| Basic Information | |
|---|---|
| Family ID | F034826 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 173 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ALQGYLLTDGLEAPARPGEVDRPIRETNVPTPERTMSPGEGMPRP |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 173 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.16 % |
| % of genes near scaffold ends (potentially truncated) | 98.84 % |
| % of genes from short scaffolds (< 2000 bps) | 86.13 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.110 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.324 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.838 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.757 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 173 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 40.46 |
| PF08308 | PEGA | 5.20 |
| PF10127 | RlaP | 2.31 |
| PF01979 | Amidohydro_1 | 1.16 |
| PF01799 | Fer2_2 | 1.16 |
| PF07394 | DUF1501 | 0.58 |
| PF04185 | Phosphoesterase | 0.58 |
| PF13442 | Cytochrome_CBB3 | 0.58 |
| PF02687 | FtsX | 0.58 |
| PF08241 | Methyltransf_11 | 0.58 |
| PF13228 | DUF4037 | 0.58 |
| PF02574 | S-methyl_trans | 0.58 |
| PF02321 | OEP | 0.58 |
| PF00005 | ABC_tran | 0.58 |
| PF00111 | Fer2 | 0.58 |
| PF00392 | GntR | 0.58 |
| PF00135 | COesterase | 0.58 |
| PF12796 | Ank_2 | 0.58 |
| PF01402 | RHH_1 | 0.58 |
| PF03572 | Peptidase_S41 | 0.58 |
| PF07495 | Y_Y_Y | 0.58 |
| PF00903 | Glyoxalase | 0.58 |
| PF02567 | PhzC-PhzF | 0.58 |
| COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 161.85 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.16 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.58 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.58 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.58 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.58 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.58 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.11 % |
| Unclassified | root | N/A | 2.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01CU7DX | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300000955|JGI1027J12803_107216710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300001086|JGI12709J13192_1008677 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300002912|JGI25386J43895_10059745 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300002914|JGI25617J43924_10189482 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300002917|JGI25616J43925_10193786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300003351|JGI26346J50198_1018156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300004152|Ga0062386_100707723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300005447|Ga0066689_10039634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2464 | Open in IMG/M |
| 3300005451|Ga0066681_10382370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300005556|Ga0066707_10475124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300005587|Ga0066654_10295230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300005921|Ga0070766_11197207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300006041|Ga0075023_100187882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300006052|Ga0075029_100106566 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300006059|Ga0075017_101203599 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300007258|Ga0099793_10319488 | Not Available | 756 | Open in IMG/M |
| 3300007265|Ga0099794_10007338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4523 | Open in IMG/M |
| 3300007265|Ga0099794_10241918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300007351|Ga0104751_1229648 | Not Available | 637 | Open in IMG/M |
| 3300009012|Ga0066710_103839894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300009038|Ga0099829_10983221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300009089|Ga0099828_10832679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300009089|Ga0099828_11485417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300009698|Ga0116216_10354279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300010304|Ga0134088_10016061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3261 | Open in IMG/M |
| 3300010322|Ga0134084_10094943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
| 3300010326|Ga0134065_10058511 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1205 | Open in IMG/M |
| 3300010335|Ga0134063_10624149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 551 | Open in IMG/M |
| 3300010359|Ga0126376_10177427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1739 | Open in IMG/M |
| 3300010360|Ga0126372_12479312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300010361|Ga0126378_10927999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300010361|Ga0126378_10937508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 971 | Open in IMG/M |
| 3300010366|Ga0126379_10158222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2123 | Open in IMG/M |
| 3300010398|Ga0126383_10071257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2991 | Open in IMG/M |
| 3300010880|Ga0126350_11428905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300011269|Ga0137392_10187106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
| 3300011269|Ga0137392_10723451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300011269|Ga0137392_11058301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300011269|Ga0137392_11110870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300011270|Ga0137391_10812378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 770 | Open in IMG/M |
| 3300011271|Ga0137393_11158384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300011271|Ga0137393_11175179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300011271|Ga0137393_11248395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300012199|Ga0137383_10810181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300012200|Ga0137382_10697775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300012202|Ga0137363_10769703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300012203|Ga0137399_11787175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300012351|Ga0137386_10087652 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
| 3300012354|Ga0137366_10197815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300012357|Ga0137384_11498600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012362|Ga0137361_11775322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012363|Ga0137390_11722401 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012924|Ga0137413_10782388 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012925|Ga0137419_11891156 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012927|Ga0137416_11468937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300012930|Ga0137407_11382785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300012948|Ga0126375_10737375 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012960|Ga0164301_10477585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300012989|Ga0164305_10458364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300014157|Ga0134078_10164678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 882 | Open in IMG/M |
| 3300014200|Ga0181526_10594331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300014657|Ga0181522_10613257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300015054|Ga0137420_1000073 | Not Available | 1066 | Open in IMG/M |
| 3300015241|Ga0137418_10011043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8311 | Open in IMG/M |
| 3300016341|Ga0182035_11139837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300016357|Ga0182032_10539444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300016357|Ga0182032_11737955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 544 | Open in IMG/M |
| 3300016404|Ga0182037_11590955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300017823|Ga0187818_10529101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300017934|Ga0187803_10049494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1660 | Open in IMG/M |
| 3300017959|Ga0187779_10431488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300017970|Ga0187783_10735858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300017973|Ga0187780_10039494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3306 | Open in IMG/M |
| 3300020579|Ga0210407_10333646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300020579|Ga0210407_10593692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300020580|Ga0210403_10035939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3961 | Open in IMG/M |
| 3300020580|Ga0210403_10320149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300021046|Ga0215015_10971478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300021168|Ga0210406_10044627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3912 | Open in IMG/M |
| 3300021168|Ga0210406_10144034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2002 | Open in IMG/M |
| 3300021171|Ga0210405_10761073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300021178|Ga0210408_10255477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1396 | Open in IMG/M |
| 3300021178|Ga0210408_11284440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300021180|Ga0210396_10107635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2519 | Open in IMG/M |
| 3300021180|Ga0210396_10288585 | Not Available | 1454 | Open in IMG/M |
| 3300021180|Ga0210396_10631769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300021180|Ga0210396_11497127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300021181|Ga0210388_10006376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9256 | Open in IMG/M |
| 3300021401|Ga0210393_10890770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300021403|Ga0210397_10154164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1608 | Open in IMG/M |
| 3300021404|Ga0210389_10582974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 879 | Open in IMG/M |
| 3300021406|Ga0210386_11209329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300021420|Ga0210394_10029291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4972 | Open in IMG/M |
| 3300021420|Ga0210394_10362220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300021432|Ga0210384_11309225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300021433|Ga0210391_10097427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2320 | Open in IMG/M |
| 3300021433|Ga0210391_11229939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300021433|Ga0210391_11498943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300021475|Ga0210392_10763228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300021476|Ga0187846_10039457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2112 | Open in IMG/M |
| 3300021477|Ga0210398_11115430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300021477|Ga0210398_11219463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300021478|Ga0210402_10100254 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300021478|Ga0210402_10137703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2217 | Open in IMG/M |
| 3300021478|Ga0210402_11665994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300021479|Ga0210410_10218799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1707 | Open in IMG/M |
| 3300021479|Ga0210410_11285432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300021559|Ga0210409_10967466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300024181|Ga0247693_1015976 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300024246|Ga0247680_1039715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300026301|Ga0209238_1068830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1247 | Open in IMG/M |
| 3300026301|Ga0209238_1138860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 772 | Open in IMG/M |
| 3300026310|Ga0209239_1100195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1230 | Open in IMG/M |
| 3300026326|Ga0209801_1000654 | All Organisms → cellular organisms → Bacteria | 22589 | Open in IMG/M |
| 3300026490|Ga0257153_1014635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
| 3300026542|Ga0209805_1210656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300026547|Ga0209156_10310204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300026547|Ga0209156_10397504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300026551|Ga0209648_10252690 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300026551|Ga0209648_10538595 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300026921|Ga0207860_1031581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300027548|Ga0209523_1053060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300027583|Ga0209527_1083863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300027825|Ga0209039_10054615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1807 | Open in IMG/M |
| 3300027846|Ga0209180_10659599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300027867|Ga0209167_10757930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300027889|Ga0209380_10409864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300027894|Ga0209068_10453358 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300027895|Ga0209624_10365793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300027910|Ga0209583_10248419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300028047|Ga0209526_10710589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300028146|Ga0247682_1009517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1674 | Open in IMG/M |
| 3300029636|Ga0222749_10709541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300030862|Ga0265753_1095828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300030972|Ga0075400_11275569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300031231|Ga0170824_114627776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300031543|Ga0318516_10549428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300031572|Ga0318515_10152030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
| 3300031681|Ga0318572_10243513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300031715|Ga0307476_10835679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300031716|Ga0310813_11973212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300031720|Ga0307469_11452254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300031754|Ga0307475_10807926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300031754|Ga0307475_11415411 | Not Available | 535 | Open in IMG/M |
| 3300031782|Ga0318552_10483120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300031798|Ga0318523_10097627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300031820|Ga0307473_11183890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031823|Ga0307478_10309824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300031823|Ga0307478_10412406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1120 | Open in IMG/M |
| 3300031823|Ga0307478_10573924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300031947|Ga0310909_10660718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300031962|Ga0307479_10106913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2721 | Open in IMG/M |
| 3300031962|Ga0307479_11228987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300031962|Ga0307479_11350031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300031962|Ga0307479_11519481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300032025|Ga0318507_10444612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300032044|Ga0318558_10194955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300032059|Ga0318533_10819794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300032064|Ga0318510_10232629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300032174|Ga0307470_10538872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300032180|Ga0307471_100081685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2846 | Open in IMG/M |
| 3300032180|Ga0307471_100162327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2171 | Open in IMG/M |
| 3300032180|Ga0307471_100163497 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2165 | Open in IMG/M |
| 3300032180|Ga0307471_102522304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300032180|Ga0307471_102689769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300032180|Ga0307471_103234942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas taiwanensis → Chitinimonas taiwanensis DSM 18899 | 577 | Open in IMG/M |
| 3300032770|Ga0335085_10280167 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300032770|Ga0335085_10962527 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300032828|Ga0335080_12277935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300032892|Ga0335081_11218617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300032893|Ga0335069_10242487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2173 | Open in IMG/M |
| 3300032893|Ga0335069_11358768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.73% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
| Deep Subsurface Aquifer | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer | 0.58% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.58% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.58% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007351 | Combined Assembly of Gp0115775, Gp0115815 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_1446610 | 2032320005 | Soil | GIALEGYLLTDGLEAPARPGEVDRPVRETNVPAPERTMSPREPMLQP |
| JGI1027J12803_1072167102 | 3300000955 | Soil | FLLTDGLEAPARPGEMDRPVRETNVPMPERTMGPDTSSPRR* |
| JGI12709J13192_10086771 | 3300001086 | Forest Soil | TDGLEAPARPGEVDRPVRETNVPMPERTMSPAETVRRNP* |
| JGI25386J43895_100597452 | 3300002912 | Grasslands Soil | LLTDGLEAPARPGEVDRPVRETNVPMPERTMSPADTVKRNP* |
| JGI25617J43924_101894821 | 3300002914 | Grasslands Soil | LLTDGLEAPARPGEVDRPVRETNVPMPERTMSPGETVRRNP* |
| JGI25616J43925_101937862 | 3300002917 | Grasslands Soil | WTNGIALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESTRNP* |
| JGI26346J50198_10181561 | 3300003351 | Bog Forest Soil | LQGYLLTDGLEAPSRPGEVDRPIRETNVPMPERSRSPGEGLPRP* |
| Ga0062386_1007077231 | 3300004152 | Bog Forest Soil | LLTDGLQSPARPGEVDRPVREINVPLPDRTLSPIYGMPRP* |
| Ga0066689_100396342 | 3300005447 | Soil | TNGIALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESMRNP* |
| Ga0066681_103823701 | 3300005451 | Soil | WTNGIALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESMRNP* |
| Ga0066707_104751241 | 3300005556 | Soil | LQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTMSPRETMRNP* |
| Ga0066654_102952302 | 3300005587 | Soil | NGIALEGYLLTDGLEAPARPGEVDRPVRETNVPMPERTVSPRESTRNP* |
| Ga0070766_111972071 | 3300005921 | Soil | DGLEAPSRPGEVDRPIRETNVPMPERNMSPGEAMPRP* |
| Ga0075023_1001878822 | 3300006041 | Watersheds | IALEGYLLTDGLEAPARPGEVDRPIRETNIPMPERTLSPGESMPRP* |
| Ga0075029_1001065661 | 3300006052 | Watersheds | SGIALQGFLLTDGLEAPAHPGEIDRPIRETNLPVPERLMAPVMPAQP* |
| Ga0075017_1012035991 | 3300006059 | Watersheds | GFLLTDGLEAPAHPGEIDRPIRETNLPVPERLMAPVMPAQP* |
| Ga0099793_103194882 | 3300007258 | Vadose Zone Soil | ALENVWTAGIALQGFLLTDGLESPARPGEADRPIRETNLPLLDRMMSPTDSMPRP* |
| Ga0099794_100073382 | 3300007265 | Vadose Zone Soil | MRKRILLTVGLEAPARPGEVDRPVRETNVPMPERTMSTGESMPRP* |
| Ga0099794_102419181 | 3300007265 | Vadose Zone Soil | LLTDGLEAPARPGEVDRPVRETNVPMPERTMSPREPVRNP* |
| Ga0104751_12296482 | 3300007351 | Deep Subsurface Aquifer | RPIDLSLLTDGLEAPARPGEVDLPVREINMPMMPRMRSREE* |
| Ga0066710_1038398941 | 3300009012 | Grasslands Soil | TSGIALQGFLLTDGLEAPARPGEVDRPVRETNVPMPERATSPGEGRPRP |
| Ga0099829_109832212 | 3300009038 | Vadose Zone Soil | LEAPARPGEVDRPVRETNVPMPERTVSPRESTRNP* |
| Ga0099828_108326791 | 3300009089 | Vadose Zone Soil | GYLLTDGLEAPARPGEVDRPVRETNVPMPERRMSPRESTRNP* |
| Ga0099828_114854171 | 3300009089 | Vadose Zone Soil | SVWTNGIALQGYLLTDGLEAPARPGEVDRPVREANVPMLERTMSPRESMRNP* |
| Ga0116216_103542792 | 3300009698 | Peatlands Soil | IALQGFLLTDGLEAPARPGEVDRPVRETNVPAPDRGLVPALAIPHP* |
| Ga0134088_100160611 | 3300010304 | Grasslands Soil | TDGLEAPARPGEVDRPVRETNVPMPERTMSPADTVKRNP* |
| Ga0134084_100949432 | 3300010322 | Grasslands Soil | GYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESMRNP* |
| Ga0134065_100585111 | 3300010326 | Grasslands Soil | FLLTDGLEAPARPGEMDRPIRETNVPMPDRTMGPERTTGPESNVPKP* |
| Ga0134063_106241491 | 3300010335 | Grasslands Soil | LQGFLLTDGLEAPARPGEMDRPIRETNVPMPERTTGPESNAPRP* |
| Ga0126376_101774272 | 3300010359 | Tropical Forest Soil | YLLTDGLEAPARPGDVDRPIRETNVPVPERTMSPEDRTTPRP* |
| Ga0126372_124793121 | 3300010360 | Tropical Forest Soil | GLESPARPGEIDRPIRETNVPMPERTMSPLDSLPRP* |
| Ga0126378_109279992 | 3300010361 | Tropical Forest Soil | ALQGFLLTDGLESPARPGEIDRPIRETNVPMPERTMSPLDSLPRP* |
| Ga0126378_109375082 | 3300010361 | Tropical Forest Soil | ALQGFLLTDGLESPARPGEIDRPIRETNVPMPERTMSPLDSLSRP* |
| Ga0126379_101582221 | 3300010366 | Tropical Forest Soil | EAPARPGDVDRPIRKTNVPVPERTMSPEDRTTPRP* |
| Ga0126383_100712571 | 3300010398 | Tropical Forest Soil | LQGFLLTDGLEAPARPGEVDRPIRETNLPVPDRMMSPSDSMPRP* |
| Ga0126350_114289051 | 3300010880 | Boreal Forest Soil | VWTNGIALQGYLLTDGLEAPSAPGEVDRPIRETNVPSPERTMSPGEAMPRP* |
| Ga0137392_101871062 | 3300011269 | Vadose Zone Soil | RKHTLLTVGPEAPARPGEVDRSVRETNVPMPERTMSTGESMPRP* |
| Ga0137392_107234511 | 3300011269 | Vadose Zone Soil | IALQGYLLTDGLEAPARPGEMDRPVRETNVPMPERSMSPGESMRRP* |
| Ga0137392_110583012 | 3300011269 | Vadose Zone Soil | NGIALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESMRNP* |
| Ga0137392_111108702 | 3300011269 | Vadose Zone Soil | VWTNGIALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMAPRESIRNP* |
| Ga0137391_108123781 | 3300011270 | Vadose Zone Soil | VWTNGIALQGYLLTDGLEAPSRPGEIDRPIRETNVPIPERTMSPGEPMPRP* |
| Ga0137393_111583842 | 3300011271 | Vadose Zone Soil | EAPARPGEVDRPIRETNVPAPERTMAPGDSVRNP* |
| Ga0137393_111751792 | 3300011271 | Vadose Zone Soil | LQGYLLTDGLEAPARPSEVDRPVRETNVPMPERTMSPREPVRNR* |
| Ga0137393_112483952 | 3300011271 | Vadose Zone Soil | ALQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTVSPRESTRNP* |
| Ga0137383_108101812 | 3300012199 | Vadose Zone Soil | VWTNGLALQGFLLTDGLEAPARPGEVDRPIRETNVPAPERTMAPGVSVRNP* |
| Ga0137382_106977752 | 3300012200 | Vadose Zone Soil | LQGFLLTDGLEAPARPDEVDRPVRETNVPMPERTMPPGEGRRRP* |
| Ga0137363_107697031 | 3300012202 | Vadose Zone Soil | ALEGYLLTDGLEAPARPGEVDRPVRETNVPAPERTMSPRELIPQP* |
| Ga0137399_117871751 | 3300012203 | Vadose Zone Soil | AGIALQGFLLTDGLESPARPGEVDRPVRETNLPLPDRMMSPSDSMPRP* |
| Ga0137386_100876521 | 3300012351 | Vadose Zone Soil | APARPGEVDRPVRETNVPMPERTMSPADTVKRNP* |
| Ga0137366_101978151 | 3300012354 | Vadose Zone Soil | NGIALQGYLLTDGLEAPARPGEVDRPIRETNVPAPERTMAPGVSVRNP* |
| Ga0137384_114986001 | 3300012357 | Vadose Zone Soil | VWTTGLALQGYLLTDGLEVPARPSEMDRAIRETNVPMPERTRAPGE* |
| Ga0137361_117753222 | 3300012362 | Vadose Zone Soil | WTNGLALQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTMSPREPVRNP* |
| Ga0137390_117224011 | 3300012363 | Vadose Zone Soil | LEAPARPGEVDRPVRETNVPMPERTMTPGETVRRNP* |
| Ga0137413_107823882 | 3300012924 | Vadose Zone Soil | WTAGIALQGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSPTDAMPRP* |
| Ga0137419_118911561 | 3300012925 | Vadose Zone Soil | MDSKLPRPGEVDRPMHETNVPVPERTLAPGEAVRRNP* |
| Ga0137416_114689371 | 3300012927 | Vadose Zone Soil | NGIALQGYLLTDGLEGPARPGEVDRPIRETNVPMPERTMSPRESMRNP* |
| Ga0137407_113827852 | 3300012930 | Vadose Zone Soil | QGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESMRNP* |
| Ga0126375_107373751 | 3300012948 | Tropical Forest Soil | VALQGYLLTDGLEAPARPGDVDRPIRETNVPVPERTMSPEDRTTPRP* |
| Ga0164301_104775852 | 3300012960 | Soil | LLTDGLEAPARPAEMDRAIRETNVPMPERTRSPGE* |
| Ga0164305_104583641 | 3300012989 | Soil | TGLALQGFLLTDGLEAPARPAEMDRAIRETNVPMPERTRSPGE* |
| Ga0134078_101646782 | 3300014157 | Grasslands Soil | FLLTDGLEAPARPGEMDRPIRETNVPMPERTTGPESNVPKP* |
| Ga0181526_105943311 | 3300014200 | Bog | TWTTGIALEGFLLTDGLEAPSRPNEVDRTLRETNMPLPERTISPLEEMPRP* |
| Ga0181522_106132571 | 3300014657 | Bog | NGIALQGYLLTDGLEAPAAPGEVDRPIRETNVPTPERTMSPGEAMPRP* |
| Ga0137420_10000731 | 3300015054 | Vadose Zone Soil | TAGIALQGFLLTDGLESPARPGEVDRPIRETNLPLLPDRMMSPTDSMPRP* |
| Ga0137418_100110434 | 3300015241 | Vadose Zone Soil | NGIALEGYLLTDGLEAPARPGEVDRPVRETNVPAPERTMSPRERMLQP* |
| Ga0182035_111398372 | 3300016341 | Soil | LLTDGLEAPARPAEVDRPVRETNVPMPERIMSPMENLPRP |
| Ga0182032_105394442 | 3300016357 | Soil | DGLEAPSRPSEIDRPIRETNLPMPERNPVFDPMPRP |
| Ga0182032_117379552 | 3300016357 | Soil | LQGYLLTDGLEAPARPSEVDRPVRETNVPMSRSMSPQQ |
| Ga0182037_115909551 | 3300016404 | Soil | LLTDGLEAPARPSEVDRPIREINVPMPDRTLSPMDTMPRP |
| Ga0187818_105291011 | 3300017823 | Freshwater Sediment | TLWTTGTALQGFLLTDGLEAPASPAEIDRPIRETNVPIPERTMSPLDTMPRP |
| Ga0187803_100494942 | 3300017934 | Freshwater Sediment | YLLTDGLEAPARPGEVDRPVREMNVPMPERTLSPGESMPRP |
| Ga0187779_104314881 | 3300017959 | Tropical Peatland | LQGFLLTDGLEAPARPGEIDRPIRETNVPMPERSATFDPVPRP |
| Ga0187783_107358581 | 3300017970 | Tropical Peatland | LQGYLLTDGLEAPARPGEVDLPVRETNIPSPERTMSPGEPMPRP |
| Ga0187780_100394942 | 3300017973 | Tropical Peatland | TDGLEAPARPGEIDRPIRETNVPMPERSAPFDPVPRP |
| Ga0210407_103336461 | 3300020579 | Soil | ALQGYLLTDGLEAPARPGEVDRPIRETNVPTPERTMSPGEGMPRP |
| Ga0210407_105936921 | 3300020579 | Soil | GIALEGYLLTDGLEAPARPGEVDRPVRETNVPAPERTMSPRELMPQP |
| Ga0210403_100359391 | 3300020580 | Soil | LTDGLESPARPGEVDRPIRETNLPLPDRMMSLSDSMPRP |
| Ga0210403_103201493 | 3300020580 | Soil | VWTAGIALQGFLLTDGLESPARPTEVDRPIRETNLPLPDRMMSPSDSMPRP |
| Ga0215015_109714781 | 3300021046 | Soil | KRQGYLLTDGLEAPARPGEVDRPIRETNVPAPERTMSPGEPMPRP |
| Ga0210406_100446271 | 3300021168 | Soil | SALQGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSPTDSMPRP |
| Ga0210406_101440343 | 3300021168 | Soil | TAGIALQGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSPTDSMPRP |
| Ga0210405_107610731 | 3300021171 | Soil | WTNGIALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESLRNP |
| Ga0210408_102554772 | 3300021178 | Soil | LEAPARPGDVDRPIRETNVPMPERTMAPAERSMPRP |
| Ga0210408_112844401 | 3300021178 | Soil | WTAGIALQGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSPSDTMPRP |
| Ga0210396_101076352 | 3300021180 | Soil | TNGIALQGYLLTDGLEAPAAPGEVDRPIRETNVPTPERTMSPGEAMPRP |
| Ga0210396_102885852 | 3300021180 | Soil | IALQGFLLTDGLESPARPGEVDLPIRETNLPLPDRMMSPTDSMPRP |
| Ga0210396_106317692 | 3300021180 | Soil | LENVWTAGIALQGFLLTDGLESPARPGEVDRPVRETNLPLPDRMMSPSDSMPRP |
| Ga0210396_114971272 | 3300021180 | Soil | LLTDGLEAPAAPGEVDRPIRETNVPTPERTMSPGEAMPRP |
| Ga0210388_100063761 | 3300021181 | Soil | ENVWTAGIALQGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSLSDSMPRP |
| Ga0210393_108907701 | 3300021401 | Soil | LLTDGLEAPSRPGEVDRPIRETNVPMPERNMSPGEAMPRP |
| Ga0210397_101541641 | 3300021403 | Soil | FLLTDGLEAPARPTEVDRPIREINVPMPDRTLSPMDTMPRP |
| Ga0210389_105829741 | 3300021404 | Soil | GVWTNGLALQGYLLTDGLEAPARPGEVDRPIRETNVPVPERSMSPGEGLPRP |
| Ga0210386_112093292 | 3300021406 | Soil | NGLALQGFLLTDGLEAPARPGEVDRPIRETNVPVPERSMSPGEGLPRP |
| Ga0210394_100292913 | 3300021420 | Soil | TNGLALQGYLLTDGLEAPSRPGEVDRPIRETNVPMPERSMSPGEGLPRP |
| Ga0210394_103622202 | 3300021420 | Soil | LEAPARPGEVDRPIRETNVPVPERSMSPGEGLPRP |
| Ga0210384_113092251 | 3300021432 | Soil | QGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSPTDSMPRP |
| Ga0210391_100974271 | 3300021433 | Soil | DGLEAPTPPGEVDRPIRETNVPAPERTMSPGEGMPRP |
| Ga0210391_112299392 | 3300021433 | Soil | YLLTDGLEAPTRPGEVDRPIRETNVPAPERTMSPGEGMPRP |
| Ga0210391_114989431 | 3300021433 | Soil | NGLALEGYLLTDGLEAPSRPGEVDRPIRETNVPMPERNMSPGDAMPRP |
| Ga0210392_107632281 | 3300021475 | Soil | TTGLALQGYLLTDGLEAPARPGEMDRAIRETNLPMPERTRSPGE |
| Ga0187846_100394571 | 3300021476 | Biofilm | NGLALLGFLLTDGLEAPARPAEVDRPIRETNVPMPERTMSPREPMPNP |
| Ga0210398_111154302 | 3300021477 | Soil | LEGVWTNGLALQGYLLTDGLEAPSRPGEVDRPIRETNVPTPERSMSPGEGLPRP |
| Ga0210398_112194632 | 3300021477 | Soil | LTDGLEAPAAPGEVDRPIRETNVPTPERTMSPGEAMPRP |
| Ga0210402_101002544 | 3300021478 | Soil | ALENVWTAGIALQGFLLTDGLESPARPGEVDRPVRETNLPLPDRMMSPSDSMPRP |
| Ga0210402_101377031 | 3300021478 | Soil | LESPARPGEVDRPVRETNLPLPDRMTSPSDSMPRP |
| Ga0210402_116659942 | 3300021478 | Soil | EGYLLTDGLEAPARPGEIDRPIRETNVPMPERTMSPVEGRPRP |
| Ga0210410_102187992 | 3300021479 | Soil | GLEAPARPGEVDRPIRETNVPMPERTMSPRESLRNP |
| Ga0210410_112854322 | 3300021479 | Soil | WTNGLALEGYLLTDGLEAPSRPGEVDRPIRETNVPMPERNMSPGEAMPRP |
| Ga0210409_109674661 | 3300021559 | Soil | ALQGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSPTDSMPRP |
| Ga0247693_10159761 | 3300024181 | Soil | LLTDGLESPARPGEVDRPIRETNLPLPARMMSPTDSMPRP |
| Ga0247680_10397151 | 3300024246 | Soil | LALQGYLLTDGLEAPARPGDVDRPIRETNVPMPERSMAPGEGMPRP |
| Ga0209238_10688302 | 3300026301 | Grasslands Soil | LESVWTNGIALQGFLLTDGLEAPARPGEMDRPIRETNVPMPERTIGPESNAPRP |
| Ga0209238_11388602 | 3300026301 | Grasslands Soil | IALQGFLLTDGLEAPARPGEMDRPIRETNVPMPERTMGPEANLSRP |
| Ga0209239_11001951 | 3300026310 | Grasslands Soil | VWTNGIALQGFLLTDGLEAPARPGEMDRPIRETNVPMPERTTGPESNAPRP |
| Ga0209801_10006541 | 3300026326 | Soil | WTNGIALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESMRNP |
| Ga0257153_10146353 | 3300026490 | Soil | LLTDGLESPARPNEVDRPIRETNLPLPDRMMSPSDSMPRP |
| Ga0209805_12106562 | 3300026542 | Soil | NGIALQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTMSPRETMRNP |
| Ga0209156_103102041 | 3300026547 | Soil | DGLEAPARPDEVDRPVRETNVPMPERTMSPGEGRPRP |
| Ga0209156_103975041 | 3300026547 | Soil | VWTNGIALQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTMSPRETMRNP |
| Ga0209648_102526901 | 3300026551 | Grasslands Soil | TNGIALQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTMSPDERVRRNP |
| Ga0209648_105385951 | 3300026551 | Grasslands Soil | TNGIALQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTMSPGETVRRNP |
| Ga0207860_10315811 | 3300026921 | Tropical Forest Soil | ESLWTTGIALEGFLLTDGLEAPARPAEVDRPVRETNVPMPERIMSPMENMPRP |
| Ga0209523_10530602 | 3300027548 | Forest Soil | LTDGLESPARPGEVDRPVRETNVPAPERTMSPREPVPQP |
| Ga0209527_10838632 | 3300027583 | Forest Soil | GLWTTGIALEGYLLTDGLEAPARPGEVDRPVRETNVPAPERTMSPGELLPRP |
| Ga0209039_100546152 | 3300027825 | Bog Forest Soil | WTNGLALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERSMSPGEGIPRP |
| Ga0209180_106595992 | 3300027846 | Vadose Zone Soil | LLTDGLEAPARPGEVDRPVRETNVPAPERTMSPREPMLQP |
| Ga0209167_107579301 | 3300027867 | Surface Soil | EGVWTNGIALQGYLLTDGLEAPAAPGEVDRPIRETNVPAPERTMSPGEVMPRP |
| Ga0209380_104098642 | 3300027889 | Soil | LEAPSRPGEVDRPVRETNVPMPERSMSPGEAMPRP |
| Ga0209068_104533582 | 3300027894 | Watersheds | LTDGLEAPARPGDVDRPIRETNVPMPERTMAPAERSMPRP |
| Ga0209624_103657931 | 3300027895 | Forest Soil | QGYLLTDGLEAPAAPGEVDRPIRETNVPTPERTMSPGEAMPRP |
| Ga0209583_102484192 | 3300027910 | Watersheds | IALEGYLLTDGLEAPARPGEVDRPIRETNIPMPERTLSPGESMPRP |
| Ga0209526_107105892 | 3300028047 | Forest Soil | LLTDGLEAPARPGDVDRPVRETNVPERLASPSQNFPRP |
| Ga0247682_10095171 | 3300028146 | Soil | QGYLLTDGLEAPARPGEVDRPIRETNVPMPERSMAPGEGMPRP |
| Ga0222749_107095411 | 3300029636 | Soil | ENVWTAGIALQGFLLTDGLESPARPGEVDRPIRETNLPLPDRMMSPTDSMPRP |
| Ga0265753_10958281 | 3300030862 | Soil | LEAPAAPGEVDRPIRETNVPTPERTMSPGEAMPRP |
| Ga0075400_112755692 | 3300030972 | Soil | EGFLLTDGLEAPARPTEVDRPIREINVPMPDRTLSPMDTMPRP |
| Ga0170824_1146277761 | 3300031231 | Forest Soil | WTNGIALQGYLLTDGLEAPARPGEVDRPIRETNVPTPERTMSPGEGMPRP |
| Ga0318516_105494282 | 3300031543 | Soil | LTDGLEAPARPAEVDRPVRETNVPMPERFMSPMENIPRP |
| Ga0318515_101520301 | 3300031572 | Soil | SVWTTGIALQGYLLTDGLEAPARPGDVDRPIRETNVPSPERMMSSSDSVPRP |
| Ga0318572_102435131 | 3300031681 | Soil | FLLTDGLEAPARPAEVDRPVRETNVPMPERIMSPMENMPRP |
| Ga0307476_108356791 | 3300031715 | Hardwood Forest Soil | WTNGIALQGYLLTDGLEAPTPPGEVDRPIRETNVPVPERTMSPGEGMPRP |
| Ga0310813_119732121 | 3300031716 | Soil | QGYLLTDGLEAPSRPGEMDRPIRETNVPMPERTMSPGEPMPRP |
| Ga0307469_114522541 | 3300031720 | Hardwood Forest Soil | GYLLTDGLEAPARPSEVDRPVRETNVPMPERTMSPRGPLREP |
| Ga0307475_108079261 | 3300031754 | Hardwood Forest Soil | GVWTNGIALQGYLLTDGLEAPARPGEVDRPVREMNVPMPERTLSPGESMPRP |
| Ga0307475_114154112 | 3300031754 | Hardwood Forest Soil | GLDSPARPGEVDRPIRETNLPLPDRMMSPPDSMPRP |
| Ga0318552_104831202 | 3300031782 | Soil | GIALEGFLLTDGLEAPARPAEVDRPVRETNVPMPERFMSPMENIPRP |
| Ga0318523_100976272 | 3300031798 | Soil | LWTTGIALEGFLLTDGLEAPARPAEVDRPVRETNVPMPERIMSPMENMPRP |
| Ga0307473_111838901 | 3300031820 | Hardwood Forest Soil | GFLLTDGLESPARPGDVDRPIRETNVPSPERTMAPTDRAMPRP |
| Ga0307478_103098242 | 3300031823 | Hardwood Forest Soil | WTNGIALEGYLLTDGLEAPARPGEVDRPVRETNVPAPERTMSPRELIPQP |
| Ga0307478_104124062 | 3300031823 | Hardwood Forest Soil | NGLALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERNMSPGEAIPRP |
| Ga0307478_105739241 | 3300031823 | Hardwood Forest Soil | TDGLEAPAAPGEVDRPIRETNVPTPERTMSPGEAMPRP |
| Ga0310909_106607182 | 3300031947 | Soil | SLWTTGIALEGFLLTDGLEAPARPAEVDRPVRETNVPMPERIMSPMENMPRP |
| Ga0307479_101069131 | 3300031962 | Hardwood Forest Soil | SVWTNGIALQGYLLTDGLEAPARPGEVDRPVRETNVPMPERTVSPRESTRNP |
| Ga0307479_112289871 | 3300031962 | Hardwood Forest Soil | ALQGYLLTDGLEAPTRPGEVDRPIRETNVPMPERTMSPRESLRNP |
| Ga0307479_113500311 | 3300031962 | Hardwood Forest Soil | GLALQGYLLTDGLEAPARPGEVDRPIRETNVPMPERSMSPGEAMPRP |
| Ga0307479_115194812 | 3300031962 | Hardwood Forest Soil | ERVWTNGIALQGYLLTDGLEAPARPGEMDRPVRETNVPVPERMMSPGESTPHP |
| Ga0318507_104446122 | 3300032025 | Soil | LEAPARPAEVDRPVRETNVPMPERFMSPMENIPRP |
| Ga0318558_101949551 | 3300032044 | Soil | ENVWTTSIALEGFLLTDGLEAPSRPSEIDRPIRETNLPMPERNPVFDPMPRP |
| Ga0318533_108197941 | 3300032059 | Soil | IALEGFLLTDGLEAPARPAEVDRPVRETNVPMPERIMSPMESMPRP |
| Ga0318510_102326292 | 3300032064 | Soil | LEGFLLTDGLEAPARPAEVDRPVRETNVPMPERIMSPMENMPRP |
| Ga0307470_105388721 | 3300032174 | Hardwood Forest Soil | LQGFLLTDGLESPARPGEVDRPVRETNLPLPDRMMSPTDSMPRP |
| Ga0307471_1000816851 | 3300032180 | Hardwood Forest Soil | LESPARPNEVDRPIRETNLPLPDRMMSPSDSMPRP |
| Ga0307471_1001623271 | 3300032180 | Hardwood Forest Soil | GYLLTDGLEAPARPGEVDRPIRETNVPMPERTMSPRESMRNP |
| Ga0307471_1001634971 | 3300032180 | Hardwood Forest Soil | DGLESPARPGDVDRPVRETNLPVPDRMMSPSDSMPRP |
| Ga0307471_1025223042 | 3300032180 | Hardwood Forest Soil | QGYLLTDGLEAPTRPGEIDRPIRETNVPLPERTMSPMEGRPRP |
| Ga0307471_1026897692 | 3300032180 | Hardwood Forest Soil | QTDGLEAPARPGEVDRPVRETNVPMPERTMSPREPVRNP |
| Ga0307471_1032349421 | 3300032180 | Hardwood Forest Soil | DGLESPARPGDVDHPVRETNLPVPDRMMSPSDSMPRP |
| Ga0335085_102801675 | 3300032770 | Soil | LQGFLLTDGLEAPAHPSDADRPIRETNLPLPDRLPPPSPSMHP |
| Ga0335085_109625271 | 3300032770 | Soil | QGFLLTDGLEAPSRPGEIDRPIRETNLPIPERNAAFDPMPRP |
| Ga0335080_122779351 | 3300032828 | Soil | ALENVWTTGIALQGFLLTDGLEAPSRPGEIDRPIRETNLPIPERNAAFDPMPRP |
| Ga0335081_112186171 | 3300032892 | Soil | GLEAPAHPSDADRPIRETNLPLPDRLPPPSASMHP |
| Ga0335069_102424872 | 3300032893 | Soil | TDGLEAPAAPGEVDRPIRETNVPAPERTMSPGEAMPRP |
| Ga0335069_113587681 | 3300032893 | Soil | FLLSDGLEAPARPGEMDRAIRETNVPMPERLRSPGE |
| ⦗Top⦘ |