Basic Information | |
---|---|
Family ID | F034776 |
Family Type | Metagenome |
Number of Sequences | 173 |
Average Sequence Length | 50 residues |
Representative Sequence | MASFSNPSKTYAIDKLSKCATTVLLVCCYLYRKRSNTINVNAEAKEQG |
Number of Associated Samples | 66 |
Number of Associated Scaffolds | 173 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.60 % |
% of genes near scaffold ends (potentially truncated) | 87.28 % |
% of genes from short scaffolds (< 2000 bps) | 95.95 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (65.896 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (98.266 % of family members) |
Environment Ontology (ENVO) | Unclassified (98.266 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (98.266 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.95% β-sheet: 0.00% Coil/Unstructured: 46.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 173 Family Scaffolds |
---|---|---|
PF14223 | Retrotran_gag_2 | 4.05 |
PF14291 | DUF4371 | 0.58 |
PF01764 | Lipase_3 | 0.58 |
PF00078 | RVT_1 | 0.58 |
PF13966 | zf-RVT | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 65.90 % |
All Organisms | root | All Organisms | 34.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005334|Ga0068869_101505066 | All Organisms → cellular organisms → Eukaryota | 598 | Open in IMG/M |
3300013297|Ga0157378_12164950 | All Organisms → cellular organisms → Eukaryota | 607 | Open in IMG/M |
3300013297|Ga0157378_13133456 | All Organisms → cellular organisms → Eukaryota | 513 | Open in IMG/M |
3300015268|Ga0182154_1053863 | All Organisms → cellular organisms → Eukaryota | 551 | Open in IMG/M |
3300015268|Ga0182154_1071327 | All Organisms → cellular organisms → Eukaryota | 507 | Open in IMG/M |
3300015274|Ga0182188_1024579 | Not Available | 641 | Open in IMG/M |
3300015274|Ga0182188_1028893 | Not Available | 615 | Open in IMG/M |
3300015275|Ga0182172_1029994 | Not Available | 658 | Open in IMG/M |
3300015276|Ga0182170_1011137 | Not Available | 860 | Open in IMG/M |
3300015276|Ga0182170_1016019 | All Organisms → cellular organisms → Eukaryota | 780 | Open in IMG/M |
3300015277|Ga0182128_1051038 | Not Available | 573 | Open in IMG/M |
3300015277|Ga0182128_1056009 | Not Available | 558 | Open in IMG/M |
3300015279|Ga0182174_1045713 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 607 | Open in IMG/M |
3300015279|Ga0182174_1060926 | All Organisms → cellular organisms → Eukaryota | 558 | Open in IMG/M |
3300015279|Ga0182174_1070401 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
3300015279|Ga0182174_1071554 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
3300015281|Ga0182160_1031945 | All Organisms → cellular organisms → Eukaryota | 662 | Open in IMG/M |
3300015281|Ga0182160_1080845 | Not Available | 508 | Open in IMG/M |
3300015282|Ga0182124_1010161 | Not Available | 895 | Open in IMG/M |
3300015283|Ga0182156_1032313 | Not Available | 673 | Open in IMG/M |
3300015285|Ga0182186_1032443 | Not Available | 662 | Open in IMG/M |
3300015285|Ga0182186_1071150 | All Organisms → cellular organisms → Eukaryota | 527 | Open in IMG/M |
3300015285|Ga0182186_1080746 | All Organisms → cellular organisms → Eukaryota | 507 | Open in IMG/M |
3300015286|Ga0182176_1008142 | Not Available | 1082 | Open in IMG/M |
3300015286|Ga0182176_1018164 | Not Available | 818 | Open in IMG/M |
3300015288|Ga0182173_1085179 | Not Available | 504 | Open in IMG/M |
3300015291|Ga0182125_1085526 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
3300015292|Ga0182141_1044891 | Not Available | 626 | Open in IMG/M |
3300015294|Ga0182126_1076580 | Not Available | 539 | Open in IMG/M |
3300015295|Ga0182175_1033729 | Not Available | 690 | Open in IMG/M |
3300015295|Ga0182175_1068355 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
3300015296|Ga0182157_1029026 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 730 | Open in IMG/M |
3300015296|Ga0182157_1036832 | Not Available | 683 | Open in IMG/M |
3300015296|Ga0182157_1090461 | Not Available | 524 | Open in IMG/M |
3300015298|Ga0182106_1037368 | Not Available | 681 | Open in IMG/M |
3300015298|Ga0182106_1038403 | All Organisms → cellular organisms → Eukaryota | 676 | Open in IMG/M |
3300015298|Ga0182106_1044981 | Not Available | 646 | Open in IMG/M |
3300015299|Ga0182107_1067814 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 575 | Open in IMG/M |
3300015299|Ga0182107_1074809 | All Organisms → cellular organisms → Eukaryota | 558 | Open in IMG/M |
3300015299|Ga0182107_1087656 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
3300015300|Ga0182108_1048804 | All Organisms → cellular organisms → Eukaryota | 639 | Open in IMG/M |
3300015302|Ga0182143_1081116 | All Organisms → cellular organisms → Eukaryota | 544 | Open in IMG/M |
3300015303|Ga0182123_1015560 | Not Available | 843 | Open in IMG/M |
3300015303|Ga0182123_1028431 | Not Available | 717 | Open in IMG/M |
3300015303|Ga0182123_1060567 | Not Available | 581 | Open in IMG/M |
3300015304|Ga0182112_1090157 | Not Available | 529 | Open in IMG/M |
3300015305|Ga0182158_1067435 | Not Available | 575 | Open in IMG/M |
3300015305|Ga0182158_1101635 | Not Available | 507 | Open in IMG/M |
3300015307|Ga0182144_1057082 | Not Available | 612 | Open in IMG/M |
3300015307|Ga0182144_1061733 | Not Available | 598 | Open in IMG/M |
3300015308|Ga0182142_1053313 | Not Available | 637 | Open in IMG/M |
3300015308|Ga0182142_1072704 | Not Available | 581 | Open in IMG/M |
3300015314|Ga0182140_1013902 | Not Available | 933 | Open in IMG/M |
3300015314|Ga0182140_1116779 | All Organisms → cellular organisms → Eukaryota | 501 | Open in IMG/M |
3300015321|Ga0182127_1040966 | Not Available | 710 | Open in IMG/M |
3300015321|Ga0182127_1097800 | Not Available | 544 | Open in IMG/M |
3300015321|Ga0182127_1123819 | Not Available | 503 | Open in IMG/M |
3300015322|Ga0182110_1054119 | Not Available | 652 | Open in IMG/M |
3300015322|Ga0182110_1060223 | All Organisms → cellular organisms → Eukaryota | 631 | Open in IMG/M |
3300015322|Ga0182110_1060954 | Not Available | 629 | Open in IMG/M |
3300015323|Ga0182129_1041813 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 683 | Open in IMG/M |
3300015323|Ga0182129_1066815 | All Organisms → cellular organisms → Eukaryota | 595 | Open in IMG/M |
3300015323|Ga0182129_1099180 | Not Available | 528 | Open in IMG/M |
3300015323|Ga0182129_1102899 | All Organisms → cellular organisms → Eukaryota | 522 | Open in IMG/M |
3300015341|Ga0182187_1043215 | Not Available | 858 | Open in IMG/M |
3300015341|Ga0182187_1060149 | Not Available | 769 | Open in IMG/M |
3300015341|Ga0182187_1175532 | Not Available | 528 | Open in IMG/M |
3300015341|Ga0182187_1176551 | All Organisms → cellular organisms → Eukaryota | 527 | Open in IMG/M |
3300015341|Ga0182187_1195044 | Not Available | 507 | Open in IMG/M |
3300015342|Ga0182109_1031246 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1019 | Open in IMG/M |
3300015342|Ga0182109_1088349 | Not Available | 711 | Open in IMG/M |
3300015342|Ga0182109_1095323 | Not Available | 692 | Open in IMG/M |
3300015342|Ga0182109_1133005 | Not Available | 613 | Open in IMG/M |
3300015342|Ga0182109_1210089 | All Organisms → cellular organisms → Eukaryota | 514 | Open in IMG/M |
3300015343|Ga0182155_1034010 | Not Available | 974 | Open in IMG/M |
3300015343|Ga0182155_1111162 | Not Available | 652 | Open in IMG/M |
3300015343|Ga0182155_1115104 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 644 | Open in IMG/M |
3300015343|Ga0182155_1182698 | Not Available | 544 | Open in IMG/M |
3300015343|Ga0182155_1199196 | Not Available | 526 | Open in IMG/M |
3300015345|Ga0182111_1214461 | Not Available | 530 | Open in IMG/M |
3300015346|Ga0182139_1086740 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 747 | Open in IMG/M |
3300015346|Ga0182139_1189952 | Not Available | 556 | Open in IMG/M |
3300015346|Ga0182139_1193126 | All Organisms → cellular organisms → Eukaryota | 552 | Open in IMG/M |
3300015346|Ga0182139_1213076 | Not Available | 531 | Open in IMG/M |
3300015347|Ga0182177_1067103 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 823 | Open in IMG/M |
3300015347|Ga0182177_1164616 | Not Available | 590 | Open in IMG/M |
3300015347|Ga0182177_1201736 | Not Available | 546 | Open in IMG/M |
3300015347|Ga0182177_1245520 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 505 | Open in IMG/M |
3300015351|Ga0182161_1061279 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 891 | Open in IMG/M |
3300015351|Ga0182161_1101575 | Not Available | 736 | Open in IMG/M |
3300015351|Ga0182161_1116215 | Not Available | 699 | Open in IMG/M |
3300015351|Ga0182161_1137240 | Not Available | 656 | Open in IMG/M |
3300015351|Ga0182161_1217206 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 547 | Open in IMG/M |
3300015351|Ga0182161_1231125 | Not Available | 533 | Open in IMG/M |
3300015355|Ga0182159_1012755 | Not Available | 1787 | Open in IMG/M |
3300015355|Ga0182159_1096870 | Not Available | 870 | Open in IMG/M |
3300015355|Ga0182159_1151753 | Not Available | 723 | Open in IMG/M |
3300015355|Ga0182159_1199243 | Not Available | 644 | Open in IMG/M |
3300015355|Ga0182159_1229863 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 605 | Open in IMG/M |
3300015355|Ga0182159_1231089 | Not Available | 604 | Open in IMG/M |
3300015355|Ga0182159_1245470 | Not Available | 588 | Open in IMG/M |
3300015355|Ga0182159_1259466 | Not Available | 574 | Open in IMG/M |
3300015355|Ga0182159_1312410 | Not Available | 529 | Open in IMG/M |
3300015361|Ga0182145_1003158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 1736 | Open in IMG/M |
3300015361|Ga0182145_1093095 | Not Available | 644 | Open in IMG/M |
3300015361|Ga0182145_1137485 | Not Available | 565 | Open in IMG/M |
3300015361|Ga0182145_1168021 | Not Available | 528 | Open in IMG/M |
3300017404|Ga0182203_1020155 | Not Available | 964 | Open in IMG/M |
3300017404|Ga0182203_1059249 | Not Available | 699 | Open in IMG/M |
3300017404|Ga0182203_1074974 | Not Available | 649 | Open in IMG/M |
3300017404|Ga0182203_1098696 | Not Available | 594 | Open in IMG/M |
3300017404|Ga0182203_1164017 | All Organisms → cellular organisms → Eukaryota | 502 | Open in IMG/M |
3300017407|Ga0182220_1018450 | Not Available | 815 | Open in IMG/M |
3300017407|Ga0182220_1043199 | Not Available | 651 | Open in IMG/M |
3300017407|Ga0182220_1083109 | Not Available | 543 | Open in IMG/M |
3300017409|Ga0182204_1080643 | Not Available | 569 | Open in IMG/M |
3300017410|Ga0182207_1088794 | All Organisms → cellular organisms → Eukaryota | 635 | Open in IMG/M |
3300017411|Ga0182208_1110357 | Not Available | 529 | Open in IMG/M |
3300017413|Ga0182222_1108080 | Not Available | 502 | Open in IMG/M |
3300017415|Ga0182202_1022649 | Not Available | 880 | Open in IMG/M |
3300017415|Ga0182202_1100688 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
3300017417|Ga0182230_1041138 | Not Available | 809 | Open in IMG/M |
3300017417|Ga0182230_1047913 | Not Available | 750 | Open in IMG/M |
3300017417|Ga0182230_1054726 | All Organisms → cellular organisms → Eukaryota | 703 | Open in IMG/M |
3300017417|Ga0182230_1061997 | All Organisms → cellular organisms → Eukaryota | 663 | Open in IMG/M |
3300017420|Ga0182228_1003197 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2264 | Open in IMG/M |
3300017424|Ga0182219_1070852 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 622 | Open in IMG/M |
3300017425|Ga0182224_1015881 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1029 | Open in IMG/M |
3300017425|Ga0182224_1025436 | Not Available | 897 | Open in IMG/M |
3300017425|Ga0182224_1076843 | Not Available | 643 | Open in IMG/M |
3300017425|Ga0182224_1142636 | Not Available | 528 | Open in IMG/M |
3300017427|Ga0182190_1093807 | All Organisms → cellular organisms → Eukaryota | 611 | Open in IMG/M |
3300017427|Ga0182190_1116098 | All Organisms → cellular organisms → Eukaryota | 568 | Open in IMG/M |
3300017427|Ga0182190_1118523 | Not Available | 564 | Open in IMG/M |
3300017427|Ga0182190_1138752 | Not Available | 534 | Open in IMG/M |
3300017430|Ga0182192_1119309 | All Organisms → cellular organisms → Eukaryota | 573 | Open in IMG/M |
3300017433|Ga0182206_1025379 | Not Available | 890 | Open in IMG/M |
3300017433|Ga0182206_1048699 | Not Available | 732 | Open in IMG/M |
3300017433|Ga0182206_1087453 | Not Available | 610 | Open in IMG/M |
3300017433|Ga0182206_1117742 | Not Available | 555 | Open in IMG/M |
3300017433|Ga0182206_1126287 | All Organisms → cellular organisms → Eukaryota | 542 | Open in IMG/M |
3300017436|Ga0182209_1071106 | Not Available | 670 | Open in IMG/M |
3300017436|Ga0182209_1088940 | Not Available | 625 | Open in IMG/M |
3300017438|Ga0182191_1011360 | Not Available | 1220 | Open in IMG/M |
3300017438|Ga0182191_1074049 | Not Available | 681 | Open in IMG/M |
3300017438|Ga0182191_1111085 | All Organisms → cellular organisms → Eukaryota | 596 | Open in IMG/M |
3300017438|Ga0182191_1140276 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 551 | Open in IMG/M |
3300017438|Ga0182191_1152189 | Not Available | 536 | Open in IMG/M |
3300017438|Ga0182191_1155669 | All Organisms → cellular organisms → Eukaryota | 531 | Open in IMG/M |
3300017438|Ga0182191_1157155 | Not Available | 530 | Open in IMG/M |
3300017442|Ga0182221_1010182 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1174 | Open in IMG/M |
3300017442|Ga0182221_1039574 | Not Available | 786 | Open in IMG/M |
3300017442|Ga0182221_1085710 | Not Available | 623 | Open in IMG/M |
3300017442|Ga0182221_1127512 | Not Available | 551 | Open in IMG/M |
3300017443|Ga0182193_1194921 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 504 | Open in IMG/M |
3300017681|Ga0182226_1093812 | All Organisms → cellular organisms → Eukaryota | 564 | Open in IMG/M |
3300017682|Ga0182229_1083944 | All Organisms → cellular organisms → Eukaryota | 555 | Open in IMG/M |
3300017683|Ga0182218_1043142 | Not Available | 740 | Open in IMG/M |
3300017683|Ga0182218_1055414 | Not Available | 687 | Open in IMG/M |
3300017683|Ga0182218_1084841 | Not Available | 605 | Open in IMG/M |
3300017683|Ga0182218_1115491 | Not Available | 550 | Open in IMG/M |
3300017685|Ga0182227_1096643 | Not Available | 572 | Open in IMG/M |
3300017685|Ga0182227_1128609 | Not Available | 513 | Open in IMG/M |
3300017686|Ga0182205_1050175 | Not Available | 755 | Open in IMG/M |
3300017686|Ga0182205_1161860 | Not Available | 512 | Open in IMG/M |
3300017690|Ga0182223_1051287 | Not Available | 643 | Open in IMG/M |
3300017690|Ga0182223_1059991 | All Organisms → cellular organisms → Eukaryota | 616 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 98.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068869_1015050661 | 3300005334 | Miscanthus Rhizosphere | MASFSNLSKTYAKDKLSKSATMVLLVCCYLYRKRSNIINVNAEAKEQGRDMQTPVD |
Ga0157378_121649501 | 3300013297 | Miscanthus Rhizosphere | MASFSNPSKTYTKDKLSKCATTVLLVCCYLYHKRSNTINVNVKDKEQGRDM |
Ga0157378_131334562 | 3300013297 | Miscanthus Rhizosphere | MASFSILSKTYAKDKLSKCATTVLLVCCYLYRKRSNTINVNAKAKEQGRDIQTP |
Ga0182154_10538631 | 3300015268 | Miscanthus Phyllosphere | MASSSNLSKTYAKDKLSKCATTVLLVCCYLYRKRSNTINVNAEAKAQGRDMQTPVDDSS |
Ga0182154_10713272 | 3300015268 | Miscanthus Phyllosphere | MASFTNHSKTYAIDKLSKGATIVLLVCYYLYRKRSNTINVNAEAK |
Ga0182188_10245792 | 3300015274 | Miscanthus Phyllosphere | MAIFSILSKTYAKDKLSKYATMILLVCCYLYHKRSNIIKVNAEAKEQDRDMKTPVD |
Ga0182188_10288931 | 3300015274 | Miscanthus Phyllosphere | ASFSNPSKTYAIDKLSRCATIVLLVCCYLYRKRSKVINVNAEAKEQGRDM* |
Ga0182172_10299941 | 3300015275 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLVCCYLYRKRSNTINVNAEAKEQGRDMQTP |
Ga0182170_10111372 | 3300015276 | Miscanthus Phyllosphere | MASCSNPSKTYAIDKLSKCATMVLLECCYLYRKRSKVININAEAKEQGRDMQTP |
Ga0182170_10160192 | 3300015276 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKCATTVLLVCCYLYRKKSYANNVNAEAK |
Ga0182128_10510381 | 3300015277 | Miscanthus Phyllosphere | MASFSNLNKTYAKNKLPKCATTVLLMCCYLYRKRSNTNNVNAEAK |
Ga0182128_10560091 | 3300015277 | Miscanthus Phyllosphere | TMASFSNLSKTYAKDKLSKCATTVLLVYCYLYRKRSKVNKVNAKAKE* |
Ga0182174_10457132 | 3300015279 | Miscanthus Phyllosphere | MASFANLSKTYAIDKLSKCATTVLLVCCYLYRKRSNVINV |
Ga0182174_10609261 | 3300015279 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLVCSYLYHKRSNIINVNAEAKEQGK |
Ga0182174_10704012 | 3300015279 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSRCATMVLLVCCYLYHKCSKVINVNAEAKEQGRDMQT |
Ga0182174_10715542 | 3300015279 | Miscanthus Phyllosphere | MASFSKLSKTYAKDKLSKCATTVLLVCCYLYRKRSNIINVNAEAKEHGR |
Ga0182160_10319451 | 3300015281 | Miscanthus Phyllosphere | MASFLSLAKTYAKDKLSRCATTVFLMCCYLYHKRCNTNNVNAEAKEQGRDMQTPIDDS |
Ga0182160_10808451 | 3300015281 | Miscanthus Phyllosphere | MASFANLSKTYAKDKLSKCATMVLLVCCYLYRKRSYANNVNAEAKE* |
Ga0182124_10101611 | 3300015282 | Miscanthus Phyllosphere | MATFSILSKTYAKNKLSKCASMVLLVCCYLYRKRSYANNVNAEAKE* |
Ga0182156_10323132 | 3300015283 | Miscanthus Phyllosphere | MASFSTSSKTYAIDKLSRCATMVLLMCCYLYRKRSKVININAEAKEQGRDMQ |
Ga0182186_10324432 | 3300015285 | Miscanthus Phyllosphere | MASFSNLTKTYAKDKLSKCATTVLLVCCYLYRKRSNTINVNAE |
Ga0182186_10711501 | 3300015285 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLVCCYLYRKRSNTINVNA |
Ga0182186_10807462 | 3300015285 | Miscanthus Phyllosphere | MASCSNPSKTYAIDKLSRCATMVLLECCYLYRKRSKVININAEAKEQGRDMQT |
Ga0182176_10081421 | 3300015286 | Miscanthus Phyllosphere | MTSFSNLSKTYAKDKLSKCVTTVLLVCCYLYRKRSNTINVNAEAKE* |
Ga0182176_10181641 | 3300015286 | Miscanthus Phyllosphere | MASFSNPSKTYAIYKLSKCAPMALLVCCYLYRKHSKVINVNAEAKEQCRDMQTPIDDSGIFTEVSR |
Ga0182171_10674881 | 3300015287 | Miscanthus Phyllosphere | MASFANLSKTYAIDKLSKCATMVLLVCCYLYRKRSNVINV |
Ga0182173_10851791 | 3300015288 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKYATTVLLVCCYLYSKRSNVINVNVEAKE* |
Ga0182125_10410622 | 3300015291 | Miscanthus Phyllosphere | MASFSNLSKTYANDKLSKCATTVLLVCCYLYRKCSKVINVNAEAK |
Ga0182125_10855262 | 3300015291 | Miscanthus Phyllosphere | MASSSNPSKTYAIDKLSRCATMVLLVCCYLYRKRSKVINVNAEAKEQGRDMQTP |
Ga0182141_10448911 | 3300015292 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKSATTVLLVCCHLYHKRSNTINVHVEAKEQG |
Ga0182126_10765801 | 3300015294 | Miscanthus Phyllosphere | MTSFANLSKTYAKDKLSKYATTVLLIYCYLYHKRSNIININAEVKEQGRD |
Ga0182175_10337291 | 3300015295 | Miscanthus Phyllosphere | MASFSNSSKTYAIDKLSKCATTVLIVCCYLYRKRSNTINVNAEAKEQGRDMQ |
Ga0182175_10683552 | 3300015295 | Miscanthus Phyllosphere | MASCSNPSKTYAIDKLSRCATMVLLECCYLYRKRSKVININAEAKEQGRDMQTLI |
Ga0182157_10290262 | 3300015296 | Miscanthus Phyllosphere | MAHFSTLSKIYAKDKLSKYVTTILLVCCYFYRKRSNTNHVNAKAKEQ |
Ga0182157_10313781 | 3300015296 | Miscanthus Phyllosphere | MASFSNLSKTYANDKLSKCATTVLLVCCYLYRKCSKVINVNAEAKE* |
Ga0182157_10368321 | 3300015296 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCTTMVLLVCCYLYHKRSNTINVNVAAKE |
Ga0182157_10904611 | 3300015296 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATIVLLVCCYLYRKRSNTNNVNSEVKEQGRDMQTPI |
Ga0182106_10373681 | 3300015298 | Miscanthus Phyllosphere | MTYFSILSKTYAKDKLSKCATTVFLVCCYLYHKKSNVNNVNAEAKEQGRDM |
Ga0182106_10384031 | 3300015298 | Miscanthus Phyllosphere | MTSFSNLSKTYVKDKLSKCATTVLLVCCNLYRKRSSTVNVNAEAKGQ |
Ga0182106_10449812 | 3300015298 | Miscanthus Phyllosphere | MASFSSSSKTYAKDKLSKYAATILLVCYYLYRKRSNTINVNAEAKKQGRDMQTPI |
Ga0182107_10678142 | 3300015299 | Miscanthus Phyllosphere | MASFSNPSKTYIIDKLSRCATMVLLVCCYLYRKRSKVINVNAEAKEQGRDMQTPVDD |
Ga0182107_10748091 | 3300015299 | Miscanthus Phyllosphere | MASFANLSKTYVKDKLSKCATMVLLVCCYLYHKSSNIINVNAEAKEQG |
Ga0182107_10876561 | 3300015299 | Miscanthus Phyllosphere | MTSFSNPSKTYAIDKLSRCATIVLLVCCYLYYKCSKVINVNAEAKE |
Ga0182108_10488042 | 3300015300 | Miscanthus Phyllosphere | MASFSNLSKTYVKNKLSKCATTVLLVCCYIYRKCRKVINVNAKAKEQG |
Ga0182143_10811161 | 3300015302 | Miscanthus Phyllosphere | MASFINLSKTYAKDKPSKCEPMVLLVCCYLYRKRSNTINVNAEAKEQGRDMQTPVDD |
Ga0182123_10155601 | 3300015303 | Miscanthus Phyllosphere | MASYSNFSKTYAKDKLSKCATMVFLVCCYLYRKMSYANNINAEDKH* |
Ga0182123_10284311 | 3300015303 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATIVLLLCCYLYRKRSNTINVNAEAKEQGRYTQTPVDDSG |
Ga0182123_10605671 | 3300015303 | Miscanthus Phyllosphere | MASFSILSKTYVKDKLSKCATTVLLVYCYLYHKRSYANNVNAEAKE* |
Ga0182112_10901571 | 3300015304 | Miscanthus Phyllosphere | AKDKLSKCATMVLLVCCYLYHKRSNTINVNVEAKEQGRDMQTPIEDSGIFT* |
Ga0182158_10674351 | 3300015305 | Miscanthus Phyllosphere | MFFFSNPSKTYTKDKISTCATTVLLVYCYLYRKRSNVINVNAEAKEQGRDMQTPVD |
Ga0182158_11016351 | 3300015305 | Miscanthus Phyllosphere | VASFSNLSKTYAEDKLSKFATTVLLVCCYLYRKRSNTINVNAEAKEQ |
Ga0182144_10570821 | 3300015307 | Miscanthus Phyllosphere | MVSFSTSSKTYAKDKLSKYATTVLLVCCYLYRKRSNTINVNAEAKKQGRDMQTPVD |
Ga0182144_10617332 | 3300015307 | Miscanthus Phyllosphere | MASFSTLSKIYAKDKLSKCATTVLLMCCYLYRKRSNVNNVNAEAKQQGR |
Ga0182142_10533131 | 3300015308 | Miscanthus Phyllosphere | MASFSILSKTYVKDKLSKCATTVLLVCCYLYRKRSYANNVNAEAKE* |
Ga0182142_10727041 | 3300015308 | Miscanthus Phyllosphere | MASFSILSKTYAKDKLSKYATTVLLVCCYLYRKRSNVNNINVKAKEQGRDM* |
Ga0182140_10139022 | 3300015314 | Miscanthus Phyllosphere | MVSFSNLSKTYAKDELSKSATTVLLVCCYLYHKKSNAINVNAEAKEQYRDIQTPVD |
Ga0182140_11167792 | 3300015314 | Miscanthus Phyllosphere | MASFSNHSKTYAKDKLSKCATTVLLVCCYLYRKHSKVINVNAEAKEQGRDMQTPVD |
Ga0182127_10409661 | 3300015321 | Miscanthus Phyllosphere | MVSFSIFSKTYAKDKLSKYATTVLLVCCYLYHKRSYANNVNAEAK |
Ga0182127_10978002 | 3300015321 | Miscanthus Phyllosphere | MATFSNLSKIYTKDKLSKYATMVLLVYCYLYRKSSKVNNVNAEAKEQGRDM* |
Ga0182127_11238191 | 3300015321 | Miscanthus Phyllosphere | MASFSNPSKTYVIDKLSRCATMVLLVCCYLYRKRSKVINVNAEAKEQGRDMQTPV |
Ga0182110_10541191 | 3300015322 | Miscanthus Phyllosphere | MASFSTLSKTYVKDKLSKCATAVLLVCCYLYYKKSNIINVDAEAKEQ |
Ga0182110_10602233 | 3300015322 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSTCATMVLLLCCYLYRKHSKEINVNAEAKE |
Ga0182110_10609541 | 3300015322 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSRCTTTVLLVFCYLYRKRSNTINVNAEAKTQGRDMQTPVDD* |
Ga0182129_10418132 | 3300015323 | Miscanthus Phyllosphere | MASFSNATKTYAIDKLSGCATTVLLVCCYLYRKKTTNTINVNAEAKKQG |
Ga0182129_10668151 | 3300015323 | Miscanthus Phyllosphere | MTSFSNPSKTYAIDKLSRCATMVLLVCCYRYRKRSKVININAEAKEQGRD |
Ga0182129_10991801 | 3300015323 | Miscanthus Phyllosphere | MASFCILSKTYVKDKLSKYTTTVLLVCCYLYRKRSYANDVNVEAKE* |
Ga0182129_11028991 | 3300015323 | Miscanthus Phyllosphere | MASFSTSSKTYAKDKLSECATTVLLVCCYLYRKYSKVINVNAEAKEQGRDMQTPVD |
Ga0182187_10432151 | 3300015341 | Miscanthus Phyllosphere | MASFDNLSNTYAKDKLSKCKTMVLLMCCYLYRNRSNVINVSAEAKERGR |
Ga0182187_10601491 | 3300015341 | Miscanthus Phyllosphere | MASFSPLSKTYAKDKLSKCATMILLVYCYLYRKSNNTNNVNSEAK |
Ga0182187_11755322 | 3300015341 | Miscanthus Phyllosphere | MVSFSNPSKTYAKDKLFKFSTTVLLVYYYIYRKRSNTTNLNVEDKEQSR |
Ga0182187_11765511 | 3300015341 | Miscanthus Phyllosphere | MTSFSNLNKTYAKDKLSKCATMVLLVCCYLYSKRSNIINVNAEAKKQGRDMQTPIDDSG |
Ga0182187_11950441 | 3300015341 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKYATTVLLLCCYLYHKRSYANNVNAEAKE* |
Ga0182109_10312461 | 3300015342 | Miscanthus Phyllosphere | MVSFSNLIKTYAKDKLSKCAITVLIVCSYLYRKRSCTINVNAEAKEQGRNMQTL |
Ga0182109_10716683 | 3300015342 | Miscanthus Phyllosphere | MTSFTNLSKTYAKDKLSKCATKILLVCCYLYRKRSNTINVNAD |
Ga0182109_10883491 | 3300015342 | Miscanthus Phyllosphere | MASFSNLSKSYAKAKLSKCATTILLVCCYLYRKRSNTINVNTEAIEQGRDMQTPV |
Ga0182109_10953232 | 3300015342 | Miscanthus Phyllosphere | MASFSNHSKTYAIDKISRCATMVLLVCCYLYRKRSKVINVNAEAKEQGRDMQTPVD |
Ga0182109_11330052 | 3300015342 | Miscanthus Phyllosphere | MASFSNLSKTYAIDKLSKCVTTVLLVCCYLYRKSSNTINVNAEA |
Ga0182109_12100892 | 3300015342 | Miscanthus Phyllosphere | MASFSNPSKTYVIDKLSRCATMVLLVCCYLYRKRSKVINVNAEAKEQGR |
Ga0182155_10340102 | 3300015343 | Miscanthus Phyllosphere | MVSFSNPNKTYAKDKLSKSATTILLVYSYLYRKRIKVNNVNVKAKEQGRDMQ |
Ga0182155_11111621 | 3300015343 | Miscanthus Phyllosphere | MAFFSNLSKTYAKDKLSKCVTTVLLVCCYRYRKRSNVINVNAETKEQGRDM* |
Ga0182155_11151041 | 3300015343 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATIILLMCCYLYRKRSNVNNVKAKAKEQGR |
Ga0182155_11826981 | 3300015343 | Miscanthus Phyllosphere | MTSFTNLSRTYAKDKLSKCAPMVLLVCCYLYRKRSNTINVNAEPKEQGRDMQTPIDD |
Ga0182155_11991961 | 3300015343 | Miscanthus Phyllosphere | MASFSNLSKTYARDKLSKGATMVLIMCCYLYRKRSNTINVNVEAKELGR |
Ga0182111_10812392 | 3300015345 | Miscanthus Phyllosphere | MASFSNPSKTYAKDKLSKCATMVLLVCCYLYRKRSNVINVNA |
Ga0182111_12144611 | 3300015345 | Miscanthus Phyllosphere | MASFSNPSKTYAKDKLSKCATMVLLVCYYLYRKHSKVNNVNMEAKEQGRDMQTPVD |
Ga0182139_10867401 | 3300015346 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKCATTVLLVCCYLYRKRSNTININAEAK |
Ga0182139_11899521 | 3300015346 | Miscanthus Phyllosphere | MASFSTSSKTYAKDKLSKCATTVLLRCCYLYRKRSNTMNVNTEAKEQGRDMQ |
Ga0182139_11931261 | 3300015346 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKCATTVLLMCCYLYRKRSNAINVNAEAKEQGRDMQTPVDDS |
Ga0182139_12130761 | 3300015346 | Miscanthus Phyllosphere | MASFSNSSKTYVIDKLSRCATMVLLVCCYLYRKCSKVININAEAKEQGRDMQTPVD |
Ga0182177_10671031 | 3300015347 | Miscanthus Phyllosphere | MASFSNPSKTYVIDKLSRCATMVLLVCCYLYRKRSKVINVNAEAKE |
Ga0182177_11646161 | 3300015347 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSKCATTVLLVCCYLYRKTSNVINVNAEAK |
Ga0182177_12017361 | 3300015347 | Miscanthus Phyllosphere | MAYFPNLSKTYAKDKLSKYATTVLLMCCYLYRKRSNTNNVNAKAKE* |
Ga0182177_12455201 | 3300015347 | Miscanthus Phyllosphere | MASFSILSKTYAKDKLFKCATTVLLVCSITTAKRSNTIKVNTEAKEQGRDVQTPVDD |
Ga0182161_10612791 | 3300015351 | Miscanthus Phyllosphere | MASFSNPSKTYTKDKLPKCATTILLVCCYIYRKRSNTINVNAEAKEQGRDMQTPVD |
Ga0182161_11015751 | 3300015351 | Miscanthus Phyllosphere | MASFSNLNKTYAKNKLSKCITTVLLVCCYLYRKKSYTNNINEETKE* |
Ga0182161_11162152 | 3300015351 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKCATTVLLMCCYLYRKRSNAINVNAKAK |
Ga0182161_11372402 | 3300015351 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKISRCATMVLLEYCYLYRKLNKVINVNAEAIEQGRDM |
Ga0182161_12172061 | 3300015351 | Miscanthus Phyllosphere | MASFLNLSKTYAKDKLSKCATTVLLVCCYLYRKRSNTINVN |
Ga0182161_12311251 | 3300015351 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVFLVCCYLYHKRSNTNNVNAEAKEQGRD |
Ga0182159_10127553 | 3300015355 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLVCCYLYHKRSNVINVNAEAKEQGRDMQTPV |
Ga0182159_10968701 | 3300015355 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATIVLLMCCYLYRKRSNAINVNAEAKEQGRDMQTPIDD |
Ga0182159_11517532 | 3300015355 | Miscanthus Phyllosphere | MRLKKLDFQPLASFSTSSKTYAKDELSKCATTVLLVCCYLYRKRSNTINVNAEGKEQGRDMQTPI |
Ga0182159_11656021 | 3300015355 | Miscanthus Phyllosphere | MVSFSTLSKTYAKDKLSKYATAVLLECCYLYRKMSYTNNVNAKAKE* |
Ga0182159_11992431 | 3300015355 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKCATTVLLVCCYLYHKRSNTINVNAEAKEQGR |
Ga0182159_12298633 | 3300015355 | Miscanthus Phyllosphere | MTSFSNPSKTYLKDKLSKCATTVFLMYCYLYRKRSNVINVNAK |
Ga0182159_12310891 | 3300015355 | Miscanthus Phyllosphere | MASSSNLSKTYAKDKLSKCATMVLLMCCYLYHKRSKVINVNAEAKEQG |
Ga0182159_12454701 | 3300015355 | Miscanthus Phyllosphere | MASFSNLSKTYAKDQLSKCATTVLLVCCYLYRKRSKTINVNAEAKEQGRDMQT |
Ga0182159_12594661 | 3300015355 | Miscanthus Phyllosphere | MVSFCNLSKNYAKDKLSKCTTTVLLVYCYLYRKRSNVNNINAEAKEQRR |
Ga0182159_13124101 | 3300015355 | Miscanthus Phyllosphere | MASFSNPSKTYAKDKLSKSATTVLLVCCYLHRKMSNTININAEAKEQGRDI* |
Ga0182145_10031583 | 3300015361 | Miscanthus Phyllosphere | MASFTNLSKTHAKDKLYKCASMVLLVCCYLYHKRSNTINVNAEAKEQGRDMQTPID |
Ga0182145_10930951 | 3300015361 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKYTTTVLLVCCYLYRKRSNTINVNAEAKEQDRDMQTPV |
Ga0182145_11374851 | 3300015361 | Miscanthus Phyllosphere | MASFSKPSKTFAKDKLSKCATTVLLVCCYRYRKRSNAINVNV |
Ga0182145_11680211 | 3300015361 | Miscanthus Phyllosphere | MTSFSNLSKIYIKHKLSKCVTTIFLVCCYLYRKRSNVNNINVKAKEQGRDMQTHV |
Ga0182203_10201551 | 3300017404 | Miscanthus Phyllosphere | MATFSTLSKTYAKDKLSKCATTVLLVCCYLYHKRSNVNNVNAEAKEQGRDM |
Ga0182203_10592491 | 3300017404 | Miscanthus Phyllosphere | MVSFSTHSKTYAKDKLSKCATMVLLMCCYLYRKRSNVINVNAEAK |
Ga0182203_10749741 | 3300017404 | Miscanthus Phyllosphere | MVSFSNPSKTYAKDKLSKYATTVLLVCSYLYRKMSNTININAEAKEEGRDMQTPVDDSGI |
Ga0182203_10986961 | 3300017404 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSKCATTVLLVCCYLYRKRSNTINVNAEAKEQG |
Ga0182203_11640171 | 3300017404 | Miscanthus Phyllosphere | MASFSNLSKTYVKDKLFKYATTALLVCCYLYHKRSNTINVNAEAKEQGRDMQT |
Ga0182220_10184501 | 3300017407 | Miscanthus Phyllosphere | MVSFSNLIKIYAKDKLSKCATTVLLVCCYLYRKKSTVNNINAEAKEQ |
Ga0182220_10431991 | 3300017407 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSRCATIVLLVCCYLYRKRSKVINVNAEAKEQ |
Ga0182220_10831091 | 3300017407 | Miscanthus Phyllosphere | MASFSTLSKTYAKDKLSKCATTVLLKCCYLYRKRSNTINVNAEAKEQC |
Ga0182204_10806432 | 3300017409 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSKCANKILLVRCYLYRKRSNAINVNTEVKEQ |
Ga0182207_10887941 | 3300017410 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLVCCYLYRKCSKVINVNAEAKEQGRDMQTPIDD |
Ga0182208_11103571 | 3300017411 | Miscanthus Phyllosphere | MTSFSNPSKTYTIDKLSKCATIILLVRCYLYRKRSNTINVNAEAKEQGRY |
Ga0182222_11080801 | 3300017413 | Miscanthus Phyllosphere | MAYFSNLSKTYAKDKLSKCATTVLLMCCYLYRNRSNVINVSAEAKERGRDMQTSVDNFG |
Ga0182202_10226491 | 3300017415 | Miscanthus Phyllosphere | MTSFSNPSKTYATDKLSRCATMVLLVCCYLYRKRSKVINVNAEAKEQGRDMQ |
Ga0182202_11006882 | 3300017415 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATMVLLVYCYLYRKKSNTINVNAEAKEQGRDMQTP |
Ga0182230_10411381 | 3300017417 | Miscanthus Phyllosphere | RTMASFSILSKTYARDKLSKCATKILLVCCYLYRKISYANNVNAEAKE |
Ga0182230_10479132 | 3300017417 | Miscanthus Phyllosphere | MASFSTFSKTYAKDKLSKCATTVLLMCCYLYRNRSNVINVSAEAKE |
Ga0182230_10547261 | 3300017417 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLQVYCYLYRKRSNTINVNAEAKEQ |
Ga0182230_10619972 | 3300017417 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSRCATKVLLVYCYLYRKRSKVINVNAEAKE |
Ga0182228_10031971 | 3300017420 | Miscanthus Phyllosphere | MASFSNPSKTYTIDKLSRCATMVLLVCCYLYRKRSNINNVNTEVKEQGRDMQTPVDA |
Ga0182219_10708522 | 3300017424 | Miscanthus Phyllosphere | MVSFSNLSKTYAKDKLSKCATTVSLVCCYLYRKRSNTINVNAEAKEQGR |
Ga0182224_10158812 | 3300017425 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLVCCYLYYKRSNTINVNAEAKE |
Ga0182224_10254362 | 3300017425 | Miscanthus Phyllosphere | MASFSISSKTYAKDKLSKCATTVLLLCCYLYRKSNNVINVNAEA |
Ga0182224_10768431 | 3300017425 | Miscanthus Phyllosphere | MVSFSTLSKTYAKDKLSKCATTVLLVCCYLYRKRSYANNVNAEAKE |
Ga0182224_11426361 | 3300017425 | Miscanthus Phyllosphere | MVSFSNLSKTYAKDKLSKCATTVLLVCCYLYRKKSKAINVNAEAK |
Ga0182190_10938072 | 3300017427 | Miscanthus Phyllosphere | MASFSNLSKTYVKDKLSKYTTTILLVCCYLYRKRSNTINVNVEAKEQG |
Ga0182190_11160981 | 3300017427 | Miscanthus Phyllosphere | MATFSNPCKTYAIDKLSKCATTVLLECCYLYRKRSNTINVNAEAKEQGRDMQ |
Ga0182190_11185231 | 3300017427 | Miscanthus Phyllosphere | MASFSNPSKTYAINELSKCATTVFLVCCYLYRKRSDTINVNAEAKKQGRDM |
Ga0182190_11387521 | 3300017427 | Miscanthus Phyllosphere | MASFPNLSKTYAKDKLSKCATTVLLMCCYLYRKRSNAINVNAEAKEQGRDMQ |
Ga0182192_11193092 | 3300017430 | Miscanthus Phyllosphere | MASFSNLSKTYGKDKLCKFVTTVLLVCCYHDRKHSKVINVNAEAKEQSRD |
Ga0182206_10253791 | 3300017433 | Miscanthus Phyllosphere | MASFSILSKTYAKDKLSKCATMVLLLCCYLYRKKGNTNNVNAE |
Ga0182206_10486991 | 3300017433 | Miscanthus Phyllosphere | MASFSNSSKTYAKDKLSKCATTVLLVCCYLYYKRSTVINVNAEDKEQ |
Ga0182206_10874531 | 3300017433 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLVCCYLYRKRSNANNINAEAKEQGRDMQTL |
Ga0182206_11177422 | 3300017433 | Miscanthus Phyllosphere | MASFSNLSKTNAKDKLSKCATTVLLVCCYLYRKRSNANNVNAEAKEQGRDMQTPIDD |
Ga0182206_11262872 | 3300017433 | Miscanthus Phyllosphere | MTSLSNLSKTYAIDKLSRCATMVLLVCCYLYRKRSNTINVNAEVKEQGRDMQTPIDD |
Ga0182209_10711061 | 3300017436 | Miscanthus Phyllosphere | MASFSNLSKTYATDKLSKCATMVLLVCCYLYRKHSKVINVNAEAKEQGRDMQT |
Ga0182209_10889401 | 3300017436 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKYEKMVLLVCCYVYRKRSNTINVHAEAKEQGR |
Ga0182191_10113603 | 3300017438 | Miscanthus Phyllosphere | MASFSISSKTYAIEKLSKRATTVLLVCCYLYRKTSNVININAKAKEQGRDMQRARLYD |
Ga0182191_10740491 | 3300017438 | Miscanthus Phyllosphere | MTSFSNLSKTYAKDKLSKCATTVLLVCCYLYHKRSNANNINAE |
Ga0182191_11110852 | 3300017438 | Miscanthus Phyllosphere | MASFSNPSKTYAIDKLSKCATMVLLVCCYLYRKRSNTINVNAEAKEQGR |
Ga0182191_11402761 | 3300017438 | Miscanthus Phyllosphere | MASFSNLSKTYEKDKLSKCATTVLLVCCYLYRKRSNVINVNAEDKE |
Ga0182191_11521891 | 3300017438 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATTVLLMCCYLYRKRSNAINVNAEAKEQGRDMQTP |
Ga0182191_11556692 | 3300017438 | Miscanthus Phyllosphere | MASCSNPSKTYAIDKLSRCATMVLLECCYLYRKRSKVINVNAEAKEQGRDMQTPVDD |
Ga0182191_11571551 | 3300017438 | Miscanthus Phyllosphere | MAYFSNLNKTYAKDKLSKCATTVLLVCCYLYRKRSNAINVNAEAKEQGRD |
Ga0182221_10101822 | 3300017442 | Miscanthus Phyllosphere | MTSFSNLSKTYAKNKLSKCAIIVLLVHNYLYRKRSNTINVNAEAIEQDRDMQTPIDD |
Ga0182221_10395741 | 3300017442 | Miscanthus Phyllosphere | MTSFSYLSKPFAKDKLSKCATTVLLVCCYLYRKRSNAINVNAEAKEQ |
Ga0182221_10857101 | 3300017442 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATKILLVCCYLYRKRSNTINVNV |
Ga0182221_11275121 | 3300017442 | Miscanthus Phyllosphere | VASFSTSSKTYAKDKLSKYEKMVLLVCCYVYRKRSNTINVHAEAKEQGRDILSTKYGQ |
Ga0182193_11949211 | 3300017443 | Miscanthus Phyllosphere | MASFSNLSKTYAKDKLSKCATMVLLMCCYLYRKTSNAINVNAEAKEQGRDM |
Ga0182226_10938122 | 3300017681 | Miscanthus Phyllosphere | MTSFSNSSKTYAKDELSQCATTVLLVSCYLYHKRSKVINVNMEAKE |
Ga0182229_10839442 | 3300017682 | Miscanthus Phyllosphere | MASYSILSKTYAKDKLSKYATTVLLVCCYLYRKRSYANNVNAEAKRV |
Ga0182218_10431422 | 3300017683 | Miscanthus Phyllosphere | MASFSNLTKTYAKDKLSECATTVLLVCCYLYRKRSNTIDVNAEAKEQGRDMQ |
Ga0182218_10554141 | 3300017683 | Miscanthus Phyllosphere | MASSSNPNKIYAKDKLSKCTTTVLLVYCYLYRKRSNTINVNAEAKEQGRDMQTPIDD |
Ga0182218_10848411 | 3300017683 | Miscanthus Phyllosphere | MASFFNLSKTYAKDKLSKCETTVLLVYCYLYRKRSNTINVNAEAKEQGRDMQTPIDDF |
Ga0182218_11154911 | 3300017683 | Miscanthus Phyllosphere | LASFSTSSKTYVKDELSKCATMVLLVCCYLYRKRSKAININTEAKEQGRDMQTPVDDSDI |
Ga0182227_10966432 | 3300017685 | Miscanthus Phyllosphere | MTSFSNPSKTYAIDKLSKCATTVLLVCCNLYRKKSNTINVNAEAKEHGRDM |
Ga0182227_11286091 | 3300017685 | Miscanthus Phyllosphere | MTSFSILNKTYTKDKLSKCATMVLLVCCYLYHKRSYANNVNA |
Ga0182205_10501751 | 3300017686 | Miscanthus Phyllosphere | MTSFSNPSKTYAIDKLSRCATTILLVCCYLYRKRSNVINVNAKAKEQGR |
Ga0182205_11618601 | 3300017686 | Miscanthus Phyllosphere | MASFSNLSKTYVKDKLSKCATTVLLVCRYLYRKRSKAINVNAEAKEQG |
Ga0182223_10512872 | 3300017690 | Miscanthus Phyllosphere | MAYFSNPSKTYAIDKLSRWATMVLLVCCYLYHKRSKVSNVNVEAKE |
Ga0182223_10599911 | 3300017690 | Miscanthus Phyllosphere | MASCSNPSKTYAIDKLSRCATMVLLECCYLYRKRSKVININAEAKEQGRDMQTYIDDSRILIEV |
⦗Top⦘ |