
| Ga0137391_109563661 | 3300011270 | Vadose Zone Soil | AIRFVRLPGHGIWFRAHAILLAIGGIAFGVFAWQYHLLDASLKF* |
| Ga0137364_114081742 | 3300012198 | Vadose Zone Soil | ALMAGLLLVVVTAFRFAKLPDHGLWFRAHAILLALGGIAFGLVCWQNHLLDTSLKF* |
| Ga0137383_105040202 | 3300012199 | Vadose Zone Soil | GAIRFVKTRTQGPWFRTHAILLALGGIAFGLFCWQYHLLDMSVKF* |
| Ga0137383_110626512 | 3300012199 | Vadose Zone Soil | LVITAIRFAKLPGQGLWFRAHAILLAIGGIAFGLFCWQYHLLDTSLKF* |
| Ga0137365_1001642510 | 3300012201 | Vadose Zone Soil | VLLVITAIRFAKLPGQGLWFRAHAILLAIGGIAFGLFCWQYHLLDTSLKF* |
| Ga0137362_105295901 | 3300012205 | Vadose Zone Soil | MLPGHGFWFRAHAILLALGGIAFGLFCWQYHLLDASLKF* |
| Ga0137381_103656842 | 3300012207 | Vadose Zone Soil | RFVRLPEHGLWFRAHAILLAIGGIAFAVFAWQYHLLDASLKF* |
| Ga0137378_100583131 | 3300012210 | Vadose Zone Soil | LLVVGAIRFVKTRTQGPWFRTHAILLALGGIAFGLFCWQYHLLDMSVKF* |
| Ga0137378_117286062 | 3300012210 | Vadose Zone Soil | QAFHIFGWFLMAGVILLVVAAIRFVRLPGHGLWFRIHASFLAIGGIAFGVFAWQYHLLDASLKF* |
| Ga0137370_102548712 | 3300012285 | Vadose Zone Soil | VASIRFIRLPGHGFWFRAHAILLALGGIAFGLFCWQYHLLDASLKF* |
| Ga0137370_110207362 | 3300012285 | Vadose Zone Soil | VVLLIVAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLEASLKF* |
| Ga0137386_101974253 | 3300012351 | Vadose Zone Soil | RFARLPGHGLWLRAHAILLAIGGIAFGLFFLQYHLLETSVKF* |
| Ga0137367_110868301 | 3300012353 | Vadose Zone Soil | ITAARFAELPGHGLWFRVHAILLAIGGIAVGLFALQYQLLNISLKF* |
| Ga0137360_103143512 | 3300012361 | Vadose Zone Soil | HIFGWFLMAGVVLLIIAAIRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF* |
| Ga0137419_116215721 | 3300012925 | Vadose Zone Soil | VRFAKLPGHGLWFRVHAILLAIGGIAFGLFAGQYHLLDMSLKF* |
| Ga0137404_118066822 | 3300012929 | Vadose Zone Soil | VLLIAAAVRFVRLQEHGLWFRAHAILLAIGGIAFAVFAWQYHLLDASLKF* |
| Ga0137410_103604472 | 3300012944 | Vadose Zone Soil | GLWFRAHAILLAIGGMAFGLFAWQYHFLDASLKF* |
| Ga0126375_113641782 | 3300012948 | Tropical Forest Soil | LSALHILGWAVLAGIVLLIVAAIRFAKLSGAGFWFRAHAILLAIGGIAFGLFVWQFHLLGPSLKF* |
| Ga0164300_106213323 | 3300012951 | Soil | LPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF* |
| Ga0126369_125579362 | 3300012971 | Tropical Forest Soil | IRFVRLPGLGLWFRAHSILLAIGGVAFGVFAWQYHLLDVSLKF* |
| Ga0126369_127185071 | 3300012971 | Tropical Forest Soil | VMAGIVILIVAAVRFVRLRGHGVWFRAHAFLLAIGGIAFGVFAWQYHLLSISLRF* |
| Ga0126369_129442632 | 3300012971 | Tropical Forest Soil | LIIAAVRFVRLPAHGLWFRAHAILLAIGGIAFAVFAWQYNLLDASLKF* |
| Ga0134077_103117381 | 3300012972 | Grasslands Soil | IFGWALMAGLVLLVITAIRFAKLPGHGLWFRAHAILLAIGGIAFGLFCWQYHLLETSVKF |
| Ga0164308_118804492 | 3300012985 | Soil | GHGLWFRTHAILLAIGGIAFGVFAWQYHFLDAALKF* |
| Ga0163162_129039042 | 3300013306 | Switchgrass Rhizosphere | QAFHVFGWVLMGGVVLLIIAAVRFARLRGHGLWFRAHAILLAIGGIAFGVFAWQYHLLDASLKF* |
| Ga0134081_102893681 | 3300014150 | Grasslands Soil | GWVVVAGIILLIVAAVRFVGLPGHGLWFRAHAILLAIGGIALGVFAWQYHLLGTSLRF* |
| Ga0134079_100521913 | 3300014166 | Grasslands Soil | GWVLMAGVVLLIIAAVRSVRLPGHGLWFRAHAILLAVGGIAFGLFAWQYHFLDASLKF* |
| Ga0134079_106141241 | 3300014166 | Grasslands Soil | ARFVRLPGHGLWFRVHAILLAIGGSAFGLFAWQYHLLDTSLRF* |
| Ga0137418_108158012 | 3300015241 | Vadose Zone Soil | GHGFWFRAHAILLAVGGIAFGLFAWQYHLLDMSVRF* |
| Ga0137418_111587472 | 3300015241 | Vadose Zone Soil | RFAKLPGHGLWFRVHAILLAIGGIAFGLFAGQYHLLDMSLKF* |
| Ga0182005_11236722 | 3300015265 | Rhizosphere | GLWFRVHAILLALGGVAFGVFAWQYNLLGPSLKF* |
| Ga0134072_100589962 | 3300015357 | Grasslands Soil | IVTSIRFIRLPGHGFWFRAHAILLALGGIAFELFCWQYHLLDASLKF* |
| Ga0134072_102332672 | 3300015357 | Grasslands Soil | GWFLMAGVVLLIIAAIRFVRLPRHGLWFQAHAILLAIGGIAFGVFAWQYHLLDASLRF* |
| Ga0134072_102811412 | 3300015357 | Grasslands Soil | IAAARFAKLPGHGLWFRLHSIFLAIGGIGFALFAWQYHLLDTSLKF* |
| Ga0134085_105904602 | 3300015359 | Grasslands Soil | WALMAGLVLLVITAIRFARLPGHGLWFRAHAILLAIGGIAFGLFCWQYHLLETSVKF* |
| Ga0132258_105024405 | 3300015371 | Arabidopsis Rhizosphere | LLIITAVRFVRLPGHGLWFRAHAILLAIGGIAVGVFAWQYHFLDASLKF* |
| Ga0132256_1001493401 | 3300015372 | Arabidopsis Rhizosphere | LRAGVVLLIIAAVPFVRLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF* |
| Ga0132257_1013101741 | 3300015373 | Arabidopsis Rhizosphere | AFRFVRLPGHGVWFRAHAILLAIGGVAFAVFAWQYHFLDASLKF* |
| Ga0132257_1025513792 | 3300015373 | Arabidopsis Rhizosphere | GWILMAGVVLLIVAAVRFARLPGHGLWFRAHTILLAIGGIAFAVFTWQYHFLDASLKF* |
| Ga0132257_1031832032 | 3300015373 | Arabidopsis Rhizosphere | VRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF* |
| Ga0132255_1022705302 | 3300015374 | Arabidopsis Rhizosphere | AGVVLLIIAAVRFVRLPGHRLWFRAHAILLAIGGVAFAVFTWQYHLLDASLKF* |
| Ga0182036_106739322 | 3300016270 | Soil | HFIGWVLMAGVVLLIIAAVRFVRLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLK |
| Ga0182041_100267626 | 3300016294 | Soil | FAWVLMAGLLLLVIAAFRFAKLPGHGFWFRAHAILLAIGGIAFGVFCWHYHFLDWSLRF |
| Ga0182032_111577552 | 3300016357 | Soil | ARLPGLGLWFRAHAILLAIGGVAVAVFAWQYHLLDASLKF |
| Ga0182032_119960942 | 3300016357 | Soil | WVLMAGVVLLIITAVCFARLPGHGLWFRAHAILLAISGIAFGLFAWQYHFLDASLKF |
| Ga0182037_101909563 | 3300016404 | Soil | AAVRFVRLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF |
| Ga0184604_100840331 | 3300018000 | Groundwater Sediment | VRFVRLPGHGLWFRAHVILLAIGGVAFGVFAWQYHFLDASLKF |
| Ga0184618_103860032 | 3300018071 | Groundwater Sediment | VRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHLLDASLKF |
| Ga0184612_102787522 | 3300018078 | Groundwater Sediment | MAGVVLLIIAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHLLDASLKF |
| Ga0184625_106120082 | 3300018081 | Groundwater Sediment | LLIIAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDPSLKF |
| Ga0066667_107233371 | 3300018433 | Grasslands Soil | PEHGLWFRAHAILLAIGGIAFAVFAWQYHLLDASLKF |
| Ga0173482_107369112 | 3300019361 | Soil | ARFAKLPGHGLWFRAHAILLAIGGITFGLFASQYHLLGTSLKF |
| Ga0193718_10914362 | 3300019999 | Soil | IGWILMAGVVLLIIAAVRFVRLPGHGLWFRAHAILLAIGGVAFALFAWQYHLLDASLKF |
| Ga0193697_11555381 | 3300020005 | Soil | MAGVVLLIIAAVRFVRLPGHGLWFRAHAILLATGGIAFAVFAWQYHLLDASLKF |
| Ga0210407_113901431 | 3300020579 | Soil | HGFWFRAHAILLALGGIGYGLFCWQYHLLDASLKF |
| Ga0179596_106875772 | 3300021086 | Vadose Zone Soil | VTGIILLVVAAVRFVRLPGHGLWFRAHTILLAIGGIAFGVFAWQYHLLSTSLRF |
| Ga0126371_104237882 | 3300021560 | Tropical Forest Soil | MFLWPFHAVGWILMAGVILLIVAAVRFVRLPGHGFWFRAHAILLAVGGIAFGLFAWQYHFLNASLKF |
| Ga0126371_118101642 | 3300021560 | Tropical Forest Soil | LIIAAIRFVRLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF |
| Ga0224452_10130284 | 3300022534 | Groundwater Sediment | FVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHLLDASLKF |
| Ga0179589_100326833 | 3300024288 | Vadose Zone Soil | IIAAVRFVRLPGHGLWFRAHAILLAIGGVAFGLFAWQYHFLDASLKF |
| Ga0179589_105617011 | 3300024288 | Vadose Zone Soil | VRLPGHGLWFRAHAILLAIGGMAFGVFAWQYHFLDASLKF |
| Ga0207646_110246542 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FAKLPGHGLWFRAHAILLAIGGIMFGLFCWQYHLLDASLKF |
| Ga0207701_111661252 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | HVFGWVLLGGVVLLIIAAVRFARLPGHGLWFRAHAILLAIGGIAFGVFAWQYHLLDASLK |
| Ga0209686_10785251 | 3300026315 | Soil | VASIRFIRLPGHGFWFRAHAILLALGGIAFGLFCWQYHLLDASLKF |
| Ga0209470_10570941 | 3300026324 | Soil | TLYIFGWALMAGLVLLVITAIRFATLPGHGLWFRAHAILLAIGGIAFGLFCWQYHLLETSVKF |
| Ga0209058_11340011 | 3300026536 | Soil | HGLWFRVHAILLAIGGSAFGLFAWQYHLLDTSLRF |
| Ga0209376_10962533 | 3300026540 | Soil | VRLPGHGLWFRVHAILLAIGGSAFGLFAWQYHLLDTSLRF |
| Ga0209156_100484431 | 3300026547 | Soil | GHGLWFRVHAILLAIGGSAFGLFAWQYHLLDTSLRF |
| Ga0209156_101983562 | 3300026547 | Soil | GHGFWFRAHAILLALGGIAFGLFCWQYHLLDASLKF |
| Ga0179587_108389951 | 3300026557 | Vadose Zone Soil | IILLIVAAIRFVRLAGHGLWFRAHAILLAIGGIAFGVFAWQYHFLSTSLRF |
| Ga0209625_10268762 | 3300027635 | Forest Soil | SIRFLMLPGHGFWFRAHAILLALGGIAFGLFCWQYHLLDASLKF |
| Ga0209590_104892411 | 3300027882 | Vadose Zone Soil | KLPGHGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF |
| Ga0209488_108230662 | 3300027903 | Vadose Zone Soil | LIIAAVRFVRLPGHGLWFRAHAILLAIGGMAFGLFGWQYHFLDASLKF |
| Ga0307291_11344772 | 3300028707 | Soil | VLLIIAAVRFVRLPGHGLWFRAHAILLAIGGVAFAVFAWQYHFLDASLKF |
| Ga0307307_101166621 | 3300028718 | Soil | AARFAKLPGHGLWFRVHAILLAIGGIAFGLFAWQYHLLDASLKF |
| Ga0307284_102916152 | 3300028799 | Soil | AGVVLLIIAAVRFTKLPKHGLWFRIHAILLAIGGIAFGLFAWQYHLLGTSLKF |
| Ga0307310_101803521 | 3300028824 | Soil | GWVLLAGVVLLIIAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF |
| Ga0075386_120655332 | 3300030916 | Soil | VLLIIAAVRFVRLPGHRLWFRAHAILLAIGGVAFAVFTWQYHLLDASLKF |
| Ga0170824_1025687792 | 3300031231 | Forest Soil | VFGWFLMAGVVLLIIAAIRFVRLAGHGLWFRAHAILLAIGGIAFGVFSWQYHLLDTSLKF |
| Ga0170824_1195845291 | 3300031231 | Forest Soil | VLLIIAAVRFVRLPGHGLWFRAHAILLALGGIAFGVFAWQYHFLDASLKF |
| Ga0170824_1278587002 | 3300031231 | Forest Soil | LIVAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF |
| Ga0170819_101090131 | 3300031469 | Forest Soil | VVGWVLLAGVVLLIVAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLKF |
| Ga0310888_105593961 | 3300031538 | Soil | IAGVILLIVAAFRFAGLPGHGLWFRGHAILLATGGIVFGLFAWQYHLLDASLKF |
| Ga0310813_105630011 | 3300031716 | Soil | AKLPGHGLWFRAHAILLAIGGVAFGLFAWQYHLLGTSLKF |
| Ga0306918_113166171 | 3300031744 | Soil | FHLIGWVLMAGVVLLIIAAVRFVRLPRLGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF |
| Ga0307473_108076991 | 3300031820 | Hardwood Forest Soil | WALMAGLVLLVITAIRFARLPGHGLWLRAHAILLAIGGIAFGLFCWQYHLLETSVKF |
| Ga0307473_112971932 | 3300031820 | Hardwood Forest Soil | HVIGWALMAGVVLLIIAAVRFVRLPGHGLWFRAHAILLAIGGIAFGVFAWQYHFLDASLK |
| Ga0310917_107368951 | 3300031833 | Soil | LPGHGLWFRAHAILLAVGGIAFGVFAWQYHFLDASLKF |
| Ga0310904_103058961 | 3300031854 | Soil | GLPGHGLWFRGHAILLATGGIIFGLFAWQYHLLDASLKF |
| Ga0310900_103225572 | 3300031908 | Soil | VILLIVAAFRFAGLPGHGLWFRGHAILLAIGGIVFGLFAWQYHLLDASLKF |
| Ga0306921_104569091 | 3300031912 | Soil | AVRFVRLPGQGFWFRAHAIFLAIGGIAFGVFAWQYNLLGTSLKF |
| Ga0306921_106098931 | 3300031912 | Soil | GLLLLVIAAFRFAKLPGHGFWFRAHAILLAIGGIAFGVFCWHYHFLDWSLRF |
| Ga0310912_110173281 | 3300031941 | Soil | AGVVLLIVAAIRFAGLPGHGVWFRAHAILLAIGGIAFGLFAWQYNLLDASLRF |
| Ga0310916_109822201 | 3300031942 | Soil | GLLLLVIAAFRFAKLPGHGFWFRAHAILLAIGGIAFGVFCWQYHFLDWSLRF |
| Ga0310910_114621561 | 3300031946 | Soil | LPGLGLWFRAHAILLAIGGVAFAAFAWQYHLVDASLKF |
| Ga0306926_112772741 | 3300031954 | Soil | RLPGLGLWFRAHAILLAIGGVAFAVFAWQYHLLDASLKF |
| Ga0318505_105899952 | 3300032060 | Soil | LQGLHMFAWVLMAGLLLLVIAAFRFAKLPGHGFWFRAHAILLAIGGIAFGVFCWHYHFLDWSLRF |
| Ga0307471_1025834171 | 3300032180 | Hardwood Forest Soil | HGFWFRAHAILLALGGIAFGLFAWQYHLLDMSVRF |
| Ga0307472_1000356051 | 3300032205 | Hardwood Forest Soil | VVLLIIAAVRFVRLPGHGLWFRAHAILLAIGGIAFGLFAWQYHFLDASLKF |
| Ga0306920_1012041273 | 3300032261 | Soil | LVAAVRFVRLPGQGFWFRAHAIFLAIGGIAFGVFAWQYNLLGTSLKF |
| Ga0306920_1025046672 | 3300032261 | Soil | WVVIAGIVLLIIAAIRFARLPDHKFWFRAHAILLAIGGIAFGLFVWQNHLLDMSLKF |
| ⦗Top⦘ |