NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034741

Metagenome / Metatranscriptome Family F034741

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034741
Family Type Metagenome / Metatranscriptome
Number of Sequences 174
Average Sequence Length 41 residues
Representative Sequence TQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Number of Associated Samples 133
Number of Associated Scaffolds 174

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 1.15 %
% of genes near scaffold ends (potentially truncated) 41.95 %
% of genes from short scaffolds (< 2000 bps) 71.84 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (51.724 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(16.092 % of family members)
Environment Ontology (ENVO) Unclassified
(25.862 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.230 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.85%    β-sheet: 0.00%    Coil/Unstructured: 66.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 174 Family Scaffolds
PF01814Hemerythrin 5.75
PF07040DUF1326 3.45
PF14947HTH_45 2.87
PF01436NHL 2.30
PF00850Hist_deacetyl 2.30
PF00296Bac_luciferase 2.30
PF02518HATPase_c 1.15
PF01391Collagen 1.15
PF05899Cupin_3 1.15
PF00127Copper-bind 1.15
PF12680SnoaL_2 1.15
PF00582Usp 1.15
PF00072Response_reg 1.15
PF05638T6SS_HCP 0.57
PF14534DUF4440 0.57
PF01022HTH_5 0.57
PF05559DUF763 0.57
PF13424TPR_12 0.57
PF09859Oxygenase-NA 0.57
PF13649Methyltransf_25 0.57
PF00413Peptidase_M10 0.57
PF08241Methyltransf_11 0.57
PF14059DUF4251 0.57
PF08240ADH_N 0.57
PF00171Aldedh 0.57
PF07366SnoaL 0.57
PF01928CYTH 0.57
PF07995GSDH 0.57
PF06348DUF1059 0.57
PF10069DICT 0.57
PF17159MASE3 0.57
PF00211Guanylate_cyc 0.57
PF08327AHSA1 0.57
PF05496RuvB_N 0.57
PF04895Nre_C 0.57
PF00011HSP20 0.57
PF04457MJ1316 0.57
PF00732GMC_oxred_N 0.57
PF13412HTH_24 0.57
PF00149Metallophos 0.57
PF07452CHRD 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 174 Family Scaffolds
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 4.60
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 3.45
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.30
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.57
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.57
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.57
COG1415Uncharacterized conserved protein, DUF763 domainFunction unknown [S] 0.57
COG1531Uncharacterized conserved protein, UPF0248 familyFunction unknown [S] 0.57
COG1602Archaeal DNA repair protein NreAReplication, recombination and repair [L] 0.57
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.57
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.57
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.57
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.57
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.57
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.57
COG5549Predicted Zn-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms56.32 %
UnclassifiedrootN/A43.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886007|SwRhRL2b_contig_317263All Organisms → cellular organisms → Archaea1254Open in IMG/M
2162886007|SwRhRL2b_contig_612750All Organisms → cellular organisms → Archaea822Open in IMG/M
2228664021|ICCgaii200_c0228975Not Available560Open in IMG/M
3300000044|ARSoilOldRDRAFT_c002510Not Available1613Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104636691Not Available724Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10002422All Organisms → cellular organisms → Archaea4943Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10016618Not Available2021Open in IMG/M
3300000787|JGI11643J11755_11432229Not Available986Open in IMG/M
3300000787|JGI11643J11755_11456906Not Available585Open in IMG/M
3300001538|A10PFW1_10197141All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1514Open in IMG/M
3300002568|C688J35102_118581117Not Available574Open in IMG/M
3300002568|C688J35102_120833204All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1739Open in IMG/M
3300003911|JGI25405J52794_10025652All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1209Open in IMG/M
3300003987|Ga0055471_10003546All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon2832Open in IMG/M
3300003987|Ga0055471_10207710Not Available613Open in IMG/M
3300004081|Ga0063454_101986969Not Available514Open in IMG/M
3300004114|Ga0062593_100978266Not Available865Open in IMG/M
3300004145|Ga0055489_10266349All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis546Open in IMG/M
3300004153|Ga0063455_100062871All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1342Open in IMG/M
3300005161|Ga0066807_1005369All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1088Open in IMG/M
3300005289|Ga0065704_10540383All Organisms → cellular organisms → Archaea641Open in IMG/M
3300005294|Ga0065705_10062967All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis594Open in IMG/M
3300005328|Ga0070676_10013871All Organisms → cellular organisms → Archaea4421Open in IMG/M
3300005441|Ga0070700_100366946All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1072Open in IMG/M
3300005441|Ga0070700_101422270Not Available587Open in IMG/M
3300005444|Ga0070694_101595475Not Available554Open in IMG/M
3300005518|Ga0070699_101849814Not Available552Open in IMG/M
3300005614|Ga0068856_102508480All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis522Open in IMG/M
3300005616|Ga0068852_100222089Not Available1797Open in IMG/M
3300005896|Ga0075282_1006428All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1334Open in IMG/M
3300006049|Ga0075417_10162957All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1042Open in IMG/M
3300006163|Ga0070715_10056176All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis1712Open in IMG/M
3300006806|Ga0079220_10073992All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1688Open in IMG/M
3300006844|Ga0075428_100047579All Organisms → cellular organisms → Archaea → TACK group4710Open in IMG/M
3300006844|Ga0075428_100433913All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1407Open in IMG/M
3300006844|Ga0075428_101239288Not Available786Open in IMG/M
3300006845|Ga0075421_100196096All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera2502Open in IMG/M
3300006845|Ga0075421_100402931All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon1642Open in IMG/M
3300006845|Ga0075421_100428811All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1583Open in IMG/M
3300006845|Ga0075421_101005158All Organisms → cellular organisms → Archaea944Open in IMG/M
3300006846|Ga0075430_100552853Not Available949Open in IMG/M
3300006847|Ga0075431_100851909All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis883Open in IMG/M
3300006847|Ga0075431_101848509Not Available560Open in IMG/M
3300006871|Ga0075434_100025503Not Available5784Open in IMG/M
3300006871|Ga0075434_100119414Not Available2650Open in IMG/M
3300006880|Ga0075429_100503259All Organisms → cellular organisms → Archaea1062Open in IMG/M
3300006904|Ga0075424_100485171Not Available1320Open in IMG/M
3300006904|Ga0075424_101203135All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota806Open in IMG/M
3300006969|Ga0075419_10079681All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota2083Open in IMG/M
3300006969|Ga0075419_10701996All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis717Open in IMG/M
3300006969|Ga0075419_11402697All Organisms → cellular organisms → Archaea521Open in IMG/M
3300007004|Ga0079218_11607319All Organisms → cellular organisms → Archaea713Open in IMG/M
3300007076|Ga0075435_100097451All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota2434Open in IMG/M
3300009094|Ga0111539_10216951Not Available2228Open in IMG/M
3300009094|Ga0111539_12295463Not Available626Open in IMG/M
3300009094|Ga0111539_12439607Not Available607Open in IMG/M
3300009147|Ga0114129_10197132Not Available2730Open in IMG/M
3300009156|Ga0111538_10212117All Organisms → cellular organisms → Archaea2455Open in IMG/M
3300009156|Ga0111538_11602472All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300009789|Ga0126307_10013019All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon6111Open in IMG/M
3300009789|Ga0126307_10019061All Organisms → cellular organisms → Archaea5153Open in IMG/M
3300009789|Ga0126307_10057824All Organisms → cellular organisms → Archaea3039Open in IMG/M
3300009789|Ga0126307_10124980All Organisms → cellular organisms → Archaea2051Open in IMG/M
3300009801|Ga0105056_1012615All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera968Open in IMG/M
3300009803|Ga0105065_1051258All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera588Open in IMG/M
3300009811|Ga0105084_1008985Not Available1503Open in IMG/M
3300010036|Ga0126305_10031226All Organisms → cellular organisms → Archaea2906Open in IMG/M
3300010036|Ga0126305_10038087All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon2666Open in IMG/M
3300010036|Ga0126305_10965431Not Available583Open in IMG/M
3300010037|Ga0126304_10040150All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon2803Open in IMG/M
3300010037|Ga0126304_10060811All Organisms → cellular organisms → Archaea2316Open in IMG/M
3300010039|Ga0126309_10273563Not Available966Open in IMG/M
3300010040|Ga0126308_10053566Not Available2352Open in IMG/M
3300010040|Ga0126308_10346105Not Available984Open in IMG/M
3300010040|Ga0126308_10389747Not Available928Open in IMG/M
3300010041|Ga0126312_10298527All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300010042|Ga0126314_10042832All Organisms → cellular organisms → Archaea2900Open in IMG/M
3300010042|Ga0126314_10063481All Organisms → cellular organisms → Archaea2435Open in IMG/M
3300010044|Ga0126310_10027976All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium2924Open in IMG/M
3300010358|Ga0126370_10000267All Organisms → cellular organisms → Archaea20333Open in IMG/M
3300010362|Ga0126377_10421210All Organisms → cellular organisms → Archaea1351Open in IMG/M
3300010362|Ga0126377_10813895Not Available993Open in IMG/M
3300010371|Ga0134125_10651747All Organisms → cellular organisms → Archaea1162Open in IMG/M
3300010371|Ga0134125_12072643Not Available618Open in IMG/M
3300010397|Ga0134124_10242140All Organisms → cellular organisms → Archaea1656Open in IMG/M
3300012189|Ga0137388_10488609All Organisms → cellular organisms → Archaea1143Open in IMG/M
3300012469|Ga0150984_121340364Not Available806Open in IMG/M
3300012490|Ga0157322_1016905Not Available664Open in IMG/M
3300012505|Ga0157339_1000899Not Available1662Open in IMG/M
3300012517|Ga0157354_1002562Not Available1389Open in IMG/M
3300012900|Ga0157292_10418545Not Available511Open in IMG/M
3300012951|Ga0164300_10247052All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.904Open in IMG/M
3300012957|Ga0164303_10434191All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.821Open in IMG/M
3300012961|Ga0164302_11091876All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300012987|Ga0164307_10206170All Organisms → cellular organisms → Archaea1342Open in IMG/M
3300012987|Ga0164307_10743644Not Available773Open in IMG/M
3300012989|Ga0164305_11970057Not Available532Open in IMG/M
3300013102|Ga0157371_10780992Not Available719Open in IMG/M
3300013104|Ga0157370_11991096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni521Open in IMG/M
3300014263|Ga0075324_1129261Not Available567Open in IMG/M
3300014270|Ga0075325_1006001Not Available1987Open in IMG/M
3300014311|Ga0075322_1011657All Organisms → cellular organisms → Archaea1710Open in IMG/M
3300014311|Ga0075322_1111330Not Available647Open in IMG/M
3300015371|Ga0132258_11585059All Organisms → cellular organisms → Archaea1653Open in IMG/M
3300015372|Ga0132256_102054669All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae677Open in IMG/M
3300015374|Ga0132255_103108485All Organisms → cellular organisms → Archaea708Open in IMG/M
3300018000|Ga0184604_10000292All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus4993Open in IMG/M
3300018051|Ga0184620_10006920All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae2435Open in IMG/M
3300018051|Ga0184620_10205000Not Available657Open in IMG/M
3300018053|Ga0184626_10234630All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon772Open in IMG/M
3300018063|Ga0184637_10678222Not Available567Open in IMG/M
3300018067|Ga0184611_1020523Not Available2030Open in IMG/M
3300018077|Ga0184633_10452946Not Available633Open in IMG/M
3300018422|Ga0190265_10153178Not Available2258Open in IMG/M
3300018432|Ga0190275_11365442Not Available785Open in IMG/M
3300018465|Ga0190269_11509515Not Available554Open in IMG/M
3300018469|Ga0190270_10023354All Organisms → cellular organisms → Archaea3877Open in IMG/M
3300018481|Ga0190271_10030561Not Available4334Open in IMG/M
3300019356|Ga0173481_10075365All Organisms → cellular organisms → Archaea1233Open in IMG/M
3300019356|Ga0173481_10086413Not Available1173Open in IMG/M
3300019869|Ga0193705_1020530All Organisms → cellular organisms → Archaea1437Open in IMG/M
3300019881|Ga0193707_1201628All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis507Open in IMG/M
3300020069|Ga0197907_11172005Not Available590Open in IMG/M
3300020077|Ga0206351_10438100Not Available510Open in IMG/M
3300021362|Ga0213882_10174977All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS883Open in IMG/M
3300024055|Ga0247794_10324925All Organisms → cellular organisms → Archaea522Open in IMG/M
3300025315|Ga0207697_10003644All Organisms → cellular organisms → Archaea7550Open in IMG/M
3300025537|Ga0210061_1000498All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon5754Open in IMG/M
3300025537|Ga0210061_1000743All Organisms → cellular organisms → Archaea4940Open in IMG/M
3300025559|Ga0210087_1060337Not Available756Open in IMG/M
3300025567|Ga0210076_1002402All Organisms → cellular organisms → Archaea4560Open in IMG/M
3300025567|Ga0210076_1009166Not Available2145Open in IMG/M
3300025567|Ga0210076_1078523Not Available721Open in IMG/M
3300025792|Ga0210143_1005450All Organisms → cellular organisms → Archaea2488Open in IMG/M
3300025795|Ga0210114_1003874All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon3682Open in IMG/M
3300025901|Ga0207688_10019801All Organisms → cellular organisms → Archaea3669Open in IMG/M
3300025904|Ga0207647_10245528All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300025907|Ga0207645_10007458All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis7724Open in IMG/M
3300025932|Ga0207690_11421271Not Available580Open in IMG/M
3300025932|Ga0207690_11514218All Organisms → cellular organisms → Archaea561Open in IMG/M
3300025961|Ga0207712_12002551Not Available518Open in IMG/M
3300025981|Ga0207640_10137862Not Available1774Open in IMG/M
3300026535|Ga0256867_10022374All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon2691Open in IMG/M
3300027056|Ga0209879_1005137All Organisms → Viruses → Predicted Viral1994Open in IMG/M
3300027360|Ga0209969_1000163All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae8820Open in IMG/M
3300027384|Ga0209854_1061877Not Available653Open in IMG/M
3300027462|Ga0210000_1028546Not Available869Open in IMG/M
3300027511|Ga0209843_1008854All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus2186Open in IMG/M
3300027647|Ga0214468_1006489All Organisms → cellular organisms → Archaea3473Open in IMG/M
3300027650|Ga0256866_1000615All Organisms → cellular organisms → Archaea8371Open in IMG/M
3300027717|Ga0209998_10013792All Organisms → cellular organisms → Archaea1684Open in IMG/M
3300027907|Ga0207428_10197660Not Available1513Open in IMG/M
3300027909|Ga0209382_10284315Not Available1869Open in IMG/M
3300027948|Ga0209858_1021390Not Available583Open in IMG/M
3300031093|Ga0308197_10204943All Organisms → cellular organisms → Archaea673Open in IMG/M
3300031229|Ga0299913_10102612All Organisms → cellular organisms → Archaea2793Open in IMG/M
3300031547|Ga0310887_10020273All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon2625Open in IMG/M
3300031731|Ga0307405_11712259Not Available557Open in IMG/M
3300031824|Ga0307413_10327967All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1172Open in IMG/M
3300031852|Ga0307410_10204047Not Available1511Open in IMG/M
3300031852|Ga0307410_10635455Not Available894Open in IMG/M
3300031858|Ga0310892_10404899Not Available889Open in IMG/M
3300031911|Ga0307412_10788734All Organisms → cellular organisms → Archaea824Open in IMG/M
3300031911|Ga0307412_11302805Not Available654Open in IMG/M
3300031913|Ga0310891_10045950Not Available1208Open in IMG/M
3300031995|Ga0307409_100215580All Organisms → cellular organisms → Archaea1729Open in IMG/M
3300031996|Ga0308176_10209423All Organisms → Viruses → Predicted Viral1840Open in IMG/M
3300032000|Ga0310903_10607569Not Available583Open in IMG/M
3300032002|Ga0307416_103004619Not Available564Open in IMG/M
3300032004|Ga0307414_10317775Not Available1324Open in IMG/M
3300032013|Ga0310906_10107181All Organisms → cellular organisms → Archaea1546Open in IMG/M
3300032013|Ga0310906_11242655Not Available543Open in IMG/M
3300032180|Ga0307471_100001135All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis14367Open in IMG/M
3300034090|Ga0326723_0336243Not Available680Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil9.77%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands6.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.02%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.02%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.30%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.30%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.30%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.15%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.15%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.15%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.15%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.15%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.15%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.15%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.15%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.57%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.57%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.57%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.57%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.57%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.57%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000044Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil oldHost-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012490Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610Host-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014263Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1EnvironmentalOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027360Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027647Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeqEnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027948Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL2b_0009.000013102162886007Switchgrass RhizosphereMNFEDKQHLENHKKVHGRKSKVYEYGDPEFTKDRLRG
SwRhRL2b_0943.000030302162886007Switchgrass RhizosphereMNFEEKRHLENHKKVHGRKSKVYEYGDPEFTKDRLRG
ICCgaii200_022897512228664021SoilVCGLIFGEEKRYQIHKKVHGRKPKISEYGSPEFNQD
ARSoilOldRDRAFT_00251013300000044Arabidopsis RhizosphereEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
INPhiseqgaiiFebDRAFT_10463669123300000364SoilMQDMGLQFEEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
AF_2010_repII_A1DRAFT_1000242273300000597Forest SoilMEFPDSRHLENHKKVHGRKPKISEYGDPEFSKDRLR*
AF_2010_repII_A1DRAFT_1001661843300000597Forest SoilMEFADEKHLKNHKKVHGRKPKIREYGDPEFSKDRLRG*
JGI11643J11755_1143222933300000787SoilLIFGEEKRYQIHKKVHGRKPKISEYGSPEFSQDRLRG*
JGI11643J11755_1145690613300000787SoilRPLAFKCKVCGLIFGEEKRYQIHKKVHGRKPKISEYGSPEFNQDRLRG*
A10PFW1_1019714123300001538PermafrostMQFEDKEHFEIHKTVHGRKSKVSEYGSPEFSQDRLRG*
C688J35102_11858111723300002568SoilTCGLQFEEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
C688J35102_12083320413300002568SoilMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLR
JGI25405J52794_1002565213300003911Tabebuia Heterophylla RhizosphereMVFRCSKCGSVFEEKRRLEIHKQTHDRKSKIREYGSPEFSQDSLRG*
Ga0055471_1000354613300003987Natural And Restored WetlandsMASLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0055471_1020771013300003987Natural And Restored WetlandsMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSSEFNQDRLRG*
Ga0063454_10198696923300004081SoilFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0062593_10097826633300004114SoilMCGLQFEEKKRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
Ga0055489_1026634913300004145Natural And Restored WetlandsMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSSEFNQDRLRG*
Ga0063455_10006287113300004153SoilMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0066807_100536913300005161SoilLTFKCKISGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0065704_1054038323300005289Switchgrass RhizosphereLTFKCKICGSQFEEKERLGIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0065705_1006296713300005294Switchgrass RhizosphereLTFKCKICGSQFEEKERLDIHKKVHGXKAKISEYGSPEFNQDRLRG*
Ga0070676_1001387123300005328Miscanthus RhizosphereMLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDMLRG*
Ga0070700_10036694613300005441Corn, Switchgrass And Miscanthus RhizosphereMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDR
Ga0070700_10142227013300005441Corn, Switchgrass And Miscanthus RhizosphereMLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0070694_10159547523300005444Corn, Switchgrass And Miscanthus RhizosphereLTFKCKICGSQFEEKERLQIHKKVHGRKAQISEYGSPEFNQDRLRG*
Ga0070699_10184981423300005518Corn, Switchgrass And Miscanthus RhizosphereKTCGLQFDEKRRLEIHKQVHGRKSKVSEYGSPEFSQDRLRG*
Ga0068856_10250848013300005614Corn RhizosphereCKKCNLEFEEKNRLEIHKKVHGRKSKVSEYGSPEFNQDRLRG*
Ga0068852_10022208933300005616Corn RhizosphereMKFEDPRRLENHKKVHGRKSKVSEYGDPEFNIDRLRG*
Ga0075282_100642833300005896Rice Paddy SoilMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFN
Ga0075417_1016295713300006049Populus RhizosphereLTFKCKICGSQFEEKERLDIHKNVHGRKAKISEYGSPEFNQDRLEAN
Ga0070715_1005617623300006163Corn, Switchgrass And Miscanthus RhizosphereMQKEFSDTKHLENHKKVHGRKPKVSEYGDPEFSKDRLR*
Ga0079220_1007399223300006806Agricultural SoilMPFKCKECGTQFEEKRRLEIHKKLHGRKSKISEYGSPEFNQDRLRG*
Ga0075428_10004757933300006844Populus RhizosphereMNFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075428_10043391333300006844Populus RhizosphereMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG*
Ga0075428_10123928813300006844Populus RhizosphereFEEKERLDIHKKVHGRKAKISEYGSPEFNQNRLRG*
Ga0075421_10019609633300006845Populus RhizosphereCGLKFEEKKRLEIHKQVHGRKPKVTEYGSSEFSQDRLRG*
Ga0075421_10040293123300006845Populus RhizosphereMNFEEKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075421_10042881133300006845Populus RhizosphereMQDIGLDFEEKKRLEIHKQVHDRKLKVAEYGSPEFSQDRLRG*
Ga0075421_10100515823300006845Populus RhizosphereLTLKCKICGSQFEEKERLDIHKKVHGRKAKISEYGSTEFNQDRLRG*
Ga0075430_10055285323300006846Populus RhizosphereMNFEDKRRLENHKKVHGRKSKVSEYGNSEFNIDRLRG*
Ga0075431_10085190913300006847Populus RhizosphereMQDIGLKFEEKKRLEIHKQVHGRKPKVTEYGSPEFSQDRLRG*
Ga0075431_10184850923300006847Populus RhizosphereMLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFN
Ga0075434_10002550373300006871Populus RhizospherePISMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0075434_10011941423300006871Populus RhizosphereMLSFKCKICGSQFEEKERLDIHKKVHGGKAKISEYGSPEFNQDRLRG*
Ga0075429_10050325923300006880Populus RhizosphereLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYGSTEFNQDRLRG*
Ga0075424_10048517113300006904Populus RhizosphereFEEKERLDIHKKVHGGKAKISEYGSPEFNQDRLRG*
Ga0075424_10120313513300006904Populus RhizosphereSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRC*
Ga0075419_1007968113300006969Populus RhizosphereKCKICGSQFEEKERLDIHKKVHGRKAKIREYGSPEFNQDRLRG*
Ga0075419_1070199623300006969Populus RhizosphereCGSQFEEKERLDIHKNVHGRKAKISEYGSPEFNQDRLRG*
Ga0075419_1140269723300006969Populus RhizosphereLTFKCKICGSQFEEKERLDIHKNVHGRKAKISEYGSPEF
Ga0079218_1160731923300007004Agricultural SoilMNFEDKKRLENHKKVHGRKSKVSEYGNPEFNIDRLRG*
Ga0075435_10009745143300007076Populus RhizosphereLTFKCKICGSQFEEKERFDIHKKVHGRKAKIREYGSPEFNQDRLRG*
Ga0111539_1021695123300009094Populus RhizosphereMNFEDKRRLENYKKVHKRKSKVSEYGDSEFNIDRLRG*
Ga0111539_1229546313300009094Populus RhizosphereRMVQFFKCKVRGLQFEEEKRLKIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0111539_1243960713300009094Populus RhizosphereMTFEEKNRLEVHKKVHGRKSKVSEYGSPEFNQDRLRG*
Ga0114129_1019713233300009147Populus RhizosphereMNFEDKRRLKNHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0111538_1021211733300009156Populus RhizosphereMKFEDPRRLENHKKVHGRKSKVSEYGDPEFSIDRLKG*
Ga0111538_1160247213300009156Populus RhizosphereKCKICNMKFEDPRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0126307_1001301943300009789Serpentine SoilMNFEDKQHLEYHKKIHGRKSKLYEYGDPEFSKDRLRG*
Ga0126307_1001906133300009789Serpentine SoilMNFEDKRRSENHKKVHGRKSKVSEYGNPEFNIDRLRG*
Ga0126307_1005782423300009789Serpentine SoilMNFEDKQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG*
Ga0126307_1012498013300009789Serpentine SoilMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG*
Ga0105056_101261523300009801Groundwater SandMEFENKDRLERHRKVHGRKSKVSEAGTMDFNQVGF*
Ga0105065_105125823300009803Groundwater SandMEFEDKERFERHKKVHGRKSKISEAGAMDFSQVGF*
Ga0105084_100898513300009811Groundwater SandKCKVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0126305_1003122613300010036Serpentine SoilMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNLDRLRG*
Ga0126305_1003808723300010036Serpentine SoilMNFEDKQHLENHKKLHGRKSKVYEYGDPEFNKDRLRG*
Ga0126305_1096543123300010036Serpentine SoilMNFEDKRRLENHKKVHGRTSKVSEYGDPEFNKDRLRG*
Ga0126304_1004015043300010037Serpentine SoilMNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG*
Ga0126304_1006081123300010037Serpentine SoilMNFEDRQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG*
Ga0126309_1027356313300010039Serpentine SoilMGFKCKKCNLQFEEERRLEIHKKVHDRKSKVSEYGSPVFNDDRLRGG*
Ga0126308_1005356623300010040Serpentine SoilMNFEDKRRLENHKKVHGRKSKVSEYGDPEFNKDRLRG*
Ga0126308_1034610513300010040Serpentine SoilMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRD*
Ga0126308_1038974713300010040Serpentine SoilMASFKCKICNMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG*
Ga0126312_1029852733300010041Serpentine SoilMNFEDKRHLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0126314_1004283233300010042Serpentine SoilMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIERLRD*
Ga0126314_1006348133300010042Serpentine SoilMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLIG*
Ga0126310_1002797633300010044Serpentine SoilMNFEDKRHLENHKKVHGRKPKVYEYGDPEFNKDRLRG*
Ga0126370_1000026793300010358Tropical Forest SoilMVFKCKECGTEFEEKRRLEIHKKVHGRKSKVREYGSPEFNQDRLRG*
Ga0126377_1042121023300010362Tropical Forest SoilEEKRRLEIHKKVHGRKSKVREYGSPEFNQDRLRG*
Ga0126377_1081389513300010362Tropical Forest SoilTFEDEKRLQIHKRVHGRKPKIREYGSPEFSQDRLRG*
Ga0134125_1065174723300010371Terrestrial SoilEEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
Ga0134125_1207264313300010371Terrestrial SoilVCGTLFVEKRRLEVHKKVHRRKPKIREYGSPEFNQDRLRG*
Ga0134124_1024214013300010397Terrestrial SoilMPFKCKECGTQFEEERRLEIHKKVHGRKSKIREYGSPEFNQDRLRG*
Ga0137388_1048860933300012189Vadose Zone SoilDEKRRLEIQKQVHGRKSKVSEYGSPEFSQDRLRG*
Ga0150984_12134036413300012469Avena Fatua RhizosphereCKKCNLEFEEKKRLEIHKNVHGRKSKVSEYGSPEFNQDRLRG*
Ga0157322_101690513300012490Arabidopsis RhizosphereTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0157339_100089913300012505Arabidopsis RhizosphereQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0157354_100256233300012517Unplanted SoilEEKERLDIHKKVHGRKAKISEYGSPEFYQDRLRG*
Ga0157292_1041854513300012900SoilLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYGS
Ga0164300_1024705213300012951SoilLALKCKKCNLEFEEKKRREIHKNVHDRKSKVYEYGSPEFKDDRLRAG*
Ga0164303_1043419123300012957SoilLALKCKKCNLEFEEKKRREIHKNVHDRKSKVYEYGSPEFNDDRLRAG*
Ga0164302_1109187623300012961SoilCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0164307_1020617023300012987SoilFEEEKRLQIHKKVHGRKPKISEYESPEFSQDRLRG*
Ga0164307_1074364423300012987SoilLALKCKKCNLEFEEKKRREIHENVHDRKSKVYEYGSPEFNNDRLRAG*
Ga0164305_1197005713300012989SoilVLVHKCKVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0157371_1078099213300013102Corn RhizosphereMPFKCKECGTQFEEKRRLEIHKKVHGRKSKIREYGSPEFNQDRLRG*
Ga0157370_1199109613300013104Corn RhizosphereMLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEY
Ga0075324_112926113300014263Natural And Restored WetlandsMASLKCKLYNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075325_100600133300014270Natural And Restored WetlandsMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSPEFNQDRLRG*
Ga0075322_101165723300014311Natural And Restored WetlandsMVSFKCKIYNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075322_111133013300014311Natural And Restored WetlandsMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSS
Ga0132258_1158505933300015371Arabidopsis RhizosphereMNFEDEIRLENHKKVHGRKSKVAEYGDSEFNIDRLRG*
Ga0132256_10205466923300015372Arabidopsis RhizosphereFSFLYILAFKCKKCNLQFEEKSRLEIHKKLHGRKSKLSEYGSPGFNDDRLRGG*
Ga0132255_10310848523300015374Arabidopsis RhizosphereEDEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0184604_1000029213300018000Groundwater SedimentCKICGSQFEEKERLNIHKKVHGRKPKISEYGSPEFNQDRLRG
Ga0184620_1000692013300018051Groundwater SedimentTLFVEKRRLEVHKKVHRRKPKIREYGSPEFNQDRLRG
Ga0184620_1020500013300018051Groundwater SedimentMQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0184626_1023463023300018053Groundwater SedimentFEEKERLNIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0184637_1067822213300018063Groundwater SedimentFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0184611_102052323300018067Groundwater SedimentMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0184633_1045294613300018077Groundwater SedimentKVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0190265_1015317823300018422SoilMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSPEFNQDRLRG
Ga0190275_1136544213300018432SoilMVFKSSKCGSVFEEERRLEIHKQTHDRKSKISEYGLPEFNQDRLRG
Ga0190269_1150951513300018465SoilMNFEDKRRLENHKNVHGRKSKVSEYGDPEFNKDRLRG
Ga0190270_1002335433300018469SoilMVFKCSKCGIVFEEKRRLEIHKQTHDRKSKISEYGSPEFNQDRLRG
Ga0190271_1003056143300018481SoilMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSSEFNQDR
Ga0173481_1007536523300019356SoilMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0173481_1008641313300019356SoilMCGLQFEEKKRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG
Ga0193705_102053013300019869SoilLQFEEEKRLQIHKKIHGRKPKISEYGSPEFNQDRLRG
Ga0193707_120162813300019881SoilLVSRAFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0197907_1117200513300020069Corn, Switchgrass And Miscanthus RhizosphereKCKKCNQQFEEKRRLEIHKKVHDRKSKISEYGSPGFNDDRLRGG
Ga0206351_1043810013300020077Corn, Switchgrass And Miscanthus RhizosphereTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0213882_1017497713300021362Exposed RockEFPDEKHLNNHKKVHGRKPKISEYGDPEFSKDRLR
Ga0247794_1032492523300024055SoilMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYG
Ga0207697_1000364413300025315Corn, Switchgrass And Miscanthus RhizosphereMLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQD
Ga0210061_100049823300025537Natural And Restored WetlandsMASLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210061_100074333300025537Natural And Restored WetlandsMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSSEFNQDRLRG
Ga0210087_106033713300025559Natural And Restored WetlandsMVSFKCKIYNNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210076_100240273300025567Natural And Restored WetlandsMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210076_100916633300025567Natural And Restored WetlandsMNFEDKRRMENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210076_107852313300025567Natural And Restored WetlandsSLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210143_100545013300025792Natural And Restored WetlandsMVSFKCKIYNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210114_100387443300025795Natural And Restored WetlandsFEDKRRMENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0207688_1001980143300025901Corn, Switchgrass And Miscanthus RhizosphereMLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0207647_1024552823300025904Corn RhizosphereMKFEDPRRLENHKKVHGRKSKVSEYGDPEFSIDRLRG
Ga0207645_1000745883300025907Miscanthus RhizosphereMLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDMLRG
Ga0207690_1142127113300025932Corn RhizosphereMKFEDPRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0207690_1151421823300025932Corn RhizosphereMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGS
Ga0207712_1200255123300025961Switchgrass RhizosphereMSFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0207640_1013786213300025981Corn RhizosphereMLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDM
Ga0256867_1002237463300026535SoilMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDRLRG
Ga0209879_100513713300027056Groundwater SandLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0209969_100016393300027360Arabidopsis Thaliana RhizosphereFKCKICGSQFEEKERLDIHKNAHGRKAKISEYGNPEFNQDRLRG
Ga0209854_106187713300027384Groundwater SandCGSQFEEKERLRVHKKVHGRKPKISEYGSPEFNQDRLRG
Ga0210000_102854623300027462Arabidopsis Thaliana RhizosphereCKICGSQFEEKERLQIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0209843_100885413300027511Groundwater SandQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0214468_100648943300027647SoilMVFICSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDRLRG
Ga0256866_100061563300027650SoilMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDGLRG
Ga0209998_1001379213300027717Arabidopsis Thaliana RhizosphereFKLTIKCKICGSQFEEKERLDIHKKVHGRKAKVSEYGSPEFNQDRLRG
Ga0207428_1019766013300027907Populus RhizosphereMNFEDKRRLENYKKVHKRKSKVSEYGDSEFNIDRLRG
Ga0209382_1028431523300027909Populus RhizosphereMNFEEKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0209858_102139013300027948Groundwater SandVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0308197_1020494323300031093SoilCGMQFEEEKRLQIHKKVHGRKPKIIEYGSPEFSQDRLRG
Ga0299913_1010261213300031229SoilMVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDKLRG
Ga0310887_1002027313300031547SoilMLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYG
Ga0307405_1171225913300031731RhizosphereMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDHLRG
Ga0307413_1032796723300031824RhizosphereAISVYIINNLSSFKCKTCNMNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG
Ga0307410_1020404713300031852RhizosphereMNFEDKQHLEYHKKIHGRKSKLYEYGDPEFSKDRLRG
Ga0307410_1063545513300031852RhizosphereMNFEDKRHLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0310892_1040489913300031858SoilNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0307412_1078873423300031911RhizosphereMNFEDKQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG
Ga0307412_1130280523300031911RhizosphereMASFKCKICNMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG
Ga0310891_1004595023300031913SoilSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0307409_10021558013300031995RhizosphereMNFEDKRRLENHKKVHGRKSKVSEYGNPKFNIDRLRD
Ga0308176_1020942323300031996SoilMPFKCKECGTQFEEERRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0310903_1060756913300032000SoilMNFEDKRRLENHKKVHGRKSKVSEYVNPEFTIDRPRG
Ga0307416_10300461913300032002RhizosphereMNFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0307414_1031777523300032004RhizosphereMNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG
Ga0310906_1010718133300032013SoilCKICNMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0310906_1124265513300032013SoilFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0307471_10000113593300032180Hardwood Forest SoilMEFENKDRLERHRKVHGRKSKVSEAGAMDFNQVGF
Ga0326723_0336243_2_1093300034090Peat SoilFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.