| Basic Information | |
|---|---|
| Family ID | F034882 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKW |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.61 % |
| % of genes near scaffold ends (potentially truncated) | 57.23 % |
| % of genes from short scaffolds (< 2000 bps) | 75.72 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.486 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (34.682 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.971 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (86.127 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.11% β-sheet: 0.00% Coil/Unstructured: 41.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 5.20 |
| PF13620 | CarboxypepD_reg | 4.62 |
| PF07394 | DUF1501 | 2.89 |
| PF07662 | Nucleos_tra2_C | 2.89 |
| PF00795 | CN_hydrolase | 2.31 |
| PF00133 | tRNA-synt_1 | 1.73 |
| PF10091 | Glycoamylase | 1.73 |
| PF13424 | TPR_12 | 1.73 |
| PF02543 | Carbam_trans_N | 1.73 |
| PF02894 | GFO_IDH_MocA_C | 1.73 |
| PF07516 | SecA_SW | 1.73 |
| PF14559 | TPR_19 | 1.16 |
| PF00905 | Transpeptidase | 1.16 |
| PF13414 | TPR_11 | 1.16 |
| PF07969 | Amidohydro_3 | 1.16 |
| PF13180 | PDZ_2 | 1.16 |
| PF01041 | DegT_DnrJ_EryC1 | 1.16 |
| PF07228 | SpoIIE | 1.16 |
| PF13432 | TPR_16 | 1.16 |
| PF00106 | adh_short | 1.16 |
| PF01850 | PIN | 0.58 |
| PF00515 | TPR_1 | 0.58 |
| PF12700 | HlyD_2 | 0.58 |
| PF13541 | ChlI | 0.58 |
| PF04909 | Amidohydro_2 | 0.58 |
| PF02321 | OEP | 0.58 |
| PF13823 | ADH_N_assoc | 0.58 |
| PF07687 | M20_dimer | 0.58 |
| PF07719 | TPR_2 | 0.58 |
| PF00694 | Aconitase_C | 0.58 |
| PF04463 | 2-thiour_desulf | 0.58 |
| PF00551 | Formyl_trans_N | 0.58 |
| PF01548 | DEDD_Tnp_IS110 | 0.58 |
| PF03415 | Peptidase_C11 | 0.58 |
| PF02781 | G6PD_C | 0.58 |
| PF01902 | Diphthami_syn_2 | 0.58 |
| PF13193 | AMP-binding_C | 0.58 |
| PF02838 | Glyco_hydro_20b | 0.58 |
| PF00326 | Peptidase_S9 | 0.58 |
| PF03144 | GTP_EFTU_D2 | 0.58 |
| PF16363 | GDP_Man_Dehyd | 0.58 |
| PF00072 | Response_reg | 0.58 |
| PF00294 | PfkB | 0.58 |
| PF08843 | AbiEii | 0.58 |
| PF00501 | AMP-binding | 0.58 |
| PF00912 | Transgly | 0.58 |
| PF08281 | Sigma70_r4_2 | 0.58 |
| PF12705 | PDDEXK_1 | 0.58 |
| PF10027 | DUF2269 | 0.58 |
| PF01522 | Polysacc_deac_1 | 0.58 |
| PF02771 | Acyl-CoA_dh_N | 0.58 |
| PF00180 | Iso_dh | 0.58 |
| PF12796 | Ank_2 | 0.58 |
| PF13302 | Acetyltransf_3 | 0.58 |
| PF01609 | DDE_Tnp_1 | 0.58 |
| PF13429 | TPR_15 | 0.58 |
| PF07715 | Plug | 0.58 |
| PF13360 | PQQ_2 | 0.58 |
| PF02954 | HTH_8 | 0.58 |
| PF02368 | Big_2 | 0.58 |
| PF10128 | OpcA_G6PD_assem | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 2.89 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 1.73 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 1.73 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.73 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.73 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.73 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.73 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.73 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.16 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.16 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.16 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.16 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.16 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.16 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.16 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.58 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.58 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.58 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.58 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.58 |
| COG2102 | Diphthamide synthase (EF-2-diphthine--ammonia ligase) | Translation, ribosomal structure and biogenesis [J] | 0.58 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.58 |
| COG1683 | Uncharacterized conserved protein YbbK, DUF523 family | Function unknown [S] | 0.58 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.49 % |
| Unclassified | root | N/A | 7.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005166|Ga0066674_10017112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3087 | Open in IMG/M |
| 3300005166|Ga0066674_10035965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2204 | Open in IMG/M |
| 3300005172|Ga0066683_10117693 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300005172|Ga0066683_10364234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300005174|Ga0066680_10832126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300005175|Ga0066673_10200303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1138 | Open in IMG/M |
| 3300005175|Ga0066673_10579877 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005178|Ga0066688_10417661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300005179|Ga0066684_10474600 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005180|Ga0066685_10040936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2936 | Open in IMG/M |
| 3300005180|Ga0066685_10044490 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
| 3300005180|Ga0066685_10065425 | All Organisms → cellular organisms → Bacteria | 2371 | Open in IMG/M |
| 3300005180|Ga0066685_10986045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300005186|Ga0066676_10034579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2776 | Open in IMG/M |
| 3300005187|Ga0066675_10193192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1425 | Open in IMG/M |
| 3300005187|Ga0066675_10422046 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005446|Ga0066686_10413771 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300005447|Ga0066689_10365690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300005450|Ga0066682_10024256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3479 | Open in IMG/M |
| 3300005450|Ga0066682_10286603 | Not Available | 1062 | Open in IMG/M |
| 3300005450|Ga0066682_10341169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
| 3300005450|Ga0066682_10938466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005451|Ga0066681_10021032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3343 | Open in IMG/M |
| 3300005451|Ga0066681_10162232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1320 | Open in IMG/M |
| 3300005451|Ga0066681_10888724 | Not Available | 534 | Open in IMG/M |
| 3300005451|Ga0066681_10891370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300005540|Ga0066697_10388335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300005552|Ga0066701_10303616 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005553|Ga0066695_10013498 | All Organisms → cellular organisms → Bacteria | 4375 | Open in IMG/M |
| 3300005553|Ga0066695_10019199 | All Organisms → cellular organisms → Bacteria | 3782 | Open in IMG/M |
| 3300005553|Ga0066695_10027088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3279 | Open in IMG/M |
| 3300005553|Ga0066695_10086055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1914 | Open in IMG/M |
| 3300005556|Ga0066707_10015081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3950 | Open in IMG/M |
| 3300005568|Ga0066703_10394291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 830 | Open in IMG/M |
| 3300005598|Ga0066706_10016715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4304 | Open in IMG/M |
| 3300005598|Ga0066706_10075591 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300005598|Ga0066706_10274323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1320 | Open in IMG/M |
| 3300005598|Ga0066706_10874360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300006031|Ga0066651_10081004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1596 | Open in IMG/M |
| 3300006034|Ga0066656_10986108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300006791|Ga0066653_10012134 | All Organisms → cellular organisms → Bacteria | 3028 | Open in IMG/M |
| 3300006791|Ga0066653_10340697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300006796|Ga0066665_10432600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300006796|Ga0066665_10779319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300006797|Ga0066659_10087341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2087 | Open in IMG/M |
| 3300006797|Ga0066659_10928043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300009012|Ga0066710_100168208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3078 | Open in IMG/M |
| 3300009012|Ga0066710_100484817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1860 | Open in IMG/M |
| 3300009012|Ga0066710_100894123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1366 | Open in IMG/M |
| 3300009012|Ga0066710_102395835 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009012|Ga0066710_103123874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300009012|Ga0066710_103819315 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 565 | Open in IMG/M |
| 3300009012|Ga0066710_103998570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300009012|Ga0066710_104451619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009137|Ga0066709_100143880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3033 | Open in IMG/M |
| 3300009137|Ga0066709_100796825 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300009137|Ga0066709_102791244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300009137|Ga0066709_104226871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300009147|Ga0114129_12498830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300010075|Ga0127434_101717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300010082|Ga0127469_194612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300010095|Ga0127475_1069028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300010111|Ga0127491_1005290 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300010117|Ga0127449_1024595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
| 3300010142|Ga0127483_1208318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300010301|Ga0134070_10033026 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300010304|Ga0134088_10066404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1671 | Open in IMG/M |
| 3300010323|Ga0134086_10008232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3157 | Open in IMG/M |
| 3300010325|Ga0134064_10051115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1267 | Open in IMG/M |
| 3300010329|Ga0134111_10011496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2844 | Open in IMG/M |
| 3300010329|Ga0134111_10034886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1769 | Open in IMG/M |
| 3300010329|Ga0134111_10314731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300010333|Ga0134080_10004074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5021 | Open in IMG/M |
| 3300010333|Ga0134080_10007889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3726 | Open in IMG/M |
| 3300010333|Ga0134080_10030510 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300010333|Ga0134080_10159753 | Not Available | 959 | Open in IMG/M |
| 3300010333|Ga0134080_10492217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300010335|Ga0134063_10363942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300010336|Ga0134071_10517570 | Not Available | 617 | Open in IMG/M |
| 3300010337|Ga0134062_10020831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2508 | Open in IMG/M |
| 3300010337|Ga0134062_10042208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1836 | Open in IMG/M |
| 3300010337|Ga0134062_10076349 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300010337|Ga0134062_10111174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300012198|Ga0137364_10207655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1437 | Open in IMG/M |
| 3300012201|Ga0137365_11251290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300012204|Ga0137374_10093179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2868 | Open in IMG/M |
| 3300012204|Ga0137374_10581201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300012204|Ga0137374_10960512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300012206|Ga0137380_10013966 | All Organisms → cellular organisms → Bacteria | 7322 | Open in IMG/M |
| 3300012207|Ga0137381_10177459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1841 | Open in IMG/M |
| 3300012208|Ga0137376_10967144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300012209|Ga0137379_10090535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2943 | Open in IMG/M |
| 3300012211|Ga0137377_10342255 | Not Available | 1432 | Open in IMG/M |
| 3300012211|Ga0137377_11833807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300012224|Ga0134028_1299437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300012285|Ga0137370_10820779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300012350|Ga0137372_10070279 | All Organisms → cellular organisms → Bacteria | 3017 | Open in IMG/M |
| 3300012350|Ga0137372_10675649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300012350|Ga0137372_10959212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300012351|Ga0137386_10443402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300012353|Ga0137367_10238850 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300012353|Ga0137367_10431423 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012355|Ga0137369_10528732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300012356|Ga0137371_10320165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1207 | Open in IMG/M |
| 3300012360|Ga0137375_11056077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300012372|Ga0134037_1145802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300012373|Ga0134042_1025480 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300012381|Ga0134026_1017558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300012381|Ga0134026_1214384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300012382|Ga0134038_1181877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012384|Ga0134036_1005080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300012386|Ga0134046_1023006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300012388|Ga0134031_1006008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300012392|Ga0134043_1326789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300012395|Ga0134044_1041693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300012398|Ga0134051_1147935 | Not Available | 560 | Open in IMG/M |
| 3300012402|Ga0134059_1349480 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300012409|Ga0134045_1458736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012532|Ga0137373_11008953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300012972|Ga0134077_10096528 | Not Available | 1140 | Open in IMG/M |
| 3300012972|Ga0134077_10345081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300012972|Ga0134077_10533215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300012975|Ga0134110_10405412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300012976|Ga0134076_10053692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1525 | Open in IMG/M |
| 3300012976|Ga0134076_10132007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300012976|Ga0134076_10298661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012977|Ga0134087_10141378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300014150|Ga0134081_10424808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300014154|Ga0134075_10162394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300014157|Ga0134078_10248695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300014157|Ga0134078_10388959 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300015356|Ga0134073_10149392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300015357|Ga0134072_10160157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300015359|Ga0134085_10009277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3618 | Open in IMG/M |
| 3300015359|Ga0134085_10019155 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 2595 | Open in IMG/M |
| 3300017654|Ga0134069_1203341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300017657|Ga0134074_1020199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2194 | Open in IMG/M |
| 3300017657|Ga0134074_1028568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1856 | Open in IMG/M |
| 3300017657|Ga0134074_1044582 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300018431|Ga0066655_10093813 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300018431|Ga0066655_10157089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1358 | Open in IMG/M |
| 3300018431|Ga0066655_10177261 | Not Available | 1295 | Open in IMG/M |
| 3300018431|Ga0066655_10182614 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300018431|Ga0066655_10409690 | Not Available | 894 | Open in IMG/M |
| 3300018433|Ga0066667_10032823 | All Organisms → cellular organisms → Bacteria | 2942 | Open in IMG/M |
| 3300018433|Ga0066667_10206907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1448 | Open in IMG/M |
| 3300018433|Ga0066667_10312950 | Not Available | 1228 | Open in IMG/M |
| 3300018433|Ga0066667_10354739 | Not Available | 1168 | Open in IMG/M |
| 3300018433|Ga0066667_10391185 | Not Available | 1120 | Open in IMG/M |
| 3300018433|Ga0066667_10866903 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300018433|Ga0066667_11379692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300018482|Ga0066669_10008889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4970 | Open in IMG/M |
| 3300018482|Ga0066669_10013156 | All Organisms → cellular organisms → Bacteria | 4327 | Open in IMG/M |
| 3300018482|Ga0066669_10034902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3020 | Open in IMG/M |
| 3300018482|Ga0066669_10234047 | Not Available | 1438 | Open in IMG/M |
| 3300018482|Ga0066669_10827581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300026307|Ga0209469_1046333 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300026314|Ga0209268_1159298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300026327|Ga0209266_1129696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300026327|Ga0209266_1170352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300026329|Ga0209375_1023029 | All Organisms → cellular organisms → Bacteria | 3528 | Open in IMG/M |
| 3300026329|Ga0209375_1038180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2514 | Open in IMG/M |
| 3300026329|Ga0209375_1060828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1833 | Open in IMG/M |
| 3300026343|Ga0209159_1028922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2989 | Open in IMG/M |
| 3300026343|Ga0209159_1102054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
| 3300026524|Ga0209690_1044318 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300026528|Ga0209378_1163266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300026540|Ga0209376_1062429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2071 | Open in IMG/M |
| 3300026547|Ga0209156_10031324 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
| 3300026547|Ga0209156_10221754 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300026548|Ga0209161_10162240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1281 | Open in IMG/M |
| 3300026548|Ga0209161_10448312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300030990|Ga0308178_1077340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 34.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 33.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010075 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010082 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010095 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012381 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066674_100171122 | 3300005166 | Soil | MSGTEHRRASAFIGGFKQLRLFHFSLSINHASRTKFDQFVNLATTK* |
| Ga0066674_100359652 | 3300005166 | Soil | ASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066683_101176932 | 3300005172 | Soil | MSRTEHRRASAFIGGSKQLRLFHFSFIINQASRTKFDQFVNLATTK* |
| Ga0066683_103642341 | 3300005172 | Soil | RASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066680_108321261 | 3300005174 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066673_102003031 | 3300005175 | Soil | RASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWTEQAEA* |
| Ga0066673_105798772 | 3300005175 | Soil | GAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVPTKWT* |
| Ga0066688_104176611 | 3300005178 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKW |
| Ga0066684_104746003 | 3300005179 | Soil | STPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDYFVNFVSTKWT* |
| Ga0066685_100409362 | 3300005180 | Soil | RCASAFIGGFKQLRLFHFSFVNHASWTKFDQFVNLATTK* |
| Ga0066685_100444903 | 3300005180 | Soil | MSGTEHRRSSVFIGGFKQLHLFHFSFINQPCLSRTKFDQFLNFVSTKRT* |
| Ga0066685_100654253 | 3300005180 | Soil | MSGAEHRRASAFIGGFKQLRLFYFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066685_109860452 | 3300005180 | Soil | EHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNSVTTK* |
| Ga0066676_100345794 | 3300005186 | Soil | EHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNLATTKWT* |
| Ga0066675_101931921 | 3300005187 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVKFVSTKWT* |
| Ga0066675_104220461 | 3300005187 | Soil | MNGSEHPRSSASIGGFKQLRLFDFSFINHASRTKFDQFVN |
| Ga0066686_104137711 | 3300005446 | Soil | MNGSEHPRSSASIGGFKQLRLFDFSFINHASRTKFDQFVNWRPP |
| Ga0066689_103656902 | 3300005447 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVN |
| Ga0066682_100242562 | 3300005450 | Soil | MSGAERRCASAFIGGFKQLRLFHFSFVNHASWTKFDQFVNLATTK* |
| Ga0066682_102866032 | 3300005450 | Soil | EHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVILATTK* |
| Ga0066682_103411691 | 3300005450 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDYFVNFVSTKWT* |
| Ga0066682_109384661 | 3300005450 | Soil | ADGRRSTPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRAKFEHFVNFVSTKRT* |
| Ga0066681_100210324 | 3300005451 | Soil | MSGAEHRRASAFIGGFKQLSLFHFSFINHASRTKFDHFVNFVSTKWA* |
| Ga0066681_101622322 | 3300005451 | Soil | MSGAEHRCASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVPTKWT* |
| Ga0066681_108887241 | 3300005451 | Soil | EHRRASAFIGGFKQLRLFHVSFINHASRTKFDQFVNLATTK* |
| Ga0066681_108913701 | 3300005451 | Soil | TEHRRASAFIGGSKQLRLFHFSFINQQASRTKFDQFVNLATTK* |
| Ga0066697_103883351 | 3300005540 | Soil | HRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066701_103036162 | 3300005552 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFEHFVNFVTTKWT* |
| Ga0066695_100134985 | 3300005553 | Soil | SAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066695_100191992 | 3300005553 | Soil | MSGLEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNLATTK* |
| Ga0066695_100270881 | 3300005553 | Soil | MSGAEHRRGSASIGGSKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066695_100860552 | 3300005553 | Soil | RRFTPMSGTEHRRASAFIGGFKQLHLFHFSFINQPCLSRTKFDQFLNFVSTKRT* |
| Ga0066707_100150812 | 3300005556 | Soil | MNGAEHRVASAFIGGFKQLRLFQFSFINHASPTKFDHFVNLVAT* |
| Ga0066703_103942911 | 3300005568 | Soil | GGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066706_100167153 | 3300005598 | Soil | MHADTPLSCTEHRRASAFIGGSKQLRLFHFSFINQQASRTKFDQFVNLATTK* |
| Ga0066706_100755911 | 3300005598 | Soil | TPVSGAEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066706_102743231 | 3300005598 | Soil | EHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVKFVSTKWT* |
| Ga0066706_108743601 | 3300005598 | Soil | MSGAEHRCASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFV |
| Ga0066651_100810041 | 3300006031 | Soil | IGGFKQLHLFHFSFINQPCLSRTKFDQFLNFVSTKRT* |
| Ga0066656_109861081 | 3300006034 | Soil | MFGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNF |
| Ga0066653_100121343 | 3300006791 | Soil | MSGTEHRRSSVFIGGFKQLHLFHFSFINQPCLSRTKFDQFLNLVS |
| Ga0066653_103406972 | 3300006791 | Soil | SAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKRT* |
| Ga0066665_104326001 | 3300006796 | Soil | HRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVKFVSTKWT* |
| Ga0066665_107793191 | 3300006796 | Soil | MSGAEHRRASAFIGGFKQLRLFHVSFINHASRTKFDHFVNFVSTKWT* |
| Ga0066659_100873413 | 3300006797 | Soil | MSRTEHRRASAFIGGSKQLRLFHFSFINQQASRTKFDQFVNLATTK* |
| Ga0066659_109280431 | 3300006797 | Soil | RRSTPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFEHFVNFVTTKWT* |
| Ga0066710_1001682083 | 3300009012 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFRFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066710_1004848172 | 3300009012 | Grasslands Soil | MSGVEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNSVTTK |
| Ga0066710_1008941234 | 3300009012 | Grasslands Soil | SAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066710_1023958351 | 3300009012 | Grasslands Soil | MSGCTPMSGAEHRRASAFIGGFKQLRLFHFSFINHAARTKFDQFVNLATTQWI |
| Ga0066710_1031238741 | 3300009012 | Grasslands Soil | MSGAAHRRASAFIGSFKQLRLFHFSFINQASRTKFDQFVNLATTK |
| Ga0066710_1038193151 | 3300009012 | Grasslands Soil | RASAFIGGFKQLRLFHFSFINHTSRTKFDQFVNLATTK |
| Ga0066710_1039985702 | 3300009012 | Grasslands Soil | MSGLEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQ |
| Ga0066710_1044516191 | 3300009012 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFRFSFINHASRTKFDQFVNLATTK |
| Ga0066709_1001438804 | 3300009137 | Grasslands Soil | MSRTEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVS |
| Ga0066709_1007968252 | 3300009137 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRFFHFSFINHASRTKFDQFVNVSTTKEK* |
| Ga0066709_1027912441 | 3300009137 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHF |
| Ga0066709_1042268711 | 3300009137 | Grasslands Soil | RRSTPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFEQFVNFVATK* |
| Ga0114129_124988302 | 3300009147 | Populus Rhizosphere | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNLATTK* |
| Ga0127434_1017171 | 3300010075 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFVNHASWTKFDQFVNLATTK* |
| Ga0127469_1946121 | 3300010082 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVRTNSL* |
| Ga0127475_10690281 | 3300010095 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNLAITK* |
| Ga0127491_10052902 | 3300010111 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWI* |
| Ga0127449_10245952 | 3300010117 | Grasslands Soil | MSGAEHRGASAFIGGFKQLRLFHFSFVNHASRTKFDQFVNLATTK* |
| Ga0127483_12083182 | 3300010142 | Grasslands Soil | RASAFIGGFKQLRLFHFSLSINHASRTKFDQFVNLATTK* |
| Ga0134070_100330261 | 3300010301 | Grasslands Soil | TPVSGAEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0134088_100664043 | 3300010304 | Grasslands Soil | MSGTEHRRSSVFIGGFKQLHLFHFSFINQPCLSRSKFDQFLNFVSTKRT* |
| Ga0134086_100082322 | 3300010323 | Grasslands Soil | VSGAEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0134064_100511152 | 3300010325 | Grasslands Soil | MSGAERRCASAFIGGFKQLRLFHFSFVNHASWTKFDQIVNLATTK* |
| Ga0134111_100114963 | 3300010329 | Grasslands Soil | MSGTEHRRSSVFIGGFKQLHLFHFSFINQPCLSRTKFDQFLNLVSTKRT* |
| Ga0134111_100348862 | 3300010329 | Grasslands Soil | RCTPMSGTEHRRASAFIGGFKQLRLFHFSLSINHASRTKFDQFVNLATTK* |
| Ga0134111_103147312 | 3300010329 | Grasslands Soil | FIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0134080_100040741 | 3300010333 | Grasslands Soil | HRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATK* |
| Ga0134080_100078891 | 3300010333 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFQFSFINHASPTKFDHFVNLVAT* |
| Ga0134080_100305101 | 3300010333 | Grasslands Soil | HRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0134080_101597531 | 3300010333 | Grasslands Soil | IGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0134080_104922171 | 3300010333 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNF |
| Ga0134063_103639422 | 3300010335 | Grasslands Soil | MSGTEHRRASAFIGGFKTTALVPFLSLLSINHASRTKFDQFVNLATTKWT* |
| Ga0134071_105175701 | 3300010336 | Grasslands Soil | AFIGGFKQLRLFHFSFINHASRTKFDQFVNSVTTK* |
| Ga0134062_100208314 | 3300010337 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRMFRFSFINHASRTKFDQFVNLATTK* |
| Ga0134062_100422081 | 3300010337 | Grasslands Soil | RRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0134062_100763491 | 3300010337 | Grasslands Soil | VSGAEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATK |
| Ga0134062_101111742 | 3300010337 | Grasslands Soil | RRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWI* |
| Ga0137364_102076552 | 3300012198 | Vadose Zone Soil | MSRTEHRRASAFIGGSKQLRLFHFSFINHASRTKFDQFVNLATTK* |
| Ga0137365_112512901 | 3300012201 | Vadose Zone Soil | MSGAEHRRASAFVGGFKQLRLFHFSFINQASRTKFDHFVNFVSTKWT* |
| Ga0137374_100931795 | 3300012204 | Vadose Zone Soil | MSGAEHRRGSAFTGGFKQLRLFHFSFINHASRTKFDQFVNLATTK* |
| Ga0137374_105812012 | 3300012204 | Vadose Zone Soil | VSLIPPSNREPPMHADDRRRTSAFIGGFKQPRLFYFSFNNHASRTKFDQFLNLATTK* |
| Ga0137374_109605121 | 3300012204 | Vadose Zone Soil | MHADSPMSGAEHRRASAFIGGFKQLRLFHFSFINHAS |
| Ga0137380_100139661 | 3300012206 | Vadose Zone Soil | STPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0137381_101774592 | 3300012207 | Vadose Zone Soil | RRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0137376_109671441 | 3300012208 | Vadose Zone Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINQQASRTKFDQFVNLATTK* |
| Ga0137379_100905355 | 3300012209 | Vadose Zone Soil | GGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0137377_103422552 | 3300012211 | Vadose Zone Soil | MSGTEHRRASAFIGGFKQLRLFHFSFIYHASRTKFDHFVNFVSTKWT* |
| Ga0137377_118338071 | 3300012211 | Vadose Zone Soil | MNADVRRRTSAFIGGSKQLRLFHFSFNNHTSRTKFDQFLNLATTK* |
| Ga0134028_12994371 | 3300012224 | Grasslands Soil | MSGAGHRRASAFIGGFKQLRLFRFSFINHASRTKFDQFVNLATTK* |
| Ga0137370_108207791 | 3300012285 | Vadose Zone Soil | MSRAEHRRASAFISGSKQLRLFHFSFINHASRTKFDHFVNFVS |
| Ga0137372_100702792 | 3300012350 | Vadose Zone Soil | MSGAEHLRASAFIGGFKQLRLFHFSFINHAYRTKFDHFVNLVAT* |
| Ga0137372_106756492 | 3300012350 | Vadose Zone Soil | PMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNLAE* |
| Ga0137372_109592121 | 3300012350 | Vadose Zone Soil | MSGTEHRRASAFIGGFKQLRLFHFSLSINHASRTKFDQFVN |
| Ga0137386_104434021 | 3300012351 | Vadose Zone Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWS* |
| Ga0137367_102388502 | 3300012353 | Vadose Zone Soil | MSGAEHPRASTFIGGFKQLRLFHFSLINHASRTKFDQFVNLATTK* |
| Ga0137367_104314232 | 3300012353 | Vadose Zone Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVTLATTK* |
| Ga0137369_105287321 | 3300012355 | Vadose Zone Soil | MHADSPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHL* |
| Ga0137371_103201653 | 3300012356 | Vadose Zone Soil | MSGAEHRRASAFMGGFKQLRLLHFSFINHASRTTFDHVVIFV |
| Ga0137375_110560771 | 3300012360 | Vadose Zone Soil | FIGGFKQLRLFHFSLINHASRTKFDQFVNLATTK* |
| Ga0134037_11458021 | 3300012372 | Grasslands Soil | MSGAEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0134042_10254802 | 3300012373 | Grasslands Soil | MSGAEHRGASAFIGGFKQLRLFHFSFINHASRTKFDQFVNLATTK* |
| Ga0134026_10175582 | 3300012381 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVPTKWT* |
| Ga0134026_12143842 | 3300012381 | Grasslands Soil | MTGTEHRRAAAFIGGFKQLRLFHFSFVNHASWTKFDQFVNLATTK* |
| Ga0134038_11818771 | 3300012382 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFV |
| Ga0134036_10050802 | 3300012384 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHVSFINHASRTKFDHFVNFVATKWT* |
| Ga0134046_10230062 | 3300012386 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFQFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0134031_10060082 | 3300012388 | Grasslands Soil | MSVAERRCASAFIGGFKQLRLFHFSFVNHASWTKFDQFVNLATTK* |
| Ga0134043_13267892 | 3300012392 | Grasslands Soil | MSGAEHRGASAFIGGFKQLRLFHFSFVNHASWTKFDQFVNLATTK* |
| Ga0134044_10416931 | 3300012395 | Grasslands Soil | MSRTEHRRASAFIGGFKQLSLFHFSFINHASRTKFDHFV |
| Ga0134051_11479351 | 3300012398 | Grasslands Soil | RRSTPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNLATTK* |
| Ga0134059_13494802 | 3300012402 | Grasslands Soil | MSGLEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0134045_14587361 | 3300012409 | Grasslands Soil | MPMSGTEHRRASAFIGGFKQLRLFHFSFVNHASRTKFDQFVNLATTK* |
| Ga0137373_110089532 | 3300012532 | Vadose Zone Soil | ASAFIGGFKRLRLFHFSFVNHASRTKFDQFVNLATTK* |
| Ga0134077_100965282 | 3300012972 | Grasslands Soil | MSGAERRCASAFIGGFKQLRLFHFSFVNHASRTKFDQFVNLATTK* |
| Ga0134077_103450812 | 3300012972 | Grasslands Soil | MSGSEHRRASAFIGGFKQLRFFHFSFINHASRTKFDQFVNVSTTKEK* |
| Ga0134077_105332152 | 3300012972 | Grasslands Soil | ASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT* |
| Ga0134110_104054122 | 3300012975 | Grasslands Soil | GTEHRRASAFNPGFKQLLFHFPFINQPCLSDEIDQFVNLATTK* |
| Ga0134076_100536922 | 3300012976 | Grasslands Soil | FIGGFKQLHLFHFSFINQPCLSRTKFDQFLNFVSTKRT* |
| Ga0134076_101320071 | 3300012976 | Grasslands Soil | IGGFKQLRLFHFSFMNHASRTKFDHFVNFVSTKWS* |
| Ga0134076_102986612 | 3300012976 | Grasslands Soil | IGGFKQLRLFHFSFMNHASRTKFDHFVNFVSTKWT* |
| Ga0134087_101413782 | 3300012977 | Grasslands Soil | RRSTPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVKFVSTKWT* |
| Ga0134081_104248081 | 3300014150 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFRFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0134075_101623941 | 3300014154 | Grasslands Soil | HRRASAFIGGFKQLRLFHFSLSINHASRTKFDQFVNLATTK* |
| Ga0134078_102486951 | 3300014157 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFV |
| Ga0134078_103889592 | 3300014157 | Grasslands Soil | GGFKKQLRVFHFSFINHAFRTKFDQFVISVSTKWS* |
| Ga0134073_101493921 | 3300015356 | Grasslands Soil | MTGTEHRRAAAFIGGFKQLRLFHFPFINQPCLSDEIDQFVNLATTK* |
| Ga0134072_101601572 | 3300015357 | Grasslands Soil | MTGTEHRRAAAFIGGFKQLLFHFPFINQPCLSDEIDQFVNLATTK* |
| Ga0134085_100092771 | 3300015359 | Grasslands Soil | ASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVPTKWT* |
| Ga0134085_100191551 | 3300015359 | Grasslands Soil | IGGFKQLGLFHFSFINHASRTKFDHFVNFVSTKWT* |
| Ga0134069_12033412 | 3300017654 | Grasslands Soil | MSGTEHRRSSVFIGGFKQLHLFHFSFINQPCLSRTKFDQFLNFVSTKRT |
| Ga0134074_10201993 | 3300017657 | Grasslands Soil | MSRTEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT |
| Ga0134074_10285682 | 3300017657 | Grasslands Soil | ASAFIGGFKQLRLFQFSFINHASPTKFDHFVNLVAT |
| Ga0134074_10445821 | 3300017657 | Grasslands Soil | MNGSEHPRSSASIGGFRQLRLFDFSFINHASRTKFDQF |
| Ga0066655_100938131 | 3300018431 | Grasslands Soil | MNGSEHPRSSASIGGFKQLRLFDFSFINHASRTKFDQFV |
| Ga0066655_101570892 | 3300018431 | Grasslands Soil | MSGAAHRRASAFIGGFKQLRLFHFSFINHASRTKFDQFVNLATTK |
| Ga0066655_101772612 | 3300018431 | Grasslands Soil | VSGAEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVATKWT |
| Ga0066655_101826142 | 3300018431 | Grasslands Soil | RASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066655_104096902 | 3300018431 | Grasslands Soil | AFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066667_100328234 | 3300018433 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066667_102069072 | 3300018433 | Grasslands Soil | MSGAERRCASAFIGGFKQLRLFHFSFVNHASWTKFDQFVNLATTK |
| Ga0066667_103129501 | 3300018433 | Grasslands Soil | RRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWI |
| Ga0066667_103547392 | 3300018433 | Grasslands Soil | ASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066667_103911852 | 3300018433 | Grasslands Soil | VSGAEHRRASAFIGGFKQLGLFHCSFINHASRTKFDHFVNFVATKWT |
| Ga0066667_108669031 | 3300018433 | Grasslands Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFD |
| Ga0066667_113796922 | 3300018433 | Grasslands Soil | MSCTEHRRASAFIGGSKQLRLFHFSFINQQASRTKFDQFVNLATTK |
| Ga0066669_100088891 | 3300018482 | Grasslands Soil | GAEHRRAFALIGGFKQLRLFHFSFINPAARTKFDHFVNFVYTKWT |
| Ga0066669_100131567 | 3300018482 | Grasslands Soil | TPVSGAEHRRASAFIGGFKQLGLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066669_100349021 | 3300018482 | Grasslands Soil | TPMSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066669_102340472 | 3300018482 | Grasslands Soil | MSGAEHRRASAFIGGFKQMRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0066669_108275811 | 3300018482 | Grasslands Soil | RASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVPTKWT |
| Ga0209469_10463331 | 3300026307 | Soil | MSGAEHRPASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKW |
| Ga0209268_11592982 | 3300026314 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVKFVPTKWT |
| Ga0209266_11296962 | 3300026327 | Soil | RRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWT |
| Ga0209266_11703522 | 3300026327 | Soil | MSGTEHRRASAFIGGFKQLRLFHFSLSINHASRTKFDQFVNLATTK |
| Ga0209375_10230292 | 3300026329 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDYFVNFVSTKWT |
| Ga0209375_10381801 | 3300026329 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDH |
| Ga0209375_10608281 | 3300026329 | Soil | MSGAAHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWTEQAEA |
| Ga0209159_10289221 | 3300026343 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVPTKWT |
| Ga0209159_11020542 | 3300026343 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVKFVSTKWT |
| Ga0209690_10443182 | 3300026524 | Soil | EHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWR |
| Ga0209378_11632661 | 3300026528 | Soil | MNGAEHRVASAFIGGFKQLRLFQFSFINHASPTKFDHFVNLVAT |
| Ga0209376_10624293 | 3300026540 | Soil | MSGAEHRRASAFIGGFKQLRLFYFSFINHASRTKFDHFVNFVSTKWT |
| Ga0209156_100313241 | 3300026547 | Soil | FIGGFKQLRLFHFSFINHGSRTKFDHFVNFVSTKWT |
| Ga0209156_102217543 | 3300026547 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVNFVSTKWI |
| Ga0209161_101622401 | 3300026548 | Soil | EHRRASAFIGGFKQLRLFHFSFINHASRTKFDHFVKFVSTKWT |
| Ga0209161_104483121 | 3300026548 | Soil | MSRTEHRRAAAFIGGFKQLGLFHFSFINHASRTKFDHFVN |
| Ga0308178_10773402 | 3300030990 | Soil | MSGAEHRRASAFIGGFKQLRLFHFSFINHASRAKFDQFLNLATTK |
| ⦗Top⦘ |