| Basic Information | |
|---|---|
| Family ID | F034768 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 174 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MDKAKKLENERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 174 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.41 % |
| % of genes near scaffold ends (potentially truncated) | 27.01 % |
| % of genes from short scaffolds (< 2000 bps) | 76.44 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.862 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.402 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.747 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.73% β-sheet: 0.00% Coil/Unstructured: 63.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 174 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 39.08 |
| PF04542 | Sigma70_r2 | 15.52 |
| PF08281 | Sigma70_r4_2 | 12.64 |
| PF13478 | XdhC_C | 11.49 |
| PF01035 | DNA_binding_1 | 4.02 |
| PF03795 | YCII | 2.87 |
| PF12804 | NTP_transf_3 | 1.72 |
| PF11528 | DUF3224 | 1.15 |
| PF03450 | CO_deh_flav_C | 1.15 |
| PF09339 | HTH_IclR | 0.57 |
| PF00583 | Acetyltransf_1 | 0.57 |
| PF13420 | Acetyltransf_4 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 174 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 15.52 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 15.52 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 15.52 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 15.52 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 4.02 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 4.02 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_108578806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 960 | Open in IMG/M |
| 3300001359|A3035W6_1094336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 1328 | Open in IMG/M |
| 3300001536|A1565W1_11583353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300002561|JGI25384J37096_10076700 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300002908|JGI25382J43887_10396300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300004153|Ga0063455_100813070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
| 3300004643|Ga0062591_100194272 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300005166|Ga0066674_10155411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300005166|Ga0066674_10456500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 583 | Open in IMG/M |
| 3300005167|Ga0066672_10146407 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300005167|Ga0066672_10906561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300005171|Ga0066677_10021094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3012 | Open in IMG/M |
| 3300005172|Ga0066683_10059548 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300005172|Ga0066683_10135275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1508 | Open in IMG/M |
| 3300005174|Ga0066680_10949667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 507 | Open in IMG/M |
| 3300005175|Ga0066673_10005871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae | 4957 | Open in IMG/M |
| 3300005176|Ga0066679_10018805 | All Organisms → cellular organisms → Bacteria | 3619 | Open in IMG/M |
| 3300005176|Ga0066679_10315347 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300005178|Ga0066688_10953734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300005180|Ga0066685_10035998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3102 | Open in IMG/M |
| 3300005180|Ga0066685_10742918 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005181|Ga0066678_10180921 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300005184|Ga0066671_10020831 | All Organisms → cellular organisms → Bacteria | 2896 | Open in IMG/M |
| 3300005186|Ga0066676_10254952 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300005186|Ga0066676_10299462 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005187|Ga0066675_10227187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1324 | Open in IMG/M |
| 3300005345|Ga0070692_10611924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 722 | Open in IMG/M |
| 3300005445|Ga0070708_100064082 | All Organisms → cellular organisms → Bacteria | 3292 | Open in IMG/M |
| 3300005445|Ga0070708_100720534 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005445|Ga0070708_101064919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 758 | Open in IMG/M |
| 3300005447|Ga0066689_10557191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300005450|Ga0066682_10177023 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300005454|Ga0066687_10075750 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300005467|Ga0070706_101484289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300005468|Ga0070707_101014085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 795 | Open in IMG/M |
| 3300005536|Ga0070697_100868445 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005540|Ga0066697_10048460 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300005540|Ga0066697_10781982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300005545|Ga0070695_100032862 | All Organisms → cellular organisms → Bacteria | 3244 | Open in IMG/M |
| 3300005559|Ga0066700_11075606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
| 3300005560|Ga0066670_10560388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 698 | Open in IMG/M |
| 3300005568|Ga0066703_10221274 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005569|Ga0066705_10037963 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
| 3300005569|Ga0066705_10069294 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300005586|Ga0066691_10302985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 943 | Open in IMG/M |
| 3300006049|Ga0075417_10019738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2671 | Open in IMG/M |
| 3300006791|Ga0066653_10065484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1557 | Open in IMG/M |
| 3300006852|Ga0075433_10064136 | All Organisms → cellular organisms → Bacteria | 3220 | Open in IMG/M |
| 3300006854|Ga0075425_100990999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 959 | Open in IMG/M |
| 3300006904|Ga0075424_100465694 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300007076|Ga0075435_101009377 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300007076|Ga0075435_101204067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 663 | Open in IMG/M |
| 3300007258|Ga0099793_10112674 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300007265|Ga0099794_10522598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 626 | Open in IMG/M |
| 3300009012|Ga0066710_101073365 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300009012|Ga0066710_102043426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 847 | Open in IMG/M |
| 3300009012|Ga0066710_103857650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 562 | Open in IMG/M |
| 3300009012|Ga0066710_104712946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300009088|Ga0099830_10613760 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300009089|Ga0099828_10038703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3893 | Open in IMG/M |
| 3300009137|Ga0066709_101197402 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300009137|Ga0066709_101479618 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300009137|Ga0066709_103320725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
| 3300009143|Ga0099792_10689081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 660 | Open in IMG/M |
| 3300009147|Ga0114129_10200598 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300009162|Ga0075423_10831083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 978 | Open in IMG/M |
| 3300010304|Ga0134088_10245371 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300010326|Ga0134065_10044683 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300010326|Ga0134065_10171107 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300010329|Ga0134111_10193241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 820 | Open in IMG/M |
| 3300010329|Ga0134111_10565952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300010335|Ga0134063_10062025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1651 | Open in IMG/M |
| 3300010336|Ga0134071_10319984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 781 | Open in IMG/M |
| 3300010337|Ga0134062_10047220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1743 | Open in IMG/M |
| 3300012096|Ga0137389_10186048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1722 | Open in IMG/M |
| 3300012198|Ga0137364_10003517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 8099 | Open in IMG/M |
| 3300012198|Ga0137364_10734431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 746 | Open in IMG/M |
| 3300012199|Ga0137383_10518809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 872 | Open in IMG/M |
| 3300012201|Ga0137365_10778021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300012203|Ga0137399_10004812 | All Organisms → cellular organisms → Bacteria | 7284 | Open in IMG/M |
| 3300012203|Ga0137399_10032061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3631 | Open in IMG/M |
| 3300012203|Ga0137399_10154898 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
| 3300012207|Ga0137381_10363241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1262 | Open in IMG/M |
| 3300012208|Ga0137376_10001767 | All Organisms → cellular organisms → Bacteria | 12384 | Open in IMG/M |
| 3300012208|Ga0137376_10236518 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300012208|Ga0137376_10340036 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012208|Ga0137376_10549243 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300012209|Ga0137379_10397816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1287 | Open in IMG/M |
| 3300012209|Ga0137379_11060763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 716 | Open in IMG/M |
| 3300012210|Ga0137378_10679190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 940 | Open in IMG/M |
| 3300012349|Ga0137387_10807300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 679 | Open in IMG/M |
| 3300012356|Ga0137371_10547507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 891 | Open in IMG/M |
| 3300012362|Ga0137361_11644823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 562 | Open in IMG/M |
| 3300012685|Ga0137397_10106569 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300012685|Ga0137397_11136790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300012918|Ga0137396_10061931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2596 | Open in IMG/M |
| 3300012922|Ga0137394_10753006 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300012923|Ga0137359_11637944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300012927|Ga0137416_10156979 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300012927|Ga0137416_11727564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 571 | Open in IMG/M |
| 3300012944|Ga0137410_11461666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
| 3300012972|Ga0134077_10520031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300012976|Ga0134076_10111802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1092 | Open in IMG/M |
| 3300014154|Ga0134075_10388840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300014166|Ga0134079_10445285 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300015245|Ga0137409_10046485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4140 | Open in IMG/M |
| 3300015245|Ga0137409_11235580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300015358|Ga0134089_10125233 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300015359|Ga0134085_10079286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1345 | Open in IMG/M |
| 3300017657|Ga0134074_1234766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
| 3300018027|Ga0184605_10022898 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
| 3300018027|Ga0184605_10055612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1692 | Open in IMG/M |
| 3300018027|Ga0184605_10243577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 817 | Open in IMG/M |
| 3300018027|Ga0184605_10542178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300018054|Ga0184621_10110405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 978 | Open in IMG/M |
| 3300018061|Ga0184619_10438996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 584 | Open in IMG/M |
| 3300018071|Ga0184618_10488628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
| 3300018431|Ga0066655_10093251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1670 | Open in IMG/M |
| 3300018433|Ga0066667_10089362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2013 | Open in IMG/M |
| 3300018468|Ga0066662_10176882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1654 | Open in IMG/M |
| 3300019255|Ga0184643_1168327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300019879|Ga0193723_1018930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2119 | Open in IMG/M |
| 3300019885|Ga0193747_1001277 | All Organisms → cellular organisms → Bacteria | 6994 | Open in IMG/M |
| 3300020001|Ga0193731_1028664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1464 | Open in IMG/M |
| 3300020006|Ga0193735_1131478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 670 | Open in IMG/M |
| 3300021078|Ga0210381_10050348 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300022756|Ga0222622_11449764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
| 3300023058|Ga0193714_1036688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 717 | Open in IMG/M |
| 3300024330|Ga0137417_1044373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1283 | Open in IMG/M |
| 3300025910|Ga0207684_10084270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2707 | Open in IMG/M |
| 3300025910|Ga0207684_11356067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
| 3300025922|Ga0207646_10006638 | All Organisms → cellular organisms → Bacteria | 11928 | Open in IMG/M |
| 3300025981|Ga0207640_10057288 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
| 3300026295|Ga0209234_1090162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1160 | Open in IMG/M |
| 3300026296|Ga0209235_1056622 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300026297|Ga0209237_1200541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 641 | Open in IMG/M |
| 3300026300|Ga0209027_1076045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1241 | Open in IMG/M |
| 3300026300|Ga0209027_1118966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 925 | Open in IMG/M |
| 3300026301|Ga0209238_1180833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
| 3300026305|Ga0209688_1002095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 3329 | Open in IMG/M |
| 3300026306|Ga0209468_1117509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 801 | Open in IMG/M |
| 3300026309|Ga0209055_1254831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300026310|Ga0209239_1142635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 964 | Open in IMG/M |
| 3300026315|Ga0209686_1032406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2003 | Open in IMG/M |
| 3300026316|Ga0209155_1029933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2211 | Open in IMG/M |
| 3300026318|Ga0209471_1057537 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300026323|Ga0209472_1110512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1088 | Open in IMG/M |
| 3300026330|Ga0209473_1022826 | All Organisms → cellular organisms → Bacteria | 2902 | Open in IMG/M |
| 3300026330|Ga0209473_1087324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1310 | Open in IMG/M |
| 3300026331|Ga0209267_1032846 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300026530|Ga0209807_1000764 | All Organisms → cellular organisms → Bacteria | 14925 | Open in IMG/M |
| 3300026530|Ga0209807_1012760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 4139 | Open in IMG/M |
| 3300026532|Ga0209160_1170133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 944 | Open in IMG/M |
| 3300026536|Ga0209058_1027418 | All Organisms → cellular organisms → Bacteria | 3584 | Open in IMG/M |
| 3300026547|Ga0209156_10208476 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300026548|Ga0209161_10282135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 829 | Open in IMG/M |
| 3300027587|Ga0209220_1028025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1510 | Open in IMG/M |
| 3300027748|Ga0209689_1351494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
| 3300027862|Ga0209701_10448378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 710 | Open in IMG/M |
| 3300027873|Ga0209814_10043337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1875 | Open in IMG/M |
| 3300027875|Ga0209283_10574065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 718 | Open in IMG/M |
| 3300027882|Ga0209590_10567161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 731 | Open in IMG/M |
| 3300028536|Ga0137415_10845615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 725 | Open in IMG/M |
| 3300028536|Ga0137415_11485477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300028711|Ga0307293_10102508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 908 | Open in IMG/M |
| 3300028715|Ga0307313_10176636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 661 | Open in IMG/M |
| 3300028718|Ga0307307_10007968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2769 | Open in IMG/M |
| 3300028791|Ga0307290_10031246 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300028814|Ga0307302_10413246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
| 3300028828|Ga0307312_10862525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300028881|Ga0307277_10006819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4391 | Open in IMG/M |
| 3300028884|Ga0307308_10026296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2693 | Open in IMG/M |
| 3300028885|Ga0307304_10269456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 745 | Open in IMG/M |
| 3300031720|Ga0307469_10053792 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.15% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.15% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1085788062 | 3300000956 | Soil | MDKGEKLENERDQEQSEGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| A3035W6_10943363 | 3300001359 | Permafrost | MDKGEKLENERGKEQTQGLTDKRRGSPAAPSDKPEGTPPHPQDVNEIAE* |
| A1565W1_115833531 | 3300001536 | Permafrost | MDKGEKLENERGKEQTQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| JGI25384J37096_100767003 | 3300002561 | Grasslands Soil | MARPVRGAWVMDKAEKLDRERDKEQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| JGI25382J43887_103963002 | 3300002908 | Grasslands Soil | KLDRERDKEQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0063455_1008130701 | 3300004153 | Soil | MEKGEKLENERDQEQRQGLSEKRRGSPPAPSDKPEGTPPHP |
| Ga0062591_1001942722 | 3300004643 | Soil | MEKGEKLENEREKEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066674_101554113 | 3300005166 | Soil | KKLENERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066674_104565002 | 3300005166 | Soil | MDKAEKLEQERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066672_101464072 | 3300005167 | Soil | MDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066672_109065612 | 3300005167 | Soil | MDKAKKLEQERDEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG* |
| Ga0066677_100210942 | 3300005171 | Soil | MDKAEKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066683_100595483 | 3300005172 | Soil | MDKAKKLENERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066683_101352753 | 3300005172 | Soil | VARAVRVSQSMDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066680_109496671 | 3300005174 | Soil | MDKAKKLENERDQEQRQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066673_100058716 | 3300005175 | Soil | MDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066679_100188052 | 3300005176 | Soil | MDKAKKLEQERDEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPS* |
| Ga0066679_103153473 | 3300005176 | Soil | MDKAKKLEQERDEEQTEGLTQKRRGSPPAASDRPEGTPPHPQDVNEISEPN* |
| Ga0066688_109537341 | 3300005178 | Soil | RVARAVRVSQSMDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066685_100359982 | 3300005180 | Soil | VRVSQSMDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066685_107429182 | 3300005180 | Soil | MWDGTLRARACLMDKAEKLDRERDKEQSEGLTEKRRGSPAAASDKPEGTPPHPQDVNEISEPS* |
| Ga0066678_101809213 | 3300005181 | Soil | VMDKAKKLENERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066671_100208314 | 3300005184 | Soil | MDKAKKLEQERDEEQDEGLSEKRRGSPPAASDRPEGTPPHPQDVNEISEPG* |
| Ga0066676_102549521 | 3300005186 | Soil | EKLEQERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066676_102994621 | 3300005186 | Soil | GGTRCAQAARMDKAKKLERERDEEQSEGLAESRRGSPPAASDRPEGTPPHPQDVNEISEPR* |
| Ga0066675_102271872 | 3300005187 | Soil | MDKSKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS* |
| Ga0070692_106119241 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKGDKLENERAKEQTQGLTDKRRGSPAAASDKPEGTPPHPQDVNEI |
| Ga0070708_1000640823 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKGEKLENERDKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0070708_1007205342 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKGEKLENEREKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0070708_1010649192 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KKLDNERDEEQREGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066689_105571911 | 3300005447 | Soil | ENERDQEQRQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066682_101770233 | 3300005450 | Soil | MDKAKKLEDERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0066687_100757504 | 3300005454 | Soil | MDKGKKLESERDQEQTQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS* |
| Ga0070706_1014842891 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKGKKLENEREQEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0070707_1010140852 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKAKKLEQERAEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAE* |
| Ga0070697_1008684451 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKGKKLENEREQEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0066697_100484604 | 3300005540 | Soil | PMDKAKKLEQERDEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG* |
| Ga0066697_107819821 | 3300005540 | Soil | AWVMDKAKKLENERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0070695_1000328622 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKGDKLENERAKEQTQGLTDKRRGSPAAASDKPEGTPPHPQDVNEISE* |
| Ga0066700_110756061 | 3300005559 | Soil | MDKAKKLENERDQEQRQGLTEKRRGSPPAASDKPEGTPP |
| Ga0066670_105603882 | 3300005560 | Soil | MDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS* |
| Ga0066703_102212743 | 3300005568 | Soil | MDKAEKLESERAKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0066705_100379632 | 3300005569 | Soil | MDKAEKLENERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066705_100692942 | 3300005569 | Soil | MDKAKKLEQERDDEQREGLTEKRRGSPPAASDRPEGTPPHPQDVNEISERS* |
| Ga0066691_103029852 | 3300005586 | Soil | MDKAKKLEQERDEEQTEGLTQKRRGSPPAASDRPEGTPP |
| Ga0075417_100197383 | 3300006049 | Populus Rhizosphere | MDKSKKLEREREQEQSEGLAEQRRGSPPAASDKPEGTPPHPQDVNEISEPR* |
| Ga0066653_100654844 | 3300006791 | Soil | MDKSKKLENERDQEQSQGLTDKRRGGPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0075433_100641365 | 3300006852 | Populus Rhizosphere | MDKGEKLENERDKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAESR* |
| Ga0075425_1009909991 | 3300006854 | Populus Rhizosphere | MDKAKRLEQERDEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAK* |
| Ga0075424_1004656943 | 3300006904 | Populus Rhizosphere | MDRGEKLENERDKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0075435_1010093772 | 3300007076 | Populus Rhizosphere | MDKGEKLENERAKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0075435_1012040672 | 3300007076 | Populus Rhizosphere | VDKAEKLEQERDEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAE* |
| Ga0099793_101126742 | 3300007258 | Vadose Zone Soil | MDKAEKLENERDKEQSQGLTDKRRGSPPAASDKPEGTPPHPQVVNEIAE* |
| Ga0099794_105225981 | 3300007265 | Vadose Zone Soil | MDKAKKLDQERDEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPS* |
| Ga0066710_1010733653 | 3300009012 | Grasslands Soil | MDKAKKLENERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0066710_1020434262 | 3300009012 | Grasslands Soil | MDKAKKLEQERDDEQREGLTEKRRGSPPAASDRPEGTPPHPQDVNEISERS |
| Ga0066710_1038576502 | 3300009012 | Grasslands Soil | MDKSKKLENERDQEQSQGLTDKRRGGPPAASDKPEGTPPHPQDVNEISEPG |
| Ga0066710_1047129461 | 3300009012 | Grasslands Soil | RRAHDRPMDKAKKLEQERDEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG |
| Ga0099830_106137602 | 3300009088 | Vadose Zone Soil | MDKGEKLQSERDEEQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAD* |
| Ga0099828_100387034 | 3300009089 | Vadose Zone Soil | MDKGEKLQSERDEKQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAD* |
| Ga0066709_1011974023 | 3300009137 | Grasslands Soil | SMDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0066709_1014796183 | 3300009137 | Grasslands Soil | MDKSKKLENERDQEQSQGLTDKRRGGPPAASDKPEGTPPHPQDVNEISEPG* |
| Ga0066709_1033207252 | 3300009137 | Grasslands Soil | RRAHDRPMDKAKKLEQERDEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPS* |
| Ga0099792_106890812 | 3300009143 | Vadose Zone Soil | KLESERDQEKSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0114129_102005984 | 3300009147 | Populus Rhizosphere | MDKGEKLENERDKEQSQGLTDKRRGSPAAASDKPEGKPPHPQDVNEIAE* |
| Ga0075423_108310832 | 3300009162 | Populus Rhizosphere | MDKAKKLEQERDEEQTDGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAE* |
| Ga0134088_102453712 | 3300010304 | Grasslands Soil | MDKAEKLDRERDKEQSEGLTEKRRGSPAAASDKPEGTPPHPQDVNEISEPS* |
| Ga0134065_100446833 | 3300010326 | Grasslands Soil | MDKAKKLEQERDDEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG* |
| Ga0134065_101711072 | 3300010326 | Grasslands Soil | MDKGEKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS* |
| Ga0134111_101932413 | 3300010329 | Grasslands Soil | MDKAKKLENERDQEQSQGLTEKRRGSPPAASDKPEGTPPH |
| Ga0134111_105659522 | 3300010329 | Grasslands Soil | MDKAKKLERERDKEQSEGLAESRRGSPPAASDRPEGTPPHPQDVNEISEPR* |
| Ga0134063_100620252 | 3300010335 | Grasslands Soil | MDKAEKLEQERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAE* |
| Ga0134071_103199841 | 3300010336 | Grasslands Soil | LMDKAEKLDRERDKEQSEGLTGKRRGSPAAASDKPEGTPPHPQDVNEISEPS* |
| Ga0134062_100472203 | 3300010337 | Grasslands Soil | MDKSKKLENERDQEQSQGLTDTRRGGPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0137389_101860483 | 3300012096 | Vadose Zone Soil | MDKAKKLENERDEEQSQGLSDKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0137364_100035174 | 3300012198 | Vadose Zone Soil | MDKAKKLEQERDDEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG* |
| Ga0137364_107344312 | 3300012198 | Vadose Zone Soil | MDKGKKLERERDEEQSEGLTEERRGSPPAASDRPEGTPPHPQDVNEIGES* |
| Ga0137383_105188092 | 3300012199 | Vadose Zone Soil | MDKGEKLKNEREKEQSQGLTDKRRGTPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0137365_107780212 | 3300012201 | Vadose Zone Soil | MDKGDKLENEREKEQTQGLTDKRRGSPAAASDKPEGTPPHPQDVNEISE* |
| Ga0137399_100048123 | 3300012203 | Vadose Zone Soil | MDKGKKLENERAQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0137399_100320613 | 3300012203 | Vadose Zone Soil | MDKAKKLEQERDEEQTEGLTQKRRGSPPAASDRPEGTPPHPQDVNEISEPS* |
| Ga0137399_101548982 | 3300012203 | Vadose Zone Soil | MDKAEKLENERDKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0137381_103632412 | 3300012207 | Vadose Zone Soil | MDKGEKLENEREKEQSQGLTDKRRGSPAAASDKPEGTPLHPQDVNEIAERR* |
| Ga0137376_1000176711 | 3300012208 | Vadose Zone Soil | MDKAKKLEQERDDEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA* |
| Ga0137376_102365183 | 3300012208 | Vadose Zone Soil | MDKAEKLDRERDKEQSEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0137376_103400363 | 3300012208 | Vadose Zone Soil | MDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEP |
| Ga0137376_105492433 | 3300012208 | Vadose Zone Soil | MRRARATVMDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS* |
| Ga0137379_103978162 | 3300012209 | Vadose Zone Soil | MDKGEKLENERDEEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0137379_110607632 | 3300012209 | Vadose Zone Soil | MDKAKKLEQERDEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAE* |
| Ga0137378_106791902 | 3300012210 | Vadose Zone Soil | MDKGEKLENERDEEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEISEPA* |
| Ga0137387_108073001 | 3300012349 | Vadose Zone Soil | MDKGEKLENEREKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAERR* |
| Ga0137371_105475073 | 3300012356 | Vadose Zone Soil | MDKGEKLENERAKEQSQGLTDKRRGTPAAASDKPEGTPPHPQDVNE |
| Ga0137361_116448232 | 3300012362 | Vadose Zone Soil | MDKAEKLEHERDEEQSEGLTEKRRGSPAAASDRPEGTPPHPQDVNEISEPA* |
| Ga0137397_101065693 | 3300012685 | Vadose Zone Soil | MDKGKKLENERDQEQTQGLTEKRRGSPPAASDKPEGTPPHPQDVNEISESG* |
| Ga0137397_111367902 | 3300012685 | Vadose Zone Soil | MDKAEKLESERAKEQSQGLTDKRRGSPAVASDKPEGTPPHPQDVNEIA |
| Ga0137396_100619312 | 3300012918 | Vadose Zone Soil | VDKAKKLEQERDEEQTEGLTQKRRGSPPAASDRPEGTPPHPQDVNEISEPS* |
| Ga0137394_107530062 | 3300012922 | Vadose Zone Soil | MARRVRVPRVMDKGKKLENERDQEQTQGLTEKRRGSPPAASDKPEGTPPHPQDVNEISESG* |
| Ga0137359_116379441 | 3300012923 | Vadose Zone Soil | MDKAEKLEGERATEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPG* |
| Ga0137416_101569791 | 3300012927 | Vadose Zone Soil | MDKAEKLENEREKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE* |
| Ga0137416_117275642 | 3300012927 | Vadose Zone Soil | MDKAKKLEQERDEEQTEGLTEKRRGSPAAASDRPEGTPPHPQDVNEISEPS* |
| Ga0137410_114616662 | 3300012944 | Vadose Zone Soil | MDKGKKLENERAQEQTQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0134077_105200312 | 3300012972 | Grasslands Soil | MDKAKKRESERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0134076_101118023 | 3300012976 | Grasslands Soil | MDKAEKLENERNTEQDQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0134075_103888401 | 3300014154 | Grasslands Soil | MDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQD |
| Ga0134079_104452852 | 3300014166 | Grasslands Soil | MDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDENEISEPS* |
| Ga0137409_100464853 | 3300015245 | Vadose Zone Soil | MDKGKKLENERAQEQTQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE* |
| Ga0137409_112355801 | 3300015245 | Vadose Zone Soil | MDKGEKLQNERDEEQSQGLTEKRRGSPPAPSDRPEGTPPHPQDVNEIAE* |
| Ga0134089_101252333 | 3300015358 | Grasslands Soil | MDKAEKLDRERDKEQSEGLTEKRRGSPAAASDKPEGTPPHPQDVN |
| Ga0134085_100792861 | 3300015359 | Grasslands Soil | MDKAEKLEQERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEI |
| Ga0134074_12347662 | 3300017657 | Grasslands Soil | LERERDEEQSEGLAESRRGSPPAASDRPEGTPPHPQDVNEISEPR |
| Ga0184605_100228982 | 3300018027 | Groundwater Sediment | MDKGKKLERERDEEQSEGLTEERRGSPPAASDRPEGTPPHPQDVNEIGES |
| Ga0184605_100556122 | 3300018027 | Groundwater Sediment | MDKGKKLENERDEEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0184605_102435771 | 3300018027 | Groundwater Sediment | MDKGKKLENEREQEQNQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0184605_105421782 | 3300018027 | Groundwater Sediment | MDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0184621_101104052 | 3300018054 | Groundwater Sediment | MDKGKKLENERDEEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPT |
| Ga0184619_104389962 | 3300018061 | Groundwater Sediment | MDKGKKLENEREQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAESAL |
| Ga0184618_104886282 | 3300018071 | Groundwater Sediment | MDKGKKLERERDEEQSEGLTEERRGSPPAASDRPEGTPPHPQDVNEIGQS |
| Ga0066655_100932513 | 3300018431 | Grasslands Soil | VARAVRVSQSMDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEP |
| Ga0066667_100893622 | 3300018433 | Grasslands Soil | MDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA |
| Ga0066662_101768822 | 3300018468 | Grasslands Soil | MDKAEKLEHERDEEQSEGLTEKRRGSPAAASDRPEGTPPHPQDVNEISEPA |
| Ga0184643_11683272 | 3300019255 | Groundwater Sediment | MDKGKKLENERDEEQSQGLTDKRRGSPPAASDKPE |
| Ga0193723_10189301 | 3300019879 | Soil | MDKGEKLENERDKEQSQGLTDKRRGSPAAPSDKPEGTPPHPQDVNEIAE |
| Ga0193747_100127711 | 3300019885 | Soil | MWDGTRRARATVMDKGKNLENERDQEQKQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS |
| Ga0193731_10286642 | 3300020001 | Soil | MDKGKNLENERDQEQKQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS |
| Ga0193735_11314782 | 3300020006 | Soil | WMWDGTRRARATVMDKGKNLENERDQEQKQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS |
| Ga0210381_100503482 | 3300021078 | Groundwater Sediment | MDKDKKLENERDEEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0222622_114497641 | 3300022756 | Groundwater Sediment | GVMDKGKKLENERDEEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPT |
| Ga0193714_10366882 | 3300023058 | Soil | MDKGDKLENEREKEQTQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0137417_10443733 | 3300024330 | Vadose Zone Soil | MDKGKKLENERAQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0207684_100842702 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKAKKLEQERAEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAE |
| Ga0207684_113560671 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TKKLEQEREEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEIAE |
| Ga0207646_1000663812 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRARALLMDKGEKLENERDKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0207640_100572884 | 3300025981 | Corn Rhizosphere | MDKGDKLENERAKEQTQGLTDKRRGSPAAASDKPEGTPPHPQDVNEISE |
| Ga0209234_10901622 | 3300026295 | Grasslands Soil | MDKAKKLEQERDEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPS |
| Ga0209235_10566222 | 3300026296 | Grasslands Soil | MARPVRGAWVMDKAEKLDRERDKEQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0209237_12005412 | 3300026297 | Grasslands Soil | MDKAEKLDRERDKEQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0209027_10760452 | 3300026300 | Grasslands Soil | MDKAKKLEQERVEEQTEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPS |
| Ga0209027_11189663 | 3300026300 | Grasslands Soil | MDKAEKLESERAKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0209238_11808332 | 3300026301 | Grasslands Soil | MDKAKKLESERAKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0209688_10020955 | 3300026305 | Soil | MDKAKKLEQERDEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG |
| Ga0209468_11175092 | 3300026306 | Soil | MDKAKKLEDERDQEQSQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0209055_12548311 | 3300026309 | Soil | SQSMDKAKKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA |
| Ga0209239_11426352 | 3300026310 | Grasslands Soil | MDKSKKLENERDQEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| Ga0209686_10324062 | 3300026315 | Soil | MDKAEKLEHERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA |
| Ga0209155_10299331 | 3300026316 | Soil | KLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0209471_10575371 | 3300026318 | Soil | ARQRFMDKAKKLEQERDEEQTEGLTQKRRGSPPAASDRPEGTPPHPQDVNEISEPN |
| Ga0209472_11105123 | 3300026323 | Soil | MDKAEKLEQERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA |
| Ga0209473_10228265 | 3300026330 | Soil | GTRRAHDRPMDKAKKLEHERDEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG |
| Ga0209473_10873241 | 3300026330 | Soil | MDKAKKLEQERDEEQDEGLTEKRRGSPPAASDRPEGTPPHP |
| Ga0209267_10328461 | 3300026331 | Soil | MDKAKKLEQERNEEQDEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPG |
| Ga0209807_10007649 | 3300026530 | Soil | MDKAEKLENERDEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA |
| Ga0209807_10127602 | 3300026530 | Soil | MDKAKKLEQERDEEQDEGLTEKRRASPPAASDRPEGTPPHPQDVNEISEPG |
| Ga0209160_11701331 | 3300026532 | Soil | MDKAKKLEHEREEEQSEGLTEKRRGSPPAASDRPEGTPPHPQDVNEISEPA |
| Ga0209058_10274186 | 3300026536 | Soil | MWDGTLRARACLMDKAEKLDRERDKEQSEGLTEKRRGSPAAASDKPEGTPPHPQDVNEISEPS |
| Ga0209156_102084762 | 3300026547 | Soil | MDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS |
| Ga0209161_102821351 | 3300026548 | Soil | SCGTRRARQPFMDKAKKLEQERDDEQREGLTEKRRGSPPAASDRPEGTPPHPQDVNEISERS |
| Ga0209220_10280253 | 3300027587 | Forest Soil | MDKGEKLENEREKEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0209689_13514942 | 3300027748 | Soil | MDKAKKLENERDQEQRQGLTEKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0209701_104483782 | 3300027862 | Vadose Zone Soil | MDKGEKLQSERDEEQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAD |
| Ga0209814_100433372 | 3300027873 | Populus Rhizosphere | MDKSKKLEREREQEQSEGLAEQRRGSPPAASDKPEGTPPHPQDVNEISEPR |
| Ga0209283_105740652 | 3300027875 | Vadose Zone Soil | MDKGEKLQSERDEKQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAD |
| Ga0209590_105671612 | 3300027882 | Vadose Zone Soil | MDKGEKLENERDKEQSQGLTDKRRGSPAAASDKPEGTPPHPQDVNEISE |
| Ga0137415_108456152 | 3300028536 | Vadose Zone Soil | MDKAKKLEQERDEEQTEGLTQKRRGSPPAASDRPEGTPPHPQDVNEISEPS |
| Ga0137415_114854771 | 3300028536 | Vadose Zone Soil | AFMDKAKKLEQERDEEQTDGLTEKRRGSPAAASDRPEGTPPHPQDVNEISEPS |
| Ga0307293_101025082 | 3300028711 | Soil | MDKGKKLENERDQEQTQGLTEKRRGSPPAASDKPEGTPPHPQDVNEISEPS |
| Ga0307313_101766362 | 3300028715 | Soil | MDKGKKLENEREQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0307307_100079682 | 3300028718 | Soil | MDKGKKLENERDQEQKQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPS |
| Ga0307290_100312464 | 3300028791 | Soil | MDKDKKLENERDDEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAE |
| Ga0307302_104132462 | 3300028814 | Soil | SGGTRRARDGVMDKGKKLENERDEEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEISEPT |
| Ga0307312_108625251 | 3300028828 | Soil | RALACGMDKAEKLENERDKEQTQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAEKD |
| Ga0307277_100068196 | 3300028881 | Soil | MDKGKKLENERDQEQSQGLTDKRRGSPPAASDKPEGTPPHPQDVNEIAEGR |
| Ga0307308_100262961 | 3300028884 | Soil | MDKGKKLENERDQEQKQGLTDKRRGSPPAASDKPEGTPP |
| Ga0307304_102694561 | 3300028885 | Soil | MDKGKKLENERDQEQKQGLTDKRRGSPPAASDKPEGTPPHPQD |
| Ga0307469_100537924 | 3300031720 | Hardwood Forest Soil | MRRARIRVMDKAEKLDRERDKEQTEGLTEKRRGSPAAASDKPEGTPPHPQDVNEIAE |
| ⦗Top⦘ |