| Basic Information | |
|---|---|
| Family ID | F034741 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 174 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 174 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 1.15 % |
| % of genes near scaffold ends (potentially truncated) | 41.95 % |
| % of genes from short scaffolds (< 2000 bps) | 71.84 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (51.724 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.092 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.862 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.230 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 174 Family Scaffolds |
|---|---|---|
| PF01814 | Hemerythrin | 5.75 |
| PF07040 | DUF1326 | 3.45 |
| PF14947 | HTH_45 | 2.87 |
| PF01436 | NHL | 2.30 |
| PF00850 | Hist_deacetyl | 2.30 |
| PF00296 | Bac_luciferase | 2.30 |
| PF02518 | HATPase_c | 1.15 |
| PF01391 | Collagen | 1.15 |
| PF05899 | Cupin_3 | 1.15 |
| PF00127 | Copper-bind | 1.15 |
| PF12680 | SnoaL_2 | 1.15 |
| PF00582 | Usp | 1.15 |
| PF00072 | Response_reg | 1.15 |
| PF05638 | T6SS_HCP | 0.57 |
| PF14534 | DUF4440 | 0.57 |
| PF01022 | HTH_5 | 0.57 |
| PF05559 | DUF763 | 0.57 |
| PF13424 | TPR_12 | 0.57 |
| PF09859 | Oxygenase-NA | 0.57 |
| PF13649 | Methyltransf_25 | 0.57 |
| PF00413 | Peptidase_M10 | 0.57 |
| PF08241 | Methyltransf_11 | 0.57 |
| PF14059 | DUF4251 | 0.57 |
| PF08240 | ADH_N | 0.57 |
| PF00171 | Aldedh | 0.57 |
| PF07366 | SnoaL | 0.57 |
| PF01928 | CYTH | 0.57 |
| PF07995 | GSDH | 0.57 |
| PF06348 | DUF1059 | 0.57 |
| PF10069 | DICT | 0.57 |
| PF17159 | MASE3 | 0.57 |
| PF00211 | Guanylate_cyc | 0.57 |
| PF08327 | AHSA1 | 0.57 |
| PF05496 | RuvB_N | 0.57 |
| PF04895 | Nre_C | 0.57 |
| PF00011 | HSP20 | 0.57 |
| PF04457 | MJ1316 | 0.57 |
| PF00732 | GMC_oxred_N | 0.57 |
| PF13412 | HTH_24 | 0.57 |
| PF00149 | Metallophos | 0.57 |
| PF07452 | CHRD | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 174 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.60 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 3.45 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.30 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.57 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.57 |
| COG1415 | Uncharacterized conserved protein, DUF763 domain | Function unknown [S] | 0.57 |
| COG1531 | Uncharacterized conserved protein, UPF0248 family | Function unknown [S] | 0.57 |
| COG1602 | Archaeal DNA repair protein NreA | Replication, recombination and repair [L] | 0.57 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.57 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.57 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.57 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.57 |
| COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.57 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.57 |
| COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.32 % |
| Unclassified | root | N/A | 43.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_317263 | All Organisms → cellular organisms → Archaea | 1254 | Open in IMG/M |
| 2162886007|SwRhRL2b_contig_612750 | All Organisms → cellular organisms → Archaea | 822 | Open in IMG/M |
| 2228664021|ICCgaii200_c0228975 | Not Available | 560 | Open in IMG/M |
| 3300000044|ARSoilOldRDRAFT_c002510 | Not Available | 1613 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104636691 | Not Available | 724 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10002422 | All Organisms → cellular organisms → Archaea | 4943 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10016618 | Not Available | 2021 | Open in IMG/M |
| 3300000787|JGI11643J11755_11432229 | Not Available | 986 | Open in IMG/M |
| 3300000787|JGI11643J11755_11456906 | Not Available | 585 | Open in IMG/M |
| 3300001538|A10PFW1_10197141 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 1514 | Open in IMG/M |
| 3300002568|C688J35102_118581117 | Not Available | 574 | Open in IMG/M |
| 3300002568|C688J35102_120833204 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1739 | Open in IMG/M |
| 3300003911|JGI25405J52794_10025652 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1209 | Open in IMG/M |
| 3300003987|Ga0055471_10003546 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2832 | Open in IMG/M |
| 3300003987|Ga0055471_10207710 | Not Available | 613 | Open in IMG/M |
| 3300004081|Ga0063454_101986969 | Not Available | 514 | Open in IMG/M |
| 3300004114|Ga0062593_100978266 | Not Available | 865 | Open in IMG/M |
| 3300004145|Ga0055489_10266349 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 546 | Open in IMG/M |
| 3300004153|Ga0063455_100062871 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1342 | Open in IMG/M |
| 3300005161|Ga0066807_1005369 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1088 | Open in IMG/M |
| 3300005289|Ga0065704_10540383 | All Organisms → cellular organisms → Archaea | 641 | Open in IMG/M |
| 3300005294|Ga0065705_10062967 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 594 | Open in IMG/M |
| 3300005328|Ga0070676_10013871 | All Organisms → cellular organisms → Archaea | 4421 | Open in IMG/M |
| 3300005441|Ga0070700_100366946 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1072 | Open in IMG/M |
| 3300005441|Ga0070700_101422270 | Not Available | 587 | Open in IMG/M |
| 3300005444|Ga0070694_101595475 | Not Available | 554 | Open in IMG/M |
| 3300005518|Ga0070699_101849814 | Not Available | 552 | Open in IMG/M |
| 3300005614|Ga0068856_102508480 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 522 | Open in IMG/M |
| 3300005616|Ga0068852_100222089 | Not Available | 1797 | Open in IMG/M |
| 3300005896|Ga0075282_1006428 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1334 | Open in IMG/M |
| 3300006049|Ga0075417_10162957 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1042 | Open in IMG/M |
| 3300006163|Ga0070715_10056176 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 1712 | Open in IMG/M |
| 3300006806|Ga0079220_10073992 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1688 | Open in IMG/M |
| 3300006844|Ga0075428_100047579 | All Organisms → cellular organisms → Archaea → TACK group | 4710 | Open in IMG/M |
| 3300006844|Ga0075428_100433913 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1407 | Open in IMG/M |
| 3300006844|Ga0075428_101239288 | Not Available | 786 | Open in IMG/M |
| 3300006845|Ga0075421_100196096 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 2502 | Open in IMG/M |
| 3300006845|Ga0075421_100402931 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 1642 | Open in IMG/M |
| 3300006845|Ga0075421_100428811 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1583 | Open in IMG/M |
| 3300006845|Ga0075421_101005158 | All Organisms → cellular organisms → Archaea | 944 | Open in IMG/M |
| 3300006846|Ga0075430_100552853 | Not Available | 949 | Open in IMG/M |
| 3300006847|Ga0075431_100851909 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 883 | Open in IMG/M |
| 3300006847|Ga0075431_101848509 | Not Available | 560 | Open in IMG/M |
| 3300006871|Ga0075434_100025503 | Not Available | 5784 | Open in IMG/M |
| 3300006871|Ga0075434_100119414 | Not Available | 2650 | Open in IMG/M |
| 3300006880|Ga0075429_100503259 | All Organisms → cellular organisms → Archaea | 1062 | Open in IMG/M |
| 3300006904|Ga0075424_100485171 | Not Available | 1320 | Open in IMG/M |
| 3300006904|Ga0075424_101203135 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 806 | Open in IMG/M |
| 3300006969|Ga0075419_10079681 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2083 | Open in IMG/M |
| 3300006969|Ga0075419_10701996 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 717 | Open in IMG/M |
| 3300006969|Ga0075419_11402697 | All Organisms → cellular organisms → Archaea | 521 | Open in IMG/M |
| 3300007004|Ga0079218_11607319 | All Organisms → cellular organisms → Archaea | 713 | Open in IMG/M |
| 3300007076|Ga0075435_100097451 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2434 | Open in IMG/M |
| 3300009094|Ga0111539_10216951 | Not Available | 2228 | Open in IMG/M |
| 3300009094|Ga0111539_12295463 | Not Available | 626 | Open in IMG/M |
| 3300009094|Ga0111539_12439607 | Not Available | 607 | Open in IMG/M |
| 3300009147|Ga0114129_10197132 | Not Available | 2730 | Open in IMG/M |
| 3300009156|Ga0111538_10212117 | All Organisms → cellular organisms → Archaea | 2455 | Open in IMG/M |
| 3300009156|Ga0111538_11602472 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300009789|Ga0126307_10013019 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 6111 | Open in IMG/M |
| 3300009789|Ga0126307_10019061 | All Organisms → cellular organisms → Archaea | 5153 | Open in IMG/M |
| 3300009789|Ga0126307_10057824 | All Organisms → cellular organisms → Archaea | 3039 | Open in IMG/M |
| 3300009789|Ga0126307_10124980 | All Organisms → cellular organisms → Archaea | 2051 | Open in IMG/M |
| 3300009801|Ga0105056_1012615 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 968 | Open in IMG/M |
| 3300009803|Ga0105065_1051258 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 588 | Open in IMG/M |
| 3300009811|Ga0105084_1008985 | Not Available | 1503 | Open in IMG/M |
| 3300010036|Ga0126305_10031226 | All Organisms → cellular organisms → Archaea | 2906 | Open in IMG/M |
| 3300010036|Ga0126305_10038087 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2666 | Open in IMG/M |
| 3300010036|Ga0126305_10965431 | Not Available | 583 | Open in IMG/M |
| 3300010037|Ga0126304_10040150 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 2803 | Open in IMG/M |
| 3300010037|Ga0126304_10060811 | All Organisms → cellular organisms → Archaea | 2316 | Open in IMG/M |
| 3300010039|Ga0126309_10273563 | Not Available | 966 | Open in IMG/M |
| 3300010040|Ga0126308_10053566 | Not Available | 2352 | Open in IMG/M |
| 3300010040|Ga0126308_10346105 | Not Available | 984 | Open in IMG/M |
| 3300010040|Ga0126308_10389747 | Not Available | 928 | Open in IMG/M |
| 3300010041|Ga0126312_10298527 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300010042|Ga0126314_10042832 | All Organisms → cellular organisms → Archaea | 2900 | Open in IMG/M |
| 3300010042|Ga0126314_10063481 | All Organisms → cellular organisms → Archaea | 2435 | Open in IMG/M |
| 3300010044|Ga0126310_10027976 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 2924 | Open in IMG/M |
| 3300010358|Ga0126370_10000267 | All Organisms → cellular organisms → Archaea | 20333 | Open in IMG/M |
| 3300010362|Ga0126377_10421210 | All Organisms → cellular organisms → Archaea | 1351 | Open in IMG/M |
| 3300010362|Ga0126377_10813895 | Not Available | 993 | Open in IMG/M |
| 3300010371|Ga0134125_10651747 | All Organisms → cellular organisms → Archaea | 1162 | Open in IMG/M |
| 3300010371|Ga0134125_12072643 | Not Available | 618 | Open in IMG/M |
| 3300010397|Ga0134124_10242140 | All Organisms → cellular organisms → Archaea | 1656 | Open in IMG/M |
| 3300012189|Ga0137388_10488609 | All Organisms → cellular organisms → Archaea | 1143 | Open in IMG/M |
| 3300012469|Ga0150984_121340364 | Not Available | 806 | Open in IMG/M |
| 3300012490|Ga0157322_1016905 | Not Available | 664 | Open in IMG/M |
| 3300012505|Ga0157339_1000899 | Not Available | 1662 | Open in IMG/M |
| 3300012517|Ga0157354_1002562 | Not Available | 1389 | Open in IMG/M |
| 3300012900|Ga0157292_10418545 | Not Available | 511 | Open in IMG/M |
| 3300012951|Ga0164300_10247052 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 904 | Open in IMG/M |
| 3300012957|Ga0164303_10434191 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 821 | Open in IMG/M |
| 3300012961|Ga0164302_11091876 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012987|Ga0164307_10206170 | All Organisms → cellular organisms → Archaea | 1342 | Open in IMG/M |
| 3300012987|Ga0164307_10743644 | Not Available | 773 | Open in IMG/M |
| 3300012989|Ga0164305_11970057 | Not Available | 532 | Open in IMG/M |
| 3300013102|Ga0157371_10780992 | Not Available | 719 | Open in IMG/M |
| 3300013104|Ga0157370_11991096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni | 521 | Open in IMG/M |
| 3300014263|Ga0075324_1129261 | Not Available | 567 | Open in IMG/M |
| 3300014270|Ga0075325_1006001 | Not Available | 1987 | Open in IMG/M |
| 3300014311|Ga0075322_1011657 | All Organisms → cellular organisms → Archaea | 1710 | Open in IMG/M |
| 3300014311|Ga0075322_1111330 | Not Available | 647 | Open in IMG/M |
| 3300015371|Ga0132258_11585059 | All Organisms → cellular organisms → Archaea | 1653 | Open in IMG/M |
| 3300015372|Ga0132256_102054669 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 677 | Open in IMG/M |
| 3300015374|Ga0132255_103108485 | All Organisms → cellular organisms → Archaea | 708 | Open in IMG/M |
| 3300018000|Ga0184604_10000292 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 4993 | Open in IMG/M |
| 3300018051|Ga0184620_10006920 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 2435 | Open in IMG/M |
| 3300018051|Ga0184620_10205000 | Not Available | 657 | Open in IMG/M |
| 3300018053|Ga0184626_10234630 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 772 | Open in IMG/M |
| 3300018063|Ga0184637_10678222 | Not Available | 567 | Open in IMG/M |
| 3300018067|Ga0184611_1020523 | Not Available | 2030 | Open in IMG/M |
| 3300018077|Ga0184633_10452946 | Not Available | 633 | Open in IMG/M |
| 3300018422|Ga0190265_10153178 | Not Available | 2258 | Open in IMG/M |
| 3300018432|Ga0190275_11365442 | Not Available | 785 | Open in IMG/M |
| 3300018465|Ga0190269_11509515 | Not Available | 554 | Open in IMG/M |
| 3300018469|Ga0190270_10023354 | All Organisms → cellular organisms → Archaea | 3877 | Open in IMG/M |
| 3300018481|Ga0190271_10030561 | Not Available | 4334 | Open in IMG/M |
| 3300019356|Ga0173481_10075365 | All Organisms → cellular organisms → Archaea | 1233 | Open in IMG/M |
| 3300019356|Ga0173481_10086413 | Not Available | 1173 | Open in IMG/M |
| 3300019869|Ga0193705_1020530 | All Organisms → cellular organisms → Archaea | 1437 | Open in IMG/M |
| 3300019881|Ga0193707_1201628 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 507 | Open in IMG/M |
| 3300020069|Ga0197907_11172005 | Not Available | 590 | Open in IMG/M |
| 3300020077|Ga0206351_10438100 | Not Available | 510 | Open in IMG/M |
| 3300021362|Ga0213882_10174977 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS | 883 | Open in IMG/M |
| 3300024055|Ga0247794_10324925 | All Organisms → cellular organisms → Archaea | 522 | Open in IMG/M |
| 3300025315|Ga0207697_10003644 | All Organisms → cellular organisms → Archaea | 7550 | Open in IMG/M |
| 3300025537|Ga0210061_1000498 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 5754 | Open in IMG/M |
| 3300025537|Ga0210061_1000743 | All Organisms → cellular organisms → Archaea | 4940 | Open in IMG/M |
| 3300025559|Ga0210087_1060337 | Not Available | 756 | Open in IMG/M |
| 3300025567|Ga0210076_1002402 | All Organisms → cellular organisms → Archaea | 4560 | Open in IMG/M |
| 3300025567|Ga0210076_1009166 | Not Available | 2145 | Open in IMG/M |
| 3300025567|Ga0210076_1078523 | Not Available | 721 | Open in IMG/M |
| 3300025792|Ga0210143_1005450 | All Organisms → cellular organisms → Archaea | 2488 | Open in IMG/M |
| 3300025795|Ga0210114_1003874 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 3682 | Open in IMG/M |
| 3300025901|Ga0207688_10019801 | All Organisms → cellular organisms → Archaea | 3669 | Open in IMG/M |
| 3300025904|Ga0207647_10245528 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300025907|Ga0207645_10007458 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7724 | Open in IMG/M |
| 3300025932|Ga0207690_11421271 | Not Available | 580 | Open in IMG/M |
| 3300025932|Ga0207690_11514218 | All Organisms → cellular organisms → Archaea | 561 | Open in IMG/M |
| 3300025961|Ga0207712_12002551 | Not Available | 518 | Open in IMG/M |
| 3300025981|Ga0207640_10137862 | Not Available | 1774 | Open in IMG/M |
| 3300026535|Ga0256867_10022374 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon | 2691 | Open in IMG/M |
| 3300027056|Ga0209879_1005137 | All Organisms → Viruses → Predicted Viral | 1994 | Open in IMG/M |
| 3300027360|Ga0209969_1000163 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 8820 | Open in IMG/M |
| 3300027384|Ga0209854_1061877 | Not Available | 653 | Open in IMG/M |
| 3300027462|Ga0210000_1028546 | Not Available | 869 | Open in IMG/M |
| 3300027511|Ga0209843_1008854 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 2186 | Open in IMG/M |
| 3300027647|Ga0214468_1006489 | All Organisms → cellular organisms → Archaea | 3473 | Open in IMG/M |
| 3300027650|Ga0256866_1000615 | All Organisms → cellular organisms → Archaea | 8371 | Open in IMG/M |
| 3300027717|Ga0209998_10013792 | All Organisms → cellular organisms → Archaea | 1684 | Open in IMG/M |
| 3300027907|Ga0207428_10197660 | Not Available | 1513 | Open in IMG/M |
| 3300027909|Ga0209382_10284315 | Not Available | 1869 | Open in IMG/M |
| 3300027948|Ga0209858_1021390 | Not Available | 583 | Open in IMG/M |
| 3300031093|Ga0308197_10204943 | All Organisms → cellular organisms → Archaea | 673 | Open in IMG/M |
| 3300031229|Ga0299913_10102612 | All Organisms → cellular organisms → Archaea | 2793 | Open in IMG/M |
| 3300031547|Ga0310887_10020273 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 2625 | Open in IMG/M |
| 3300031731|Ga0307405_11712259 | Not Available | 557 | Open in IMG/M |
| 3300031824|Ga0307413_10327967 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon | 1172 | Open in IMG/M |
| 3300031852|Ga0307410_10204047 | Not Available | 1511 | Open in IMG/M |
| 3300031852|Ga0307410_10635455 | Not Available | 894 | Open in IMG/M |
| 3300031858|Ga0310892_10404899 | Not Available | 889 | Open in IMG/M |
| 3300031911|Ga0307412_10788734 | All Organisms → cellular organisms → Archaea | 824 | Open in IMG/M |
| 3300031911|Ga0307412_11302805 | Not Available | 654 | Open in IMG/M |
| 3300031913|Ga0310891_10045950 | Not Available | 1208 | Open in IMG/M |
| 3300031995|Ga0307409_100215580 | All Organisms → cellular organisms → Archaea | 1729 | Open in IMG/M |
| 3300031996|Ga0308176_10209423 | All Organisms → Viruses → Predicted Viral | 1840 | Open in IMG/M |
| 3300032000|Ga0310903_10607569 | Not Available | 583 | Open in IMG/M |
| 3300032002|Ga0307416_103004619 | Not Available | 564 | Open in IMG/M |
| 3300032004|Ga0307414_10317775 | Not Available | 1324 | Open in IMG/M |
| 3300032013|Ga0310906_10107181 | All Organisms → cellular organisms → Archaea | 1546 | Open in IMG/M |
| 3300032013|Ga0310906_11242655 | Not Available | 543 | Open in IMG/M |
| 3300032180|Ga0307471_100001135 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 14367 | Open in IMG/M |
| 3300034090|Ga0326723_0336243 | Not Available | 680 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.92% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 9.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.32% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.17% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.02% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.30% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.30% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.30% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.30% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.72% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.15% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.15% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.15% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.15% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.15% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.15% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.57% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.57% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.57% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.57% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.57% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.57% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0009.00001310 | 2162886007 | Switchgrass Rhizosphere | MNFEDKQHLENHKKVHGRKSKVYEYGDPEFTKDRLRG |
| SwRhRL2b_0943.00003030 | 2162886007 | Switchgrass Rhizosphere | MNFEEKRHLENHKKVHGRKSKVYEYGDPEFTKDRLRG |
| ICCgaii200_02289751 | 2228664021 | Soil | VCGLIFGEEKRYQIHKKVHGRKPKISEYGSPEFNQD |
| ARSoilOldRDRAFT_0025101 | 3300000044 | Arabidopsis Rhizosphere | EEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG* |
| INPhiseqgaiiFebDRAFT_1046366912 | 3300000364 | Soil | MQDMGLQFEEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG* |
| AF_2010_repII_A1DRAFT_100024227 | 3300000597 | Forest Soil | MEFPDSRHLENHKKVHGRKPKISEYGDPEFSKDRLR* |
| AF_2010_repII_A1DRAFT_100166184 | 3300000597 | Forest Soil | MEFADEKHLKNHKKVHGRKPKIREYGDPEFSKDRLRG* |
| JGI11643J11755_114322293 | 3300000787 | Soil | LIFGEEKRYQIHKKVHGRKPKISEYGSPEFSQDRLRG* |
| JGI11643J11755_114569061 | 3300000787 | Soil | RPLAFKCKVCGLIFGEEKRYQIHKKVHGRKPKISEYGSPEFNQDRLRG* |
| A10PFW1_101971412 | 3300001538 | Permafrost | MQFEDKEHFEIHKTVHGRKSKVSEYGSPEFSQDRLRG* |
| C688J35102_1185811172 | 3300002568 | Soil | TCGLQFEEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG* |
| C688J35102_1208332041 | 3300002568 | Soil | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLR |
| JGI25405J52794_100256521 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MVFRCSKCGSVFEEKRRLEIHKQTHDRKSKIREYGSPEFSQDSLRG* |
| Ga0055471_100035461 | 3300003987 | Natural And Restored Wetlands | MASLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0055471_102077101 | 3300003987 | Natural And Restored Wetlands | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSSEFNQDRLRG* |
| Ga0063454_1019869692 | 3300004081 | Soil | FKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG* |
| Ga0062593_1009782663 | 3300004114 | Soil | MCGLQFEEKKRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG* |
| Ga0055489_102663491 | 3300004145 | Natural And Restored Wetlands | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSSEFNQDRLRG* |
| Ga0063455_1000628711 | 3300004153 | Soil | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG* |
| Ga0066807_10053691 | 3300005161 | Soil | LTFKCKISGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG* |
| Ga0065704_105403832 | 3300005289 | Switchgrass Rhizosphere | LTFKCKICGSQFEEKERLGIHKKVHGRKAKISEYGSPEFNQDRLRG* |
| Ga0065705_100629671 | 3300005294 | Switchgrass Rhizosphere | LTFKCKICGSQFEEKERLDIHKKVHGXKAKISEYGSPEFNQDRLRG* |
| Ga0070676_100138712 | 3300005328 | Miscanthus Rhizosphere | MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDMLRG* |
| Ga0070700_1003669461 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDR |
| Ga0070700_1014222701 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG* |
| Ga0070694_1015954752 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LTFKCKICGSQFEEKERLQIHKKVHGRKAQISEYGSPEFNQDRLRG* |
| Ga0070699_1018498142 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KTCGLQFDEKRRLEIHKQVHGRKSKVSEYGSPEFSQDRLRG* |
| Ga0068856_1025084801 | 3300005614 | Corn Rhizosphere | CKKCNLEFEEKNRLEIHKKVHGRKSKVSEYGSPEFNQDRLRG* |
| Ga0068852_1002220893 | 3300005616 | Corn Rhizosphere | MKFEDPRRLENHKKVHGRKSKVSEYGDPEFNIDRLRG* |
| Ga0075282_10064283 | 3300005896 | Rice Paddy Soil | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFN |
| Ga0075417_101629571 | 3300006049 | Populus Rhizosphere | LTFKCKICGSQFEEKERLDIHKNVHGRKAKISEYGSPEFNQDRLEAN |
| Ga0070715_100561762 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKEFSDTKHLENHKKVHGRKPKVSEYGDPEFSKDRLR* |
| Ga0079220_100739922 | 3300006806 | Agricultural Soil | MPFKCKECGTQFEEKRRLEIHKKLHGRKSKISEYGSPEFNQDRLRG* |
| Ga0075428_1000475793 | 3300006844 | Populus Rhizosphere | MNFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0075428_1004339133 | 3300006844 | Populus Rhizosphere | MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG* |
| Ga0075428_1012392881 | 3300006844 | Populus Rhizosphere | FEEKERLDIHKKVHGRKAKISEYGSPEFNQNRLRG* |
| Ga0075421_1001960963 | 3300006845 | Populus Rhizosphere | CGLKFEEKKRLEIHKQVHGRKPKVTEYGSSEFSQDRLRG* |
| Ga0075421_1004029312 | 3300006845 | Populus Rhizosphere | MNFEEKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0075421_1004288113 | 3300006845 | Populus Rhizosphere | MQDIGLDFEEKKRLEIHKQVHDRKLKVAEYGSPEFSQDRLRG* |
| Ga0075421_1010051582 | 3300006845 | Populus Rhizosphere | LTLKCKICGSQFEEKERLDIHKKVHGRKAKISEYGSTEFNQDRLRG* |
| Ga0075430_1005528532 | 3300006846 | Populus Rhizosphere | MNFEDKRRLENHKKVHGRKSKVSEYGNSEFNIDRLRG* |
| Ga0075431_1008519091 | 3300006847 | Populus Rhizosphere | MQDIGLKFEEKKRLEIHKQVHGRKPKVTEYGSPEFSQDRLRG* |
| Ga0075431_1018485092 | 3300006847 | Populus Rhizosphere | MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFN |
| Ga0075434_1000255037 | 3300006871 | Populus Rhizosphere | PISMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG* |
| Ga0075434_1001194142 | 3300006871 | Populus Rhizosphere | MLSFKCKICGSQFEEKERLDIHKKVHGGKAKISEYGSPEFNQDRLRG* |
| Ga0075429_1005032592 | 3300006880 | Populus Rhizosphere | LTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYGSTEFNQDRLRG* |
| Ga0075424_1004851711 | 3300006904 | Populus Rhizosphere | FEEKERLDIHKKVHGGKAKISEYGSPEFNQDRLRG* |
| Ga0075424_1012031351 | 3300006904 | Populus Rhizosphere | SQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRC* |
| Ga0075419_100796811 | 3300006969 | Populus Rhizosphere | KCKICGSQFEEKERLDIHKKVHGRKAKIREYGSPEFNQDRLRG* |
| Ga0075419_107019962 | 3300006969 | Populus Rhizosphere | CGSQFEEKERLDIHKNVHGRKAKISEYGSPEFNQDRLRG* |
| Ga0075419_114026972 | 3300006969 | Populus Rhizosphere | LTFKCKICGSQFEEKERLDIHKNVHGRKAKISEYGSPEF |
| Ga0079218_116073192 | 3300007004 | Agricultural Soil | MNFEDKKRLENHKKVHGRKSKVSEYGNPEFNIDRLRG* |
| Ga0075435_1000974514 | 3300007076 | Populus Rhizosphere | LTFKCKICGSQFEEKERFDIHKKVHGRKAKIREYGSPEFNQDRLRG* |
| Ga0111539_102169512 | 3300009094 | Populus Rhizosphere | MNFEDKRRLENYKKVHKRKSKVSEYGDSEFNIDRLRG* |
| Ga0111539_122954631 | 3300009094 | Populus Rhizosphere | RMVQFFKCKVRGLQFEEEKRLKIHKKVHGRKPKISEYGSPEFSQDRLRG* |
| Ga0111539_124396071 | 3300009094 | Populus Rhizosphere | MTFEEKNRLEVHKKVHGRKSKVSEYGSPEFNQDRLRG* |
| Ga0114129_101971323 | 3300009147 | Populus Rhizosphere | MNFEDKRRLKNHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0111538_102121173 | 3300009156 | Populus Rhizosphere | MKFEDPRRLENHKKVHGRKSKVSEYGDPEFSIDRLKG* |
| Ga0111538_116024721 | 3300009156 | Populus Rhizosphere | KCKICNMKFEDPRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0126307_100130194 | 3300009789 | Serpentine Soil | MNFEDKQHLEYHKKIHGRKSKLYEYGDPEFSKDRLRG* |
| Ga0126307_100190613 | 3300009789 | Serpentine Soil | MNFEDKRRSENHKKVHGRKSKVSEYGNPEFNIDRLRG* |
| Ga0126307_100578242 | 3300009789 | Serpentine Soil | MNFEDKQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG* |
| Ga0126307_101249801 | 3300009789 | Serpentine Soil | MNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG* |
| Ga0105056_10126152 | 3300009801 | Groundwater Sand | MEFENKDRLERHRKVHGRKSKVSEAGTMDFNQVGF* |
| Ga0105065_10512582 | 3300009803 | Groundwater Sand | MEFEDKERFERHKKVHGRKSKISEAGAMDFSQVGF* |
| Ga0105084_10089851 | 3300009811 | Groundwater Sand | KCKVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG* |
| Ga0126305_100312261 | 3300010036 | Serpentine Soil | MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNLDRLRG* |
| Ga0126305_100380872 | 3300010036 | Serpentine Soil | MNFEDKQHLENHKKLHGRKSKVYEYGDPEFNKDRLRG* |
| Ga0126305_109654312 | 3300010036 | Serpentine Soil | MNFEDKRRLENHKKVHGRTSKVSEYGDPEFNKDRLRG* |
| Ga0126304_100401504 | 3300010037 | Serpentine Soil | MNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG* |
| Ga0126304_100608112 | 3300010037 | Serpentine Soil | MNFEDRQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG* |
| Ga0126309_102735631 | 3300010039 | Serpentine Soil | MGFKCKKCNLQFEEERRLEIHKKVHDRKSKVSEYGSPVFNDDRLRGG* |
| Ga0126308_100535662 | 3300010040 | Serpentine Soil | MNFEDKRRLENHKKVHGRKSKVSEYGDPEFNKDRLRG* |
| Ga0126308_103461051 | 3300010040 | Serpentine Soil | MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRD* |
| Ga0126308_103897471 | 3300010040 | Serpentine Soil | MASFKCKICNMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG* |
| Ga0126312_102985273 | 3300010041 | Serpentine Soil | MNFEDKRHLENHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0126314_100428323 | 3300010042 | Serpentine Soil | MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIERLRD* |
| Ga0126314_100634813 | 3300010042 | Serpentine Soil | MNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLIG* |
| Ga0126310_100279763 | 3300010044 | Serpentine Soil | MNFEDKRHLENHKKVHGRKPKVYEYGDPEFNKDRLRG* |
| Ga0126370_100002679 | 3300010358 | Tropical Forest Soil | MVFKCKECGTEFEEKRRLEIHKKVHGRKSKVREYGSPEFNQDRLRG* |
| Ga0126377_104212102 | 3300010362 | Tropical Forest Soil | EEKRRLEIHKKVHGRKSKVREYGSPEFNQDRLRG* |
| Ga0126377_108138951 | 3300010362 | Tropical Forest Soil | TFEDEKRLQIHKRVHGRKPKIREYGSPEFSQDRLRG* |
| Ga0134125_106517472 | 3300010371 | Terrestrial Soil | EEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG* |
| Ga0134125_120726431 | 3300010371 | Terrestrial Soil | VCGTLFVEKRRLEVHKKVHRRKPKIREYGSPEFNQDRLRG* |
| Ga0134124_102421401 | 3300010397 | Terrestrial Soil | MPFKCKECGTQFEEERRLEIHKKVHGRKSKIREYGSPEFNQDRLRG* |
| Ga0137388_104886093 | 3300012189 | Vadose Zone Soil | DEKRRLEIQKQVHGRKSKVSEYGSPEFSQDRLRG* |
| Ga0150984_1213403641 | 3300012469 | Avena Fatua Rhizosphere | CKKCNLEFEEKKRLEIHKNVHGRKSKVSEYGSPEFNQDRLRG* |
| Ga0157322_10169051 | 3300012490 | Arabidopsis Rhizosphere | TQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG* |
| Ga0157339_10008991 | 3300012505 | Arabidopsis Rhizosphere | QFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG* |
| Ga0157354_10025623 | 3300012517 | Unplanted Soil | EEKERLDIHKKVHGRKAKISEYGSPEFYQDRLRG* |
| Ga0157292_104185451 | 3300012900 | Soil | LTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYGS |
| Ga0164300_102470521 | 3300012951 | Soil | LALKCKKCNLEFEEKKRREIHKNVHDRKSKVYEYGSPEFKDDRLRAG* |
| Ga0164303_104341912 | 3300012957 | Soil | LALKCKKCNLEFEEKKRREIHKNVHDRKSKVYEYGSPEFNDDRLRAG* |
| Ga0164302_110918762 | 3300012961 | Soil | CGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG* |
| Ga0164307_102061702 | 3300012987 | Soil | FEEEKRLQIHKKVHGRKPKISEYESPEFSQDRLRG* |
| Ga0164307_107436442 | 3300012987 | Soil | LALKCKKCNLEFEEKKRREIHENVHDRKSKVYEYGSPEFNNDRLRAG* |
| Ga0164305_119700571 | 3300012989 | Soil | VLVHKCKVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG* |
| Ga0157371_107809921 | 3300013102 | Corn Rhizosphere | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKIREYGSPEFNQDRLRG* |
| Ga0157370_119910961 | 3300013104 | Corn Rhizosphere | MLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEY |
| Ga0075324_11292611 | 3300014263 | Natural And Restored Wetlands | MASLKCKLYNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0075325_10060013 | 3300014270 | Natural And Restored Wetlands | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSPEFNQDRLRG* |
| Ga0075322_10116572 | 3300014311 | Natural And Restored Wetlands | MVSFKCKIYNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG* |
| Ga0075322_11113301 | 3300014311 | Natural And Restored Wetlands | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSS |
| Ga0132258_115850593 | 3300015371 | Arabidopsis Rhizosphere | MNFEDEIRLENHKKVHGRKSKVAEYGDSEFNIDRLRG* |
| Ga0132256_1020546692 | 3300015372 | Arabidopsis Rhizosphere | FSFLYILAFKCKKCNLQFEEKSRLEIHKKLHGRKSKLSEYGSPGFNDDRLRGG* |
| Ga0132255_1031084852 | 3300015374 | Arabidopsis Rhizosphere | EDEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG* |
| Ga0184604_100002921 | 3300018000 | Groundwater Sediment | CKICGSQFEEKERLNIHKKVHGRKPKISEYGSPEFNQDRLRG |
| Ga0184620_100069201 | 3300018051 | Groundwater Sediment | TLFVEKRRLEVHKKVHRRKPKIREYGSPEFNQDRLRG |
| Ga0184620_102050001 | 3300018051 | Groundwater Sediment | MQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG |
| Ga0184626_102346302 | 3300018053 | Groundwater Sediment | FEEKERLNIHKKVHGRKSKISEYGSPEFNQDRLRG |
| Ga0184637_106782221 | 3300018063 | Groundwater Sediment | FEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG |
| Ga0184611_10205232 | 3300018067 | Groundwater Sediment | MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG |
| Ga0184633_104529461 | 3300018077 | Groundwater Sediment | KVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG |
| Ga0190265_101531782 | 3300018422 | Soil | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSPEFNQDRLRG |
| Ga0190275_113654421 | 3300018432 | Soil | MVFKSSKCGSVFEEERRLEIHKQTHDRKSKISEYGLPEFNQDRLRG |
| Ga0190269_115095151 | 3300018465 | Soil | MNFEDKRRLENHKNVHGRKSKVSEYGDPEFNKDRLRG |
| Ga0190270_100233543 | 3300018469 | Soil | MVFKCSKCGIVFEEKRRLEIHKQTHDRKSKISEYGSPEFNQDRLRG |
| Ga0190271_100305614 | 3300018481 | Soil | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSSEFNQDR |
| Ga0173481_100753652 | 3300019356 | Soil | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG |
| Ga0173481_100864131 | 3300019356 | Soil | MCGLQFEEKKRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG |
| Ga0193705_10205301 | 3300019869 | Soil | LQFEEEKRLQIHKKIHGRKPKISEYGSPEFNQDRLRG |
| Ga0193707_12016281 | 3300019881 | Soil | LVSRAFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG |
| Ga0197907_111720051 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | KCKKCNQQFEEKRRLEIHKKVHDRKSKISEYGSPGFNDDRLRGG |
| Ga0206351_104381001 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | TQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG |
| Ga0213882_101749771 | 3300021362 | Exposed Rock | EFPDEKHLNNHKKVHGRKPKISEYGDPEFSKDRLR |
| Ga0247794_103249252 | 3300024055 | Soil | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYG |
| Ga0207697_100036441 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQD |
| Ga0210061_10004982 | 3300025537 | Natural And Restored Wetlands | MASLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0210061_10007433 | 3300025537 | Natural And Restored Wetlands | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSSEFNQDRLRG |
| Ga0210087_10603371 | 3300025559 | Natural And Restored Wetlands | MVSFKCKIYNNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0210076_10024027 | 3300025567 | Natural And Restored Wetlands | MNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0210076_10091663 | 3300025567 | Natural And Restored Wetlands | MNFEDKRRMENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0210076_10785231 | 3300025567 | Natural And Restored Wetlands | SLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0210143_10054501 | 3300025792 | Natural And Restored Wetlands | MVSFKCKIYNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0210114_10038744 | 3300025795 | Natural And Restored Wetlands | FEDKRRMENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0207688_100198014 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG |
| Ga0207647_102455282 | 3300025904 | Corn Rhizosphere | MKFEDPRRLENHKKVHGRKSKVSEYGDPEFSIDRLRG |
| Ga0207645_100074588 | 3300025907 | Miscanthus Rhizosphere | MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDMLRG |
| Ga0207690_114212711 | 3300025932 | Corn Rhizosphere | MKFEDPRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0207690_115142182 | 3300025932 | Corn Rhizosphere | MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGS |
| Ga0207712_120025512 | 3300025961 | Switchgrass Rhizosphere | MSFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG |
| Ga0207640_101378621 | 3300025981 | Corn Rhizosphere | MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDM |
| Ga0256867_100223746 | 3300026535 | Soil | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDRLRG |
| Ga0209879_10051371 | 3300027056 | Groundwater Sand | LQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG |
| Ga0209969_10001639 | 3300027360 | Arabidopsis Thaliana Rhizosphere | FKCKICGSQFEEKERLDIHKNAHGRKAKISEYGNPEFNQDRLRG |
| Ga0209854_10618771 | 3300027384 | Groundwater Sand | CGSQFEEKERLRVHKKVHGRKPKISEYGSPEFNQDRLRG |
| Ga0210000_10285462 | 3300027462 | Arabidopsis Thaliana Rhizosphere | CKICGSQFEEKERLQIHKKVHGRKAKISEYGSPEFNQDRLRG |
| Ga0209843_10088541 | 3300027511 | Groundwater Sand | QFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG |
| Ga0214468_10064894 | 3300027647 | Soil | MVFICSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDRLRG |
| Ga0256866_10006156 | 3300027650 | Soil | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDGLRG |
| Ga0209998_100137921 | 3300027717 | Arabidopsis Thaliana Rhizosphere | FKLTIKCKICGSQFEEKERLDIHKKVHGRKAKVSEYGSPEFNQDRLRG |
| Ga0207428_101976601 | 3300027907 | Populus Rhizosphere | MNFEDKRRLENYKKVHKRKSKVSEYGDSEFNIDRLRG |
| Ga0209382_102843152 | 3300027909 | Populus Rhizosphere | MNFEEKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0209858_10213901 | 3300027948 | Groundwater Sand | VCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG |
| Ga0308197_102049432 | 3300031093 | Soil | CGMQFEEEKRLQIHKKVHGRKPKIIEYGSPEFSQDRLRG |
| Ga0299913_101026121 | 3300031229 | Soil | MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDKLRG |
| Ga0310887_100202731 | 3300031547 | Soil | MLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYG |
| Ga0307405_117122591 | 3300031731 | Rhizosphere | MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDHLRG |
| Ga0307413_103279672 | 3300031824 | Rhizosphere | AISVYIINNLSSFKCKTCNMNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG |
| Ga0307410_102040471 | 3300031852 | Rhizosphere | MNFEDKQHLEYHKKIHGRKSKLYEYGDPEFSKDRLRG |
| Ga0307410_106354551 | 3300031852 | Rhizosphere | MNFEDKRHLENHKKVHGRKSKVSEYGNPEFNIDRLRG |
| Ga0310892_104048991 | 3300031858 | Soil | NFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG |
| Ga0307412_107887342 | 3300031911 | Rhizosphere | MNFEDKQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG |
| Ga0307412_113028052 | 3300031911 | Rhizosphere | MASFKCKICNMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG |
| Ga0310891_100459502 | 3300031913 | Soil | SQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG |
| Ga0307409_1002155801 | 3300031995 | Rhizosphere | MNFEDKRRLENHKKVHGRKSKVSEYGNPKFNIDRLRD |
| Ga0308176_102094232 | 3300031996 | Soil | MPFKCKECGTQFEEERRLEIHKKVHGRKSKISEYGSPEFNQDRLRG |
| Ga0310903_106075691 | 3300032000 | Soil | MNFEDKRRLENHKKVHGRKSKVSEYVNPEFTIDRPRG |
| Ga0307416_1030046191 | 3300032002 | Rhizosphere | MNFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG |
| Ga0307414_103177752 | 3300032004 | Rhizosphere | MNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG |
| Ga0310906_101071813 | 3300032013 | Soil | CKICNMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG |
| Ga0310906_112426551 | 3300032013 | Soil | FEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG |
| Ga0307471_1000011359 | 3300032180 | Hardwood Forest Soil | MEFENKDRLERHRKVHGRKSKVSEAGAMDFNQVGF |
| Ga0326723_0336243_2_109 | 3300034090 | Peat Soil | FEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG |
| ⦗Top⦘ |