NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034791

Metagenome / Metatranscriptome Family F034791

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034791
Family Type Metagenome / Metatranscriptome
Number of Sequences 173
Average Sequence Length 103 residues
Representative Sequence MEAMTPFFLMIQDLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF
Number of Associated Samples 112
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.41 %
% of genes near scaffold ends (potentially truncated) 26.01 %
% of genes from short scaffolds (< 2000 bps) 80.35 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.110 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(21.387 % of family members)
Environment Ontology (ENVO) Unclassified
(70.520 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.665 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 65.15%    β-sheet: 0.00%    Coil/Unstructured: 34.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF01642MM_CoA_mutase 20.23
PF08240ADH_N 8.67
PF07879PHB_acc_N 4.05
PF09084NMT1 2.89
PF13561adh_short_C2 2.31
PF06026Rib_5-P_isom_A 2.31
PF02954HTH_8 1.73
PF02678Pirin 1.16
PF06827zf-FPG_IleRS 1.16
PF06233Usg 1.16
PF01590GAF 1.16
PF05610DUF779 1.16
PF02515CoA_transf_3 0.58
PF00171Aldedh 0.58
PF07690MFS_1 0.58
PF13632Glyco_trans_2_3 0.58
PF12806Acyl-CoA_dh_C 0.58
PF02310B12-binding 0.58
PF10090HPTransfase 0.58
PF02803Thiolase_C 0.58
PF00005ABC_tran 0.58
PF02527GidB 0.58
PF12770CHAT 0.58
PF07992Pyr_redox_2 0.58
PF07681DoxX 0.58
PF00155Aminotran_1_2 0.58
PF00107ADH_zinc_N 0.58
PF02669KdpC 0.58
PF00196GerE 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 173 Family Scaffolds
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 20.23
COG5394Polyhydroxyalkanoate (PHA) synthesis regulator protein, binds DNA and PHASignal transduction mechanisms [T] 4.05
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 2.89
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 2.89
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 2.31
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 1.16
COG3564Uncharacterized conserved protein, DUF779 familyFunction unknown [S] 1.16
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.58
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.58
COG035716S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)Translation, ribosomal structure and biogenesis [J] 0.58
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.58
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.58
COG2156K+-transporting ATPase, KdpC subunitInorganic ion transport and metabolism [P] 0.58
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.58
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.58
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.11 %
UnclassifiedrootN/A2.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000313|WSSedB1CaDRAFT_10012332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2012Open in IMG/M
3300004080|Ga0062385_10513448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.742Open in IMG/M
3300004082|Ga0062384_100322818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.967Open in IMG/M
3300009547|Ga0116136_1070035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.945Open in IMG/M
3300009547|Ga0116136_1073005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.921Open in IMG/M
3300009548|Ga0116107_1061303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1235Open in IMG/M
3300009616|Ga0116111_1046116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1287Open in IMG/M
3300009617|Ga0116123_1158544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.582Open in IMG/M
3300009631|Ga0116115_1064364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.960Open in IMG/M
3300009639|Ga0116122_1051336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1394Open in IMG/M
3300009640|Ga0116126_1141966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.813Open in IMG/M
3300009644|Ga0116121_1038703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus1506Open in IMG/M
3300009762|Ga0116130_1064798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1149Open in IMG/M
3300010379|Ga0136449_102625968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.718Open in IMG/M
3300014151|Ga0181539_1124302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1056Open in IMG/M
3300014151|Ga0181539_1211817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.739Open in IMG/M
3300014152|Ga0181533_1274608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.620Open in IMG/M
3300014153|Ga0181527_1041736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2568Open in IMG/M
3300014155|Ga0181524_10008669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8482Open in IMG/M
3300014155|Ga0181524_10179657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1059Open in IMG/M
3300014156|Ga0181518_10374631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.693Open in IMG/M
3300014158|Ga0181521_10147998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus1354Open in IMG/M
3300014159|Ga0181530_10585486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.547Open in IMG/M
3300014160|Ga0181517_10046572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2697Open in IMG/M
3300014160|Ga0181517_10243186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.965Open in IMG/M
3300014160|Ga0181517_10268450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.906Open in IMG/M
3300014160|Ga0181517_10291542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.860Open in IMG/M
3300014160|Ga0181517_10352978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.762Open in IMG/M
3300014161|Ga0181529_10010352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8738Open in IMG/M
3300014161|Ga0181529_10057792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2677Open in IMG/M
3300014161|Ga0181529_10146694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1440Open in IMG/M
3300014161|Ga0181529_10216518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1112Open in IMG/M
3300014165|Ga0181523_10297726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.912Open in IMG/M
3300014167|Ga0181528_10471670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.688Open in IMG/M
3300014167|Ga0181528_10647655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.588Open in IMG/M
3300014167|Ga0181528_10831995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.520Open in IMG/M
3300014168|Ga0181534_10308857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.854Open in IMG/M
3300014168|Ga0181534_10840908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.545Open in IMG/M
3300014169|Ga0181531_10039501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2741Open in IMG/M
3300014199|Ga0181535_10489073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.713Open in IMG/M
3300014199|Ga0181535_10510584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.695Open in IMG/M
3300014200|Ga0181526_10164782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1421Open in IMG/M
3300014490|Ga0182010_10297523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.865Open in IMG/M
3300014491|Ga0182014_10005754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales13681Open in IMG/M
3300014491|Ga0182014_10006399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales12677Open in IMG/M
3300014491|Ga0182014_10381660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.706Open in IMG/M
3300014491|Ga0182014_10607250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.527Open in IMG/M
3300014492|Ga0182013_10080926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2278Open in IMG/M
3300014492|Ga0182013_10114213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus1785Open in IMG/M
3300014492|Ga0182013_10341647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.823Open in IMG/M
3300014493|Ga0182016_10328578All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300014494|Ga0182017_10519183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.729Open in IMG/M
3300014496|Ga0182011_10562327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.729Open in IMG/M
3300014496|Ga0182011_10623948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.684Open in IMG/M
3300014498|Ga0182019_10198415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1297Open in IMG/M
3300014502|Ga0182021_11208870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.910Open in IMG/M
3300014654|Ga0181525_10021605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3977Open in IMG/M
3300014655|Ga0181516_10080622All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300014655|Ga0181516_10525664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.608Open in IMG/M
3300014838|Ga0182030_10027353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10262Open in IMG/M
3300014839|Ga0182027_10115406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3211Open in IMG/M
3300014839|Ga0182027_10426618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1466Open in IMG/M
3300014839|Ga0182027_10683051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1090Open in IMG/M
3300016728|Ga0181500_1369712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.665Open in IMG/M
3300017925|Ga0187856_1006442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales7369Open in IMG/M
3300017925|Ga0187856_1208092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.706Open in IMG/M
3300017929|Ga0187849_1044273Not Available2137Open in IMG/M
3300017935|Ga0187848_10003435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11593Open in IMG/M
3300017935|Ga0187848_10143415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1056Open in IMG/M
3300017935|Ga0187848_10319613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.646Open in IMG/M
3300017935|Ga0187848_10359539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.602Open in IMG/M
3300017935|Ga0187848_10458025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.523Open in IMG/M
3300017940|Ga0187853_10522138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.517Open in IMG/M
3300017941|Ga0187850_10169113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1016Open in IMG/M
3300017946|Ga0187879_10333666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.841Open in IMG/M
3300017972|Ga0187781_10469551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.902Open in IMG/M
3300017988|Ga0181520_10007728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales15668Open in IMG/M
3300017988|Ga0181520_10035496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5095Open in IMG/M
3300017988|Ga0181520_10122047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2176Open in IMG/M
3300017988|Ga0181520_10290414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1229Open in IMG/M
3300017988|Ga0181520_10323541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1145Open in IMG/M
3300017988|Ga0181520_10528714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.830Open in IMG/M
3300017996|Ga0187891_1003269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11477Open in IMG/M
3300018002|Ga0187868_1023502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2926Open in IMG/M
3300018004|Ga0187865_1309011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.520Open in IMG/M
3300018013|Ga0187873_1161529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.852Open in IMG/M
3300018014|Ga0187860_1242173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.720Open in IMG/M
3300018022|Ga0187864_10355343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.641Open in IMG/M
3300018023|Ga0187889_10059256Not Available2011Open in IMG/M
3300018023|Ga0187889_10392120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.602Open in IMG/M
3300018024|Ga0187881_10043746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2221Open in IMG/M
3300018024|Ga0187881_10109916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1237Open in IMG/M
3300018024|Ga0187881_10451277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.525Open in IMG/M
3300018025|Ga0187885_10560688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.508Open in IMG/M
3300018034|Ga0187863_10215895All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300018035|Ga0187875_10735447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.518Open in IMG/M
3300018035|Ga0187875_10764992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.506Open in IMG/M
3300018040|Ga0187862_10600555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.652Open in IMG/M
3300018044|Ga0187890_10848673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.516Open in IMG/M
3300018057|Ga0187858_10386228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.872Open in IMG/M
3300018062|Ga0187784_10937784Not Available689Open in IMG/M
3300018062|Ga0187784_11082662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.636Open in IMG/M
3300018088|Ga0187771_10045539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3399Open in IMG/M
3300018088|Ga0187771_10121636Not Available2123Open in IMG/M
3300018088|Ga0187771_11284212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.621Open in IMG/M
3300018090|Ga0187770_10431016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1038Open in IMG/M
3300018090|Ga0187770_10586178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.886Open in IMG/M
3300019082|Ga0187852_1352967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.579Open in IMG/M
3300019787|Ga0182031_1461636All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300021361|Ga0213872_10144397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1043Open in IMG/M
3300023090|Ga0224558_1171593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.677Open in IMG/M
3300023091|Ga0224559_1007944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4833Open in IMG/M
3300023091|Ga0224559_1047892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1697Open in IMG/M
3300025496|Ga0208191_1055789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.850Open in IMG/M
3300025633|Ga0208480_1051658Not Available1067Open in IMG/M
3300027867|Ga0209167_10509282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.659Open in IMG/M
3300027905|Ga0209415_10575744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.842Open in IMG/M
3300028562|Ga0302151_10162503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.766Open in IMG/M
3300028745|Ga0302267_10224056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.825Open in IMG/M
3300028762|Ga0302202_10338052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.714Open in IMG/M
3300028779|Ga0302266_10194944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.772Open in IMG/M
3300028783|Ga0302279_10472516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.506Open in IMG/M
3300028813|Ga0302157_10112236All Organisms → cellular organisms → Bacteria1685Open in IMG/M
3300028867|Ga0302146_10212335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.763Open in IMG/M
3300029911|Ga0311361_10457948All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300029911|Ga0311361_11474186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.516Open in IMG/M
3300029913|Ga0311362_10667534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.901Open in IMG/M
3300029954|Ga0311331_10998169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.727Open in IMG/M
3300029955|Ga0311342_10591617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.902Open in IMG/M
3300029957|Ga0265324_10148616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.795Open in IMG/M
3300029990|Ga0311336_11372934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.620Open in IMG/M
3300030000|Ga0311337_10653225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.907Open in IMG/M
3300030519|Ga0302193_10152020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1342Open in IMG/M
3300030688|Ga0311345_10419301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1191Open in IMG/M
3300031235|Ga0265330_10057849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1690Open in IMG/M
3300031235|Ga0265330_10167989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.930Open in IMG/M
3300031235|Ga0265330_10323516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.651Open in IMG/M
3300031235|Ga0265330_10333143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.641Open in IMG/M
3300031241|Ga0265325_10148865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1108Open in IMG/M
3300031241|Ga0265325_10286675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.737Open in IMG/M
3300031242|Ga0265329_10101564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.916Open in IMG/M
3300031249|Ga0265339_10105460All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300031249|Ga0265339_10253338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.851Open in IMG/M
3300031261|Ga0302140_11187667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.511Open in IMG/M
3300031344|Ga0265316_10096750All Organisms → cellular organisms → Bacteria2248Open in IMG/M
3300031344|Ga0265316_11145115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.539Open in IMG/M
3300031524|Ga0302320_10680890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1174Open in IMG/M
3300031708|Ga0310686_118505506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3696Open in IMG/M
3300031711|Ga0265314_10372210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.780Open in IMG/M
3300031712|Ga0265342_10280311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.882Open in IMG/M
3300031759|Ga0316219_1050287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1716Open in IMG/M
3300031884|Ga0316220_1123077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.958Open in IMG/M
3300032605|Ga0316232_1164424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.923Open in IMG/M
3300032665|Ga0316221_1172252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.737Open in IMG/M
3300032665|Ga0316221_1223799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.616Open in IMG/M
3300032829|Ga0335070_10516924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1130Open in IMG/M
3300032829|Ga0335070_11340721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.654Open in IMG/M
3300033402|Ga0326728_10002457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans61665Open in IMG/M
3300033402|Ga0326728_10005544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans35191Open in IMG/M
3300033402|Ga0326728_10024242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11019Open in IMG/M
3300033402|Ga0326728_10331488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1358Open in IMG/M
3300033402|Ga0326728_10511893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.971Open in IMG/M
3300033405|Ga0326727_10456322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1136Open in IMG/M
3300033405|Ga0326727_10494413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1068Open in IMG/M
3300033405|Ga0326727_11041395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.591Open in IMG/M
3300033755|Ga0371489_0003166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans20120Open in IMG/M
3300033755|Ga0371489_0026600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4435Open in IMG/M
3300033982|Ga0371487_0198166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.962Open in IMG/M
3300033982|Ga0371487_0208350All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300033982|Ga0371487_0372858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.623Open in IMG/M
3300033983|Ga0371488_0465548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.576Open in IMG/M
3300034282|Ga0370492_0000659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans12362Open in IMG/M
3300034282|Ga0370492_0066935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1472Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog21.39%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland17.92%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog9.25%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil8.09%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere8.09%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.36%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog5.78%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen5.20%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater2.89%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.16%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.16%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.16%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.16%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.58%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000313Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 CattailEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021361Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2Host-AssociatedOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031884Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
WSSedB1CaDRAFT_1001233233300000313WetlandMQAMTPFFEMVRGLEGFEMVCFWLGAFVSFVLIGFLLDYLMGRQGFGPLINSVLALFGAFAGLYIRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF*
Ga0062385_1051344813300004080Bog Forest SoilMAAMSPFFLMINSLEGFELACFWLAVFVGFFLIGFVLDYLMGRQGFGPYVNSLLALIGTLAGLYARYNYLQGYLRYEPYLSLTLLFAVPVFMIVVLSFLRTRAF*
Ga0062384_10032281813300004082Bog Forest SoilMTAMSPFFLMINSLEGFELACFWLAVFVGFFLIGFVLDYLMGRQGFGPYINSLLALVGTLAGLYARYNYLQGYVRYEPYLSLTLLFAVPVLMIILLSFLRTRAF*
Ga0116136_107003523300009547PeatlandMAAMTPFFKLINSLEGFELVCFWLAAFVGFVLIGFLLDWLMGRQGFGPYVNSALALIGVCAGLYARYNYFMHYAGYEPYLSFALLFSAPVLLILILSFLKTRAF*
Ga0116136_107300513300009547PeatlandMAAMTPFFRMIGSLEGFEMVCFWLALFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY*
Ga0116107_106130323300009548PeatlandMERGTAEMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAIVGVFCGLYARYNYCLPFVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR*
Ga0116111_104611613300009616PeatlandMAAMKPFFMMIDSLEGFEMVCFWLAVFVGFVLIGFLLDFLMGRQGFGPYVNSVLALVGAWVGLYARYNYFLPYVRYEPYLSFTLLFAAPVSLILILSFMRTRVF*
Ga0116123_115854413300009617PeatlandMEAMTPFFLMIRDLDGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFGGLYVRYNYMTPYLRYEPYLSFGLLFAAPVLLVMMLSFARTRVF*
Ga0116115_106436423300009631PeatlandMAAMTPFFTMINSLEGFEYVCFWLGAFVGFVLIGFLLDYLMGRQGFGPYVNAVLAVVGAGIGLYVRYNYCLPYVRYEPYLSFGLLFTTPVLLVLLLSFMRTRVF*
Ga0116122_105133623300009639PeatlandMAAMKPFFMMIDSLEGFEMVCFWLAVFVGFVLIGFLLDFLMGRQGFGPYVNSVLELVGAWVGLYARYNYFLPYVRYEPYLSFTLLFAAPVSLILILSFMRTRVF*
Ga0116126_114196613300009640PeatlandGLEGFEMVCFWLGVFVGFFLSGFLLDYLLGRQGFGPYLNAALALLGVFCGLYARYNYFLPFVRYEPYLTFALLFGAPVLLIVILSFTRTRVFAR*
Ga0116121_103870323300009644PeatlandMEAMTPFFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFGGLYVRYNFMTPYLGYEPYLSLGLLFAAPVLLVLTLSFMRTRVF*
Ga0116130_106479813300009762PeatlandMAAMTPFFRMIGSLEGFEMVCFWLAVFVGFFLIGFLLDYLMGRQGFGPYINSGLALVGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY*
Ga0136449_10262596813300010379Peatlands SoilMEAMRPFFLMVQDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALMGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPV
Ga0181539_112430223300014151BogMTAMAPFFRMIVGLEGFEMVCFWLAAFVGFVLIGFLLDYLMGRQGFGPYVNSGLALVGVLCGLYARYNYFLPYGRYEPYLSFALLFAAPVALIVILSFARTRVFAG*
Ga0181539_121181723300014151BogMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAVVGVFCGLYARFNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR*
Ga0181533_127460813300014152BogMAAMAPFFRMINGLEGFEMVCFWLGAFVGFFLLGFVLDYLMGRQGFGPYVNSVLALIGALVGLYVRYNYFLPYVRYEPYLSFALLFGAPVFLILILCFLRTRAY*
Ga0181527_104173633300014153BogMTAMAPFFRLIVGLEGFEMVCFWLAAFVGFVLIGFLLDYLMGRQGFGPYVNSGLALVGVLCGLYARYNYFLPYGRYEPYLSFALLFAAPVALIVILSFARTRVFAG*
Ga0181524_1000866923300014155BogMAAMAPFFRMINGLEGFEMVCFWLGAFVGFFLLGFVLDYLMGRQGFGPYVNSVLALIGAVGGLYVRYNYFLPYVRYEPYLSFALLFGAPVFLILILSFLRTRAY*
Ga0181524_1017965723300014155BogMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAIVGVFCGLYARYNYFLPFVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR*
Ga0181518_1037463113300014156BogMEAMTPFFLMIRDLEGFEMVCFWLAAFVGFVLVGFVLDFLMGRQGFGPYVNSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLL
Ga0181521_1014799823300014158BogMEAMTPFFLMIRDLDGFEMVCFWLATFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVMMLSFMRTRVF*
Ga0181530_1058548613300014159BogRGTRHARQNPLEISPRGSTERGKAEMAAMTPFFKLINSLEGFELVCFWLAAFVGFVLIGFLLDWLMGRQGFGPYVNSALALIGVCAGLYARYNYFMHYAGYEPYLSFALLFSAPVLLILILSFLKTRAF*
Ga0181517_1004657223300014160BogMEAMTPFFMMVRDLDGFEKVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYINSILALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF*
Ga0181517_1024318623300014160BogMEAMSPLFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF*
Ga0181517_1026845013300014160BogMEAMTPFFLMVRDLDGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF*
Ga0181517_1029154213300014160BogMEAMTPLFLMVRDLEGFERVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF*
Ga0181517_1035297823300014160BogMEAMTPFFLMVRDLDGFEKVCFWLAVFVGFVLIGFVLDFLMGRQGFGPYINSVLALVGVFAGLYVRYNFMTPYLGYEPYLSFGLLFAAPVLLVLTLSFMRTRVF*
Ga0181529_1001035253300014161BogMEAMTPFFLMIRDLEGFEMVCFWLGAFVGFVLIGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMSPYLRYEPYLSFGLLFAAPVLLVVTLSFARTRVF*
Ga0181529_1005779223300014161BogMEAMTPFFMMVRSLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF*
Ga0181529_1014669413300014161BogMVAMTPFFAMVQNLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSVLALIGVFGGLYVRYNYMTPYLRYEPYLTFGLLFATPLLLVLVLSFMRTRVF*
Ga0181529_1021651823300014161BogMEAMTPFFLMIRGLEGFEMVCFWLAFFVGFVLIGFMLDYLMGRQGFGPYVNSILALIGVFGGLYVRYNYMTPYLRYEPYLSFGLLFAAPVLLVLMLSFARTRVF*
Ga0181523_1029772623300014165BogLPRQNLELGETEMAAMSPFFLMIGSLEGFEMACFWLAAFVGFVLIGFLLDFLMGGQGFGPYINSMLALVGAFLGLYLRYNYLLPYVRYEPYLSFTLLFAAPVLLIVLLSFMRTRVF*
Ga0181528_1047167013300014167BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMSPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF*
Ga0181528_1064765513300014167BogMEAMTPFFLMIQDLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF*
Ga0181528_1083199513300014167BogFTMVRSLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPSINSILALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF*
Ga0181534_1030885713300014168BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFATPVLLVLMLSFARTRVF*
Ga0181534_1084090813300014168BogMEAMTPFFLMVRDLDGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLF
Ga0181531_1003950123300014169BogMEAMTPFFLMVRDLEGFEMVCFWLGAFVGFVLVGFALDFLMGRQGFGPYINSVLALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFFAPVLLVLTLSFARTRVF*
Ga0181535_1048907313300014199BogMEAMTPFFLMIRDLEGFEMVCFWLGAFVGFVLIGFALDFLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF*
Ga0181535_1051058413300014199BogMEAMTPFFTMVRSLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF*
Ga0181526_1016478213300014200BogLPRQNLELGETEMAAMSPFFLMIGSLEGFEMACFWLAAFVGFVLIGFLLDFLMGGQGFGPYINSMLAVVGAFLGLYLRYNYLLPYVRYEPYLSFTLLFAAPVLLIVLLSFMRTRVF*
Ga0182010_1029752313300014490FenMTAMTPFFTMIRDLEGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFGGLYVRYNYMTPYLRYEPYLTFGLLFAAPVLLVLTLSLARTRVF*
Ga0182014_1000575463300014491BogMERGTAEMTAMAPFFRMIDGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR*
Ga0182014_1000639913300014491BogREAAMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFALDYLMGRQGFGPYINSVLALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSLARTRVF*
Ga0182014_1038166023300014491BogMQAMRPFFQMIQDLEGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFCGLYVRYNFMTPYLRYEPYLSFGLLFAMPVLLVLTLSFARTRVF*
Ga0182014_1060725013300014491BogMEAMTPLFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYETYLSFGLLFAMPVLLVLTLSF
Ga0182013_1008092623300014492BogMEAMTPFFLMIRDLDGFEMVAFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSVLALVGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVVLVVMLSFMRTRVF*
Ga0182013_1011421323300014492BogMEAMTPLFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF*
Ga0182013_1034164723300014492BogMQAMTPFFQMIQDLEGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFCGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVVMLSFMRSRVF*
Ga0182016_1032857813300014493BogDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF*
Ga0182017_1051918313300014494FenMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFALDYLMGRQGFGPYINSVLALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSLARTRVF*
Ga0182011_1056232723300014496FenFLMVRDLDGFEKVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAMPVLLVLTLSFARTRVF*
Ga0182011_1062394813300014496FenMERGTAEMTAMAPFFRMIDGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAIIGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR*
Ga0182019_1019841523300014498FenMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFALDYLMGRQGFGPYINSVLALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTL
Ga0182021_1120887013300014502FenMAAMTPFFTMIRSLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFGGLYVRYNYMTPYLRYEPYLTFGLLFAAPLLLVLLLSFMRSRVF*
Ga0181525_1002160533300014654BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF*
Ga0181516_1008062223300014655BogMEAMTPFFLMIQDLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVVGLSFARTRVF*
Ga0181516_1052566413300014655BogREAPLRRRFPREAAMEAMTPFFLMIRDLEGFEMVCFWLGAFVSLVLVGFALDYLMGHQGFGPFINALLALAGVFGGLYVRYNFMTPYLRYEPYLSFSLLFAAPVLLVLGLSFARTRVF*
Ga0182030_10027353103300014838BogMQAMRPFFQMIQDLEGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFCGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVVMLSFMRSRVF*
Ga0182027_1011540633300014839FenMTAMAPFFRMIDGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR*
Ga0182027_1042661823300014839FenVREAAMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFALDYLMGRQGFGPYINSVLALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSLARTRVF*
Ga0182027_1068305123300014839FenMEAMTPFFLMVRDLDGFEKVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAMPVLLVLTLSFARTRVF*
Ga0181500_136971213300016728PeatlandMEAMTPLFLMIRDLDGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0187856_100644263300017925PeatlandMAAMTPFFRMIGSLEGFEMVCFWLALFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY
Ga0187856_120809223300017925PeatlandMAAMTPFFKLINSLEGFELVCFWLAAFVGFVLIGFLLDWLMGRQGFGPYVNSALALIGVCAGLYARYNYFMHYAGYEPYLSFALLFSAPVLLILILSFLKTRAF
Ga0187849_104427323300017929PeatlandMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAIVGVFCGLYARYNYCLPFVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR
Ga0187848_1000343593300017935PeatlandMAAMTPFFTMINSLEGFEYVCFWLGAFVGFVLIGFLLDYLMGRQGFGPYVNAVLAVVGAGIGLYVRYNYCLPYVRYEPYLSFGLLFTTPVLLVLLLSFMRTRVF
Ga0187848_1014341523300017935PeatlandMTAMAPFFRMIVGLEGFEMVCFWLAAFVGFVLIGFLLDYLMGRQGFGPYVNSGLALVGVLCGLYARYNYFLPYGRYEPYLSFALLFAAPVALIVILSFARTRVFAG
Ga0187848_1031961313300017935PeatlandMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFARTRVFSR
Ga0187848_1035953913300017935PeatlandMEAMTPFFLMIRDLDGFEMVCFWLATFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVMMLSFMRTRVF
Ga0187848_1045802513300017935PeatlandMTAMTPFFQMIRGLEGFEMVCFWLGVFVGFFLSGFLLDYLLGRQGFGPYLNAALALLGVFCGLYARYNYFLPFVRYEPYLTFALLFGAPVLLIVILSFTRTRVFAR
Ga0187853_1052213813300017940PeatlandMEAMTPFFLMVRDLDGFEKVCFWLAVFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFGGLYVRYNFMTPYLGYEPYLSLGLLFAAPVLLVLTLSFMRTRVF
Ga0187850_1016911333300017941PeatlandMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR
Ga0187879_1033366623300017946PeatlandMEAMTPLFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0187781_1046955123300017972Tropical PeatlandMAAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYIMGRQGFGPYVNSVLALIGAGVGLYVRYNFFIPYVRYEPYLSIGLLFAAPVALILLLSFMRTRVF
Ga0181520_10007728143300017988BogMEAMTPFFLMIRDLEGFEMVCFWLGAFVGFVLIGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMSPYLRYEPYLSFGLLFAAPVLLVVTLSFARTRVF
Ga0181520_1003549643300017988BogMEAMTPFFMMVRDLDGFEKVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYINSILALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0181520_1012204723300017988BogMEAMTPFFTMVRSLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0181520_1029041423300017988BogMEAMTPFFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFGGLYVRYNFMTPYLGYEPYLSLGLLFAAPVLLVLTLSFMRTRVF
Ga0181520_1032354123300017988BogMEAMTPFFLMIQDLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVVGLSFARTRVF
Ga0181520_1052871423300017988BogMEAMTPLFLMVRDLEGFERVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0187891_1003269113300017996PeatlandGFEMVCFWLALFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY
Ga0187868_102350243300018002PeatlandMAAMKPFFMMIDSLEGFEMVCFWLAVFVGFVLIGFLLDFLMGRQGFGPYVNSVLALVGAWVGLYARYNYFLPYVRYEPYLSFTLLFAAPVSLILILSFMRTRVF
Ga0187865_130901113300018004PeatlandLMIRDLEGFEMVCFWLGAFVGFVLIGFALDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0187873_116152923300018013PeatlandMAAMTPFFRVIGSLEGFEMVCFWLALFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY
Ga0187860_124217323300018014PeatlandMEAMTPFFLMIRDLEGFEMVCFWLAAFVGFVLVGFVLDFLMGRQGFGPYVNSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLLAAPVLLVMVLSFMRTRVF
Ga0187864_1035534313300018022PeatlandMVAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLALVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVALILTLSFMRTRVF
Ga0187889_1005925633300018023PeatlandMTAMAPFFRMIDGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR
Ga0187889_1039212013300018023PeatlandAAPQRPPTIPPRASAKRGSAEMTAMAPFFRMIVGLEGFEMVCFWLAAFVGFVLIGFLLDYLMGRQGFGPYVNSGLALVGVLCGLYARYNYFLPYGRYEPYLSFALLFAAPVALIVILSFARTRVFAG
Ga0187881_1004374623300018024PeatlandMAAMTPFFRMIGSLEGFEMVCFWLAVFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY
Ga0187881_1010991623300018024PeatlandMEAMTPFFLMIRDLDGFEMVCFWLAAFVGFVLVGFVLDFLMGRQGFGPYVNSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVMMLSFARTRVF
Ga0187881_1045127723300018024PeatlandMTAMTPFFQMIRGLEGFEMVCFWLGVFVGFFLSGFLLDYLLGRQGFGPYLNAALALLGVFCGLYARYNYFLPFVRYEPYLTFAL
Ga0187885_1056068813300018025PeatlandMVCFWLALFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY
Ga0187863_1021589523300018034PeatlandMEAMTPFFLMIQDLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0187875_1073544723300018035PeatlandMEAMTPFFLMIRDLEGFEMVCFWLAAFVGFVLVGFVLDFLMGRQGFGPYVNSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVVMLSFMRSRVF
Ga0187875_1076499213300018035PeatlandMAAMTPFFRMIGSLEGFEMVCFWLAAFVGFVLIGFLLDYLMGRQGFGPYVNSLLALIGAGAGLYARYIYFLPYVRYEPYLSITLLFATPVALILILSFLRTRVF
Ga0187862_1060055513300018040PeatlandMAAMTPFFRMIGSLEGFEMVCFWLALFVGFFLIGFLLDYLMGRQGFGPYINSGLALVGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY
Ga0187890_1084867313300018044PeatlandRRRRRPREAAMEAMTPLFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0187858_1038622823300018057PeatlandMEAMTPFFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFGGLYVRYNFMTPYLGYEPYLSLGLLFAAPVLLVMMLSFMRTRVF
Ga0187784_1093778413300018062Tropical PeatlandMAAMAPFFATIQALDGFEFACFCLASFVGFMLAGFLVDYLMGRQAFGPYVNAGLTLIGFCAGLYARYNFLGPYVRYEPYLTCGLLFAAPALL
Ga0187784_1108266223300018062Tropical PeatlandMAAMKPFFMMIESLEGFETVCFWLAVFVGFVLIGFVLDFLMGRQGFGPYVNSALALVGAWVGLYARYNYFLPYVRYEPYLSFTLLFAAPVTLILILSFMRTRVF
Ga0187771_1004553943300018088Tropical PeatlandMAAMTPFFRMIDGLDGFEMVCFWLAVFVGFFLIGFVLDYLMGRQGFGPYINSVLALVGALVGLYLRYNYFLPYVRYEPYLSFVLMFGAPVSLILLLSFMRTRVF
Ga0187771_1012163623300018088Tropical PeatlandMAAMAPFFATIQALDGFEFACFCLASFVGFMLAGFLVDYLMGRQAFGPYVNAGLTLIGFCAGLYARYNFLGPYVRYEPYLTCGVLFAAPALLIVTLSFLRTRLA
Ga0187771_1128421213300018088Tropical PeatlandPRRFPREAAMEAMTPFFLMIRDLDGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFVGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVVTLSFMRTRVF
Ga0187770_1043101623300018090Tropical PeatlandMAAMTPFFRMINGLDGFETVCFWLAVFVGFFLIGFVLDYLMGRQGFGPYINSVLALVGALVGLYLRYNYFLHFVRYEPYLSFVLMFGAPVSLILLLSFMRTRVF
Ga0187770_1058617823300018090Tropical PeatlandMEAMTPFFLMIRDLDGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFVGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVVTLSFMRTRVF
Ga0187852_135296713300019082PeatlandEMAAMTPFFKLINSLEGFELVCFWLAAFVGFVLIGFLLDWLMGRQGFGPYVNSALALIGVCAGLYARYNYFMHYAGYEPYLSFALLFSAPVLLILILSFLKTRAF
Ga0182031_146163623300019787BogMEAMTPFFLMIRDLDGFEMVAFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSVLALVGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVVLVVMLSFMRTRVF
Ga0213872_1014439713300021361RhizosphereELTCFWLTAFVVFLLIGFVLDYLMGRQGFGPYANAALALIGAFAGLYARYNYFAAYAGYEPYLTLTLLLAAPVLLMVVLSFLRTRTF
Ga0224558_117159313300023090SoilGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR
Ga0224559_100794463300023091SoilMEAMTPFFLMVRDLDGFEKVCFWLAAFVGFVLVGFVLDYLMGRQGFGPYVNSILALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0224559_104789223300023091SoilMTAMTPFFTMIRDLEGFEMVCFWLGVFVGFVLIGFVLDYLMGRQGFGPYVNSILALIGVFGGLYVRYNYMTPYLRYEPYLTFGLLFAAPLLLVLLLSFMRSRVF
Ga0208191_105578923300025496PeatlandMAAMKPFFMMIDSLEGFEMVCFWLALFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGAWVGLYLRYNYFLPYLRYEPYLSFTLLFGAPVSLILILSFLRTRVY
Ga0208480_105165813300025633Arctic Peat SoilMQAMTPFFLMIRDLEGFEMVAFWLAAFVGLVLIGFFLDFLMGRQGFGPYINSILAAIGVFAALYLRYNFLMPYLRYEPYLSLGLLFGVPVLLVIGLSLARTRIF
Ga0209167_1050928213300027867Surface SoilMQAMKPFFLMISDLEGFEMVCFWLAAFVSLVLVGFILDFLMGRQGFGPFMNSILAAIGVFAALYVRYNFLSGYLIYDPYLTIGVLFAFPVILVVVMSMARSRIF
Ga0209415_1057574413300027905Peatlands SoilMEAMTPFFLMVQDLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYVNSILALLGVFGGLYLRYNYMSPYLRYEPYLSFGLLFAAPVLLVVVLSVARTRVF
Ga0302151_1016250313300028562BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGVVMTGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVVLVVMLSFMRTRVF
Ga0302267_1022405623300028745BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGVVMTGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVVLVLTLSFARMRVF
Ga0302202_1033805223300028762BogMAAMSPFLKQFEGLEGFELVCVWLAVFVGFVMAGFLLDYLMGRQGFGPLVNSLLAVVGTFVGLYARYNYFLGYIRFEPYLSFTLMFAAPVILILMLSFLRTRVF
Ga0302266_1019494413300028779BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGVVMTGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLF
Ga0302279_1047251613300028783BogQIAPRPLQGIAEMAAMSPFLKQFEGLEGFELVCVWLAVFVGFVMAGFLLDYLMGRQGFGPLVNSLLAVVGTFVGLYARYNYFLGYIRFEPYLSFTLMFAAPVILILMLSFLRTRVF
Ga0302157_1011223613300028813BogMVCFWLAAFVGVVMTGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVVLVLTLSFARMRVF
Ga0302146_1021233523300028867BogFEGLEGFELVCVWLAVFVGFVMAGFLLDYLMGRQGFGPLVNSLLAVVGTFVGLYARYNYFLGYIRFEPYLSFTLMFAAPVILILMLSFLRTRVF
Ga0311361_1045794813300029911BogEAMTPFFLMVRDLEGFEMVCFWLAAFVGVVMTGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVVLVLTLSFARMRVF
Ga0311361_1147418613300029911BogCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0311362_1066753423300029913BogAGRIGFGSQETAHPQIAPRPLQGIAEMAAMSPFLKQFEGLEGFELVCVWLAVFVGFVMAGFLLDYLMGRQGFGPLVNSLLAVVGTFVGLYARYNYFLGYIRFEPYLSFTLMFAAPVILILMLSFLRTRVF
Ga0311331_1099816923300029954BogMAAMSPFLKQFEGLEGFELVCVWLAVFVGFVMAGFLLDYLMGRQGFGPLVNSLLAVVGTFVGLYARYNYFLGYIRFEPYLSFTLMFAAPVILILMLSF
Ga0311342_1059161713300029955BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGVVMTGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0265324_1014861633300029957RhizosphereMQAMTPFFEMVRDLEGFEMVCFWLGAFVGFVLIGFLLDYLMGRQGFGPYINAVLALIGAFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF
Ga0311336_1137293423300029990FenAMTPLFLTIRDLDGFERVCFWLAFFVGFVLIGFLLDFLMGRQGFGPYINSLLALAGVFGGLYVRYNFMTPFLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0311337_1065322523300030000FenMTAMTPFFTMIHGLEGFEKVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFGGLYVRYNYMTPYLRYEPYLTFGLLFAAPLLLVLLLSFMRSRVF
Ga0302193_1015202023300030519BogMEAMTPFFLMVRDLEGFEMVCFWLAAFVGVVMTGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVVL
Ga0311345_1041930123300030688BogMEAMTPLFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGTYIISILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0265330_1005784923300031235RhizosphereMEAMTPFFLMVRDLEGFEMVCFWLGSFVGFVLIGFALDYLMGRQGFGPYVNSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFALPVVLVLTLSFARTRVF
Ga0265330_1016798923300031235RhizosphereMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFLLDYLMGRQGFGPYINSFLALIGTFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF
Ga0265330_1032351613300031235RhizosphereMEAMTPFFLMIQGLEGFEKVCFWLGAFVGIVLIGFLLDYLMGRQGFGPYINSVLALVGLFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0265330_1033314323300031235RhizosphereQDLEGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALAGAFGGLYVRYNFMTSYLRYEPYLSFGLLFAAPVLLVLMLSFMRTRVF
Ga0265325_1014886523300031241RhizosphereMEAMTPFFLMVRDLEGFEMVCFWLGSFVGFVLIGFALDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFALPVVLVLTLSFARTRVF
Ga0265325_1028667523300031241RhizosphereMEAMTPFFLMIHSLEGFEKVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSVLALVGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLMLSFMRTRVF
Ga0265329_1010156423300031242RhizosphereMEAMTPFFLMVRDLEGFEMVCFWLGSFVGFVLIGFVLDYLMGRQGFGPYVNSILALVGVFVGLYVRFNFLTPYLRYEPYLSFGVLFTAPLLLVLLLSFMRSRVF
Ga0265339_1010546023300031249RhizosphereMIRDLEGFEKVCFWLGAFVGIVLVGFVLDYLMGRQGFGPYINSLLALAGVFGGLYVRYNFMTPFLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0265339_1025333813300031249RhizosphereGARRRRRAREAAMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFLLDYLMGRQGFGPYINSFLALIGTFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF
Ga0302140_1118766723300031261BogRDLDGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALAGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLLLSFARTRVF
Ga0265316_1009675023300031344RhizosphereMEAMTPFFLTIRDLDGFERVCFWLAFFVGFVLIGFLLDFLMGRQGFGPYINSLLALAGVFGGLYVRYNFMTPFLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0265316_1114511513300031344RhizosphereMQAMTPFFLMIRDLDGFEKVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSVLALAGVFGGLYVRFNFMTPYLRYEPYLSFVLLFAAPLLLVVALSYMRSRVF
Ga0302320_1068089013300031524BogAMSPFLKQFEGLEGFELVCVWLAVFVGFVMAGFLLDYLMGRQGFGPLVNSLLAVVGTFVGLYARYNYFLGYIRFEPYLSFTLMFAAPVILILMLSFLRTRVF
Ga0310686_11850550623300031708SoilMQAMQPFFLMIRDLEGFEMVCFWLAAFVSLVLIGFILDFLMGRQGFGPFGNSLLAAVGVFAALYLRFNFLMSYLRYDPYLSMALVFGLPVVLVMGLSFARTRIF
Ga0265314_1037221023300031711RhizosphereMQAMTPFFLMINGLDGFEKVCFWLAAFVGFVLSGFILDFLMGRQGFGPYINSVLALLGVFGGLYVRYNYMTPYLRYEPYVSFALLFAAPVLLVVVLSFLRTRVF
Ga0265342_1028031113300031712RhizosphereMQAMTPFFLMINGLDGFEKVCFWLAAFVGFVLSGFILDFLMGRQGFGPYINSVLALLGVFGGLYVRYNYMTPYLRYEPYVSFTLLFAAPVLLVVVLSFLRTRVF
Ga0316219_105028713300031759FreshwaterMEAMTPFFLMVRDLEGFEMVCFWLGSFVGFVLIGFVLDYLMGRQGFGPYVNSILALLGVFAGLYVRYNFMTPYLRYEPYLSFGLLFALPVLLVLTLSFARTRVF
Ga0316220_112307723300031884FreshwaterMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFLLDYLMGRQGFGPYINSFLALIGAFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF
Ga0316232_116442423300032605FreshwaterMEAMTPFFLMVRDLEGFEMVCFWLGSFVGFVLIGFVLDYLMVRQGFGPYVNSILALLGVFAGLYVRYNFMTPYLRYEPYLSFGLLFALPVLLVLTLSFARTRVF
Ga0316221_117225213300032665FreshwaterSPEGARRRRRAREAAMQAMTPFFQMVRDLEGFEMVCFWLGAFVGFVLIGFLLDYLMGRQGFGPYINSFLALIGAFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFARTRVF
Ga0316221_122379913300032665FreshwaterMEAMTPFFLMVRDLEGFEMVCFWLGSFVGFVLIGFALDYLMGRQGFGPYVNSILALLGVFAGLYVRYNFMTPYLRYEPYLSFGLLFALPV
Ga0335070_1051692423300032829SoilMEAMKPFFLMVRDLEGFEMVCFWLAVFVGFLLIGFALDYLMGRQGFGPYVNAVLALAGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAVPVLLVMALSYMRTRVF
Ga0335070_1134072113300032829SoilMEAMTPFFLMIRDLDGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYINSILALVGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVALVITLSFMRTRVF
Ga0326728_10002457233300033402Peat SoilMTAMAPFFRIISGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLALAGVLCGLFARYNFFLPYVRYEPYLSFALLFAAPVFLIVILSVVRTRVFLR
Ga0326728_10005544323300033402Peat SoilMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAIVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR
Ga0326728_1002424283300033402Peat SoilMEAMTPFFSMIRDLDGFEMVCFWLAVFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFGGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0326728_1033148823300033402Peat SoilMEAMTPFFLMVRDLDGFEKVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSILALIGVFAGLYVRYNFMTPYLRYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0326728_1051189323300033402Peat SoilMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSVLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVALIVILSFTRTRVFSR
Ga0326727_1045632223300033405Peat SoilMEAMTPFFTMIRDLDGFEMVCFWLAVFVGFVLIGFVLDFLMGRQGFGPYVNSILTLIGVFGGLYVRYNFMTPYLSYEPYLSFGLLFAAPVLLVLTLSFMRTRVF
Ga0326727_1049441323300033405Peat SoilMAAMTPFFKLISALEGFEMVCFWLAAFVGFVLIGFLLDYLMGRQGFGPYVNSGLAAIGVFAGLYARYNYFLPYVRYEPYLSIGLLFAAPIFLILILSYLRTRVF
Ga0326727_1104139523300033405Peat SoilAAMEAMTPFFLMIRDLDGFEMVCFWLAAFVGFVLIGFVLDFLMGRQGFGPYVNSILALIGVFGGLYVRYNFMTPYLGYEPYLSLGLLFAAPVLLVLTLSFMRTRVF
Ga0371489_0003166_3803_40963300033755Peat SoilMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSGLAIVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVVLIVILSFTRTRVFSR
Ga0371489_0026600_445_8373300033755Peat SoilMAARGAATSAAIPPRTNRERGTAEMTAMAPFFRMINGLEGFEMVCFWLAAFVGFFLIGFLLDYLMGRQGFGPYVNSVLAVVGVFCGLYARYNYFLPYVRYEPYLSFALLFAAPVALIVILSFTRTRVFSR
Ga0371487_0198166_1_2763300033982Peat SoilMTAMAPFFRMIVGLEGFEMVCFWLAAFVGFVLIGFLLDYLMGRQGFGPYVNSGLALVGVLCGLYARYNYFLPYGRYEPYLSFALLFAAPVAL
Ga0371487_0208350_12_2993300033982Peat SoilMVSNLEGFEMVCFWLAVFVGFVLIGFVLDYLMGRQGFGPYVNSILALLGVFGGLYVRYNYMTPYLRYEPYLSFGLLFAAPVLLVVLLSFARTRVF
Ga0371487_0372858_104_4693300033982Peat SoilMSAWAAPRGRRPPCEAAMVAMTPFFAMVQNLEGFEMVCFWLAAFVGFVLIGFVLDYLMGRQGFGPYINSVLALIGVFGGLYVRYNYMTPYLRYEPYLTFGLLFATPLLLVLVLSFMRTRV
Ga0371488_0465548_274_5613300033983Peat SoilMIRDLDGFEMVCFWLAVFVGFVLIGFVLDSLMGRQGFGPYVNSILALVGVFGGLYVRFNFLTPYLRYEPYLSFGVLFAAPLLLILLLSFARTRVF
Ga0370492_0000659_2909_32233300034282Untreated Peat SoilMAAMRPFFQMIQDLEGFEMVCFWMAAFVGFVLVGFLLDYLMGRQGFGPYINSILALVGVFGGLYLRYNFLTPYLRYEPYLTFGVLFATPVLLVVTLSFMRTRVF
Ga0370492_0066935_862_12393300034282Untreated Peat SoilMAEYAVGSEAPWRRRRSLEAAMQAMSPFFLMINSLEGFEMVCFWLGAFVGFVLVGFVLDFLMGRQGFGPYINSILALIGVFAGLYVRYNFMSPYFRYEPYLSFGLLFAAPVLLVLGLSFARTRVF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.