| Basic Information | |
|---|---|
| Family ID | F034733 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 174 |
| Average Sequence Length | 38 residues |
| Representative Sequence | ELREAQPAAGQFTVQLNGDERAIGEKAAAGLFVRPD |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 174 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.47 % |
| % of genes near scaffold ends (potentially truncated) | 93.10 % |
| % of genes from short scaffolds (< 2000 bps) | 93.10 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.713 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.965 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.851 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.56% Coil/Unstructured: 73.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 174 Family Scaffolds |
|---|---|---|
| PF02773 | S-AdoMet_synt_C | 44.25 |
| PF14014 | DUF4230 | 5.75 |
| PF01370 | Epimerase | 4.02 |
| PF01522 | Polysacc_deac_1 | 2.87 |
| PF16363 | GDP_Man_Dehyd | 2.87 |
| PF03640 | Lipoprotein_15 | 2.87 |
| PF00583 | Acetyltransf_1 | 1.72 |
| PF07479 | NAD_Gly3P_dh_C | 1.72 |
| PF01797 | Y1_Tnp | 1.15 |
| PF01810 | LysE | 1.15 |
| PF04023 | FeoA | 1.15 |
| PF00152 | tRNA-synt_2 | 1.15 |
| PF11832 | DUF3352 | 0.57 |
| PF11258 | DUF3048 | 0.57 |
| PF13231 | PMT_2 | 0.57 |
| PF00291 | PALP | 0.57 |
| PF14714 | KH_dom-like | 0.57 |
| PF13683 | rve_3 | 0.57 |
| PF14329 | DUF4386 | 0.57 |
| PF00296 | Bac_luciferase | 0.57 |
| PF00378 | ECH_1 | 0.57 |
| PF01566 | Nramp | 0.57 |
| PF14333 | DUF4389 | 0.57 |
| PF00230 | MIP | 0.57 |
| PF05199 | GMC_oxred_C | 0.57 |
| PF02742 | Fe_dep_repr_C | 0.57 |
| PF13549 | ATP-grasp_5 | 0.57 |
| PF01451 | LMWPc | 0.57 |
| PF01243 | Putative_PNPOx | 0.57 |
| PF00571 | CBS | 0.57 |
| PF02649 | GCHY-1 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 174 Family Scaffolds |
|---|---|---|---|
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 44.25 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 2.87 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 2.87 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.72 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.15 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.15 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.15 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 1.15 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.15 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 1.15 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.57 |
| COG1321 | Mn-dependent transcriptional regulator MntR, DtxR family | Transcription [K] | 0.57 |
| COG1469 | GTP cyclohydrolase FolE2 | Coenzyme transport and metabolism [H] | 0.57 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.57 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.57 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.01 % |
| Unclassified | root | N/A | 22.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig40726 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1779780 | Not Available | 809 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104839707 | Not Available | 667 | Open in IMG/M |
| 3300000891|JGI10214J12806_11680601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 500 | Open in IMG/M |
| 3300001334|A2165W6_1035246 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii | 913 | Open in IMG/M |
| 3300004643|Ga0062591_100956573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300005179|Ga0066684_10521811 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005181|Ga0066678_10738657 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005181|Ga0066678_10883668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300005327|Ga0070658_11688961 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005329|Ga0070683_100593766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
| 3300005450|Ga0066682_10855116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 545 | Open in IMG/M |
| 3300005554|Ga0066661_10835446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300005560|Ga0066670_10453508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300005563|Ga0068855_102558266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300005564|Ga0070664_100403128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
| 3300005576|Ga0066708_10437179 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005576|Ga0066708_10484838 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005614|Ga0068856_100294098 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300005764|Ga0066903_101887679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1144 | Open in IMG/M |
| 3300005903|Ga0075279_10109972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300006163|Ga0070715_10328571 | Not Available | 828 | Open in IMG/M |
| 3300006173|Ga0070716_101092193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300006173|Ga0070716_101202224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 609 | Open in IMG/M |
| 3300006755|Ga0079222_11377012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300006903|Ga0075426_10502912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300006904|Ga0075424_100313794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1669 | Open in IMG/M |
| 3300006953|Ga0074063_14053751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300006954|Ga0079219_11365544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300009012|Ga0066710_103262671 | Not Available | 621 | Open in IMG/M |
| 3300009012|Ga0066710_104361724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300009038|Ga0099829_11140285 | Not Available | 646 | Open in IMG/M |
| 3300009094|Ga0111539_13047427 | Not Available | 541 | Open in IMG/M |
| 3300009100|Ga0075418_12253077 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
| 3300009148|Ga0105243_12086087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 602 | Open in IMG/M |
| 3300009162|Ga0075423_10405947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1430 | Open in IMG/M |
| 3300009661|Ga0105858_1178336 | Not Available | 613 | Open in IMG/M |
| 3300009810|Ga0105088_1032752 | Not Available | 844 | Open in IMG/M |
| 3300009840|Ga0126313_11035064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300010041|Ga0126312_11015579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300010152|Ga0126318_10489284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300010301|Ga0134070_10416856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300010337|Ga0134062_10103430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
| 3300010371|Ga0134125_12635600 | Not Available | 546 | Open in IMG/M |
| 3300010373|Ga0134128_10970474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 940 | Open in IMG/M |
| 3300010375|Ga0105239_11055819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300010376|Ga0126381_104983549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
| 3300010395|Ga0058701_10814453 | Not Available | 510 | Open in IMG/M |
| 3300010403|Ga0134123_11068913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300011119|Ga0105246_12477979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300012001|Ga0120167_1029230 | Not Available | 1320 | Open in IMG/M |
| 3300012003|Ga0120163_1106882 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012014|Ga0120159_1065005 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300012014|Ga0120159_1161182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300012204|Ga0137374_10277448 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300012207|Ga0137381_11161859 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300012210|Ga0137378_11688775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300012353|Ga0137367_10241884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1299 | Open in IMG/M |
| 3300012354|Ga0137366_10735483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300012355|Ga0137369_11092389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300012358|Ga0137368_10134405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1850 | Open in IMG/M |
| 3300012502|Ga0157347_1029864 | Not Available | 678 | Open in IMG/M |
| 3300012529|Ga0136630_1378128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300012532|Ga0137373_10445370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300012532|Ga0137373_10516565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 910 | Open in IMG/M |
| 3300012668|Ga0157216_10229236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
| 3300012899|Ga0157299_10177697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 624 | Open in IMG/M |
| 3300012906|Ga0157295_10224026 | Not Available | 614 | Open in IMG/M |
| 3300012915|Ga0157302_10215635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300012923|Ga0137359_10645656 | Not Available | 925 | Open in IMG/M |
| 3300012944|Ga0137410_11876809 | Not Available | 530 | Open in IMG/M |
| 3300012948|Ga0126375_12093021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300012955|Ga0164298_11608395 | Not Available | 512 | Open in IMG/M |
| 3300012958|Ga0164299_11069428 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012958|Ga0164299_11088350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300012958|Ga0164299_11166254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300012960|Ga0164301_10296582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300012971|Ga0126369_13618099 | Not Available | 506 | Open in IMG/M |
| 3300012985|Ga0164308_11654281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300012989|Ga0164305_10839947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300012989|Ga0164305_11102530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300013100|Ga0157373_10426514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300013102|Ga0157371_10982574 | Not Available | 643 | Open in IMG/M |
| 3300013104|Ga0157370_10802753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300013296|Ga0157374_11323138 | Not Available | 743 | Open in IMG/M |
| 3300013296|Ga0157374_11666627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300013297|Ga0157378_10858061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300013307|Ga0157372_10284410 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300013307|Ga0157372_11881532 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii | 688 | Open in IMG/M |
| 3300013427|Ga0120106_1084217 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300013763|Ga0120179_1014224 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300013765|Ga0120172_1006685 | All Organisms → cellular organisms → Bacteria | 3919 | Open in IMG/M |
| 3300014157|Ga0134078_10082006 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300014487|Ga0182000_10478433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300015201|Ga0173478_10003240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3647 | Open in IMG/M |
| 3300015357|Ga0134072_10183988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
| 3300015373|Ga0132257_103105626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300016357|Ga0182032_11076577 | Not Available | 689 | Open in IMG/M |
| 3300017654|Ga0134069_1249981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300017994|Ga0187822_10094924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300018000|Ga0184604_10165076 | Not Available | 739 | Open in IMG/M |
| 3300018056|Ga0184623_10303231 | Not Available | 721 | Open in IMG/M |
| 3300018431|Ga0066655_11108555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300018433|Ga0066667_10898883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
| 3300018466|Ga0190268_12198854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300018920|Ga0190273_12211112 | Not Available | 517 | Open in IMG/M |
| 3300019361|Ga0173482_10374912 | Not Available | 653 | Open in IMG/M |
| 3300019884|Ga0193741_1125203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300020081|Ga0206354_10096275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300021080|Ga0210382_10010653 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
| 3300021445|Ga0182009_10803408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300021510|Ga0222621_1039550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
| 3300021510|Ga0222621_1093345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300021560|Ga0126371_10663669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
| 3300022467|Ga0224712_10488996 | All Organisms → cellular organisms → Eukaryota | 594 | Open in IMG/M |
| 3300024055|Ga0247794_10059725 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300024055|Ga0247794_10252288 | Not Available | 583 | Open in IMG/M |
| 3300024181|Ga0247693_1064198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300024287|Ga0247690_1002035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2707 | Open in IMG/M |
| 3300025878|Ga0209584_10212754 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300025878|Ga0209584_10398976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300025906|Ga0207699_10937222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300025912|Ga0207707_10167933 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300025924|Ga0207694_10227215 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Nematocera → Culicomorpha → Culicoidea → Culicidae → Anophelinae → Anopheles → Cellia | 1523 | Open in IMG/M |
| 3300025927|Ga0207687_10431771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
| 3300025928|Ga0207700_11361568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300025937|Ga0207669_10034823 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
| 3300025939|Ga0207665_10043867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2991 | Open in IMG/M |
| 3300025939|Ga0207665_10968801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300025945|Ga0207679_12195184 | Not Available | 501 | Open in IMG/M |
| 3300025949|Ga0207667_12160203 | Not Available | 514 | Open in IMG/M |
| 3300025981|Ga0207640_10430390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1082 | Open in IMG/M |
| 3300025981|Ga0207640_11510022 | Not Available | 604 | Open in IMG/M |
| 3300025989|Ga0207998_1035337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300026116|Ga0207674_10800879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 909 | Open in IMG/M |
| 3300026121|Ga0207683_10785708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 883 | Open in IMG/M |
| 3300026221|Ga0209848_1049059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300026221|Ga0209848_1060152 | Not Available | 680 | Open in IMG/M |
| 3300026542|Ga0209805_1063870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1805 | Open in IMG/M |
| 3300027748|Ga0209689_1223668 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300027873|Ga0209814_10119404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1124 | Open in IMG/M |
| 3300027907|Ga0207428_10501541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
| 3300027909|Ga0209382_11358411 | Not Available | 716 | Open in IMG/M |
| 3300028556|Ga0265337_1180012 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300028573|Ga0265334_10166201 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300028705|Ga0307276_10215477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300028708|Ga0307295_10085176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
| 3300028714|Ga0307309_10107378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300028718|Ga0307307_10027986 | Not Available | 1590 | Open in IMG/M |
| 3300028718|Ga0307307_10299342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300028721|Ga0307315_10100492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300028744|Ga0307318_10114978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 915 | Open in IMG/M |
| 3300028755|Ga0307316_10097747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
| 3300028771|Ga0307320_10006572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4142 | Open in IMG/M |
| 3300028771|Ga0307320_10118924 | Not Available | 1011 | Open in IMG/M |
| 3300028791|Ga0307290_10158540 | Not Available | 829 | Open in IMG/M |
| 3300028799|Ga0307284_10081896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
| 3300028799|Ga0307284_10147479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 906 | Open in IMG/M |
| 3300028828|Ga0307312_10392287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 911 | Open in IMG/M |
| 3300028828|Ga0307312_10644332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 701 | Open in IMG/M |
| 3300030785|Ga0102757_11480973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300030830|Ga0308205_1016513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
| 3300031711|Ga0265314_10063793 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300031716|Ga0310813_11904366 | Not Available | 560 | Open in IMG/M |
| 3300031821|Ga0318567_10021621 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
| 3300031832|Ga0318499_10249733 | Not Available | 689 | Open in IMG/M |
| 3300031879|Ga0306919_10087261 | Not Available | 2166 | Open in IMG/M |
| 3300031911|Ga0307412_11877887 | Not Available | 552 | Open in IMG/M |
| 3300032074|Ga0308173_11755278 | Not Available | 585 | Open in IMG/M |
| 3300032783|Ga0335079_10492146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1309 | Open in IMG/M |
| 3300032829|Ga0335070_10708776 | Not Available | 940 | Open in IMG/M |
| 3300033004|Ga0335084_10954543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 3300034195|Ga0370501_0109781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.47% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.90% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.30% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.72% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.15% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.15% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.15% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.15% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.15% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.15% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.15% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.57% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.57% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.57% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.57% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.57% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013427 | Permafrost microbial communities from Nunavut, Canada - A15_35cm_18M | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025989 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0726.00002930 | 2166559005 | Simulated | VTSSEPAADEFVVRLNGGNQSISERAAAGLFVRAA |
| ICChiseqgaiiDRAFT_17797801 | 3300000033 | Soil | TKLELREAQPAAGQFTVKVDGKEQSIAEKAAAGLFVKPQ* |
| INPhiseqgaiiFebDRAFT_1048397071 | 3300000364 | Soil | ELTATQPAAGQLTVRVDGGEKAISERAAEGLFVRPTA* |
| JGI10214J12806_116806012 | 3300000891 | Soil | VEVRDTQPAAEQLTVRLNGDEQTIAEKAAAGLFVRPAG* |
| A2165W6_10352461 | 3300001334 | Permafrost | LEVQETQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPA* |
| Ga0062591_1009565731 | 3300004643 | Soil | TEVEVREAQPAAEQLTVRLNGGERTIAEKAAAGLFVRPA* |
| Ga0066684_105218113 | 3300005179 | Soil | GTQVEVREAQPAAEQLTVRLNGDERTIAEKAAAGLFVRPV* |
| Ga0066678_107386572 | 3300005181 | Soil | SRTALEVRETQPAAEQLTVRVNGDERAISEKAAAGLFVRAV* |
| Ga0066678_108836682 | 3300005181 | Soil | TSILVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS* |
| Ga0070658_116889611 | 3300005327 | Corn Rhizosphere | PGADVELRAVEAAAGQFRVALGGSEKAIGERAAEGLYVKRV* |
| Ga0070683_1005937661 | 3300005329 | Corn Rhizosphere | VVELRAAEPAAGQLRVAVGGVEKSIGEKAADGLFVRPAA* |
| Ga0066682_108551161 | 3300005450 | Soil | IELRSAEPAADQFTVGLDGGERAISEKAAAGLFVRPAAS* |
| Ga0066661_108354461 | 3300005554 | Soil | ELEVRDAQPAAGQMTVALNGTEQAIGEKAAAGLFVRPG* |
| Ga0066670_104535082 | 3300005560 | Soil | KIELREAQPAAGQFTVRRGGEDRAIGEKAAAGLFVKQL* |
| Ga0068855_1025582662 | 3300005563 | Corn Rhizosphere | IELRDAQPAAGQFTVRREGEDRAIGEKAAAGLFVKPV* |
| Ga0070664_1004031283 | 3300005564 | Corn Rhizosphere | SDAQPAAGQFTVKVDGREQAIAEKAAAGLFVKAE* |
| Ga0066708_104371792 | 3300005576 | Soil | EAQPAAGQMTVRLNGTERAIGDKAAAGLFVRPAA* |
| Ga0066708_104848383 | 3300005576 | Soil | GTQVEVREAQPAAEQLTVRLNGDERTIAEKAAAGLFVRPA* |
| Ga0068856_1002940981 | 3300005614 | Corn Rhizosphere | GQQVEIRAATPAADQFTISLGDGEQAISEKAAAGLFVKLVA* |
| Ga0066903_1018876791 | 3300005764 | Tropical Forest Soil | AVESAAGQYRVLVAGGEQAIGEKAAAGLFVRPASA* |
| Ga0075279_101099722 | 3300005903 | Rice Paddy Soil | VERADAAADQFVVRVGDRSRAVSEKAAAGLFVRPG* |
| Ga0070715_103285712 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AAEPAAGQLRVSVGGVEMAIGDKAAAGLYVKPAA* |
| Ga0070716_1010921931 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GTSILVRAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS* |
| Ga0070716_1012022241 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EIELRTAEPAADQFTVGLEGGERAISEKAAAGLFVRPAAS* |
| Ga0079222_113770121 | 3300006755 | Agricultural Soil | ELQSAEPAADQFTIRLDGSERAVSEKAAAGLFVQPAA* |
| Ga0075426_105029121 | 3300006903 | Populus Rhizosphere | VQTAEPAADQFTVAVDGGERAVSEKAAAGLFVRPA* |
| Ga0075424_1003137943 | 3300006904 | Populus Rhizosphere | QLESAEPAAGQFTVRLNGSTRAVGERAAAGLFVRRAA* |
| Ga0074063_140537512 | 3300006953 | Soil | ILVRTAEPAADQFTVSVEKVGERAISEKAAAGLFVRPS* |
| Ga0079219_113655441 | 3300006954 | Agricultural Soil | TSILVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPA* |
| Ga0066710_1032626711 | 3300009012 | Grasslands Soil | LQSAQPAAGQFTVKVDGSEKAIGEKAAAGLFVRPT |
| Ga0066710_1043617242 | 3300009012 | Grasslands Soil | GTELEIREAQPAAEQLTVRVNGDERAISEKAAAGLFVRAV |
| Ga0099829_111402852 | 3300009038 | Vadose Zone Soil | VLRASEPAAGQFRVKLDGTEKAIGEKAAAGLFVKPA* |
| Ga0111539_130474271 | 3300009094 | Populus Rhizosphere | QLELQAAQPAAGQFTVKVDGSEKAIGEKAAAGLFVKPA* |
| Ga0075418_122530773 | 3300009100 | Populus Rhizosphere | AAEPAAGQLRVVVDGVEKAIGEKAAAGLFVKRAA* |
| Ga0105243_120860872 | 3300009148 | Miscanthus Rhizosphere | RETQPAADQLTVRLNGHEQTIAEKAAAGLFVRHG* |
| Ga0075423_104059471 | 3300009162 | Populus Rhizosphere | LRDAQPAAGQFTVKVDGREHAIAEKAAAGLFVKPE* |
| Ga0105858_11783362 | 3300009661 | Permafrost Soil | MRRAEPAADQFTIGFLDDGTPSSGDRAISEKAAAGLFVKPAA* |
| Ga0105088_10327522 | 3300009810 | Groundwater Sand | ELRAAPAAGQFTLKVHGDERAIEEKAAAGLFVRPAA* |
| Ga0126313_110350641 | 3300009840 | Serpentine Soil | LREAQPAAGQFTLRVKGAERAIGEKAAAGLFVRPV* |
| Ga0126312_110155792 | 3300010041 | Serpentine Soil | AVEVREAQPAAEQLTVRLDGGEQTIGEKAAAGLFVRAATASK* |
| Ga0126318_104892841 | 3300010152 | Soil | LVRAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS* |
| Ga0134070_104168561 | 3300010301 | Grasslands Soil | LGDATRPDGGEFTVKVNGDERAIGEKAAAGLFVRPA* |
| Ga0134062_101034303 | 3300010337 | Grasslands Soil | LVPGTSILVRTAEPAADQFTVSIEKVGERAISEKAAAGLFVRRS* |
| Ga0134125_126356002 | 3300010371 | Terrestrial Soil | VTSAEPAAGQVVVRLNGDERSIGERAAGGLFVRPA* |
| Ga0134128_109704743 | 3300010373 | Terrestrial Soil | VEVRETQPAADQLTVRLNGHEQTIAEKAAAGLFVRPAG* |
| Ga0105239_110558191 | 3300010375 | Corn Rhizosphere | IELRSAEPAADQFTVSLDGGDRAVSERAAAGLFVKLV* |
| Ga0126381_1049835492 | 3300010376 | Tropical Forest Soil | RNAAPAADQFTVAIEKVGERAISEKAAAGLFVRPS* |
| Ga0058701_108144532 | 3300010395 | Agave | VREVAPAAEQLTVGLDGQEQTIAEKAAAGLFVRPTPSK* |
| Ga0134123_110689131 | 3300010403 | Terrestrial Soil | FTPGTKIELRDAQPAAGQFTVRREGEDQAIGEKAAAGLFVKLS* |
| Ga0105246_124779792 | 3300011119 | Miscanthus Rhizosphere | VEVREAQPAAEQLTVRLNGGEQTIAEKAAAGLFVRPA* |
| Ga0120167_10292303 | 3300012001 | Permafrost | VPGTAVELRAAEPAAGQFRVVVDGREQAIGEKAADGLFVKRA* |
| Ga0120163_11068822 | 3300012003 | Permafrost | PGQQIEMRSAEPAADQFTIGVENDGERAISEKAASGLFVRTLR* |
| Ga0120159_10650051 | 3300012014 | Permafrost | IELREAQPAAGQLTVKLNGDERAIGEKAAAGLFVRPAA* |
| Ga0120159_11611823 | 3300012014 | Permafrost | PEPAADQFTVGLDGGERAISEKAAAGLFVRPAAS* |
| Ga0137374_102774483 | 3300012204 | Vadose Zone Soil | ELRAAPTVGQFTLKVNGGERAIEEKAAAGLFVRPS* |
| Ga0137381_111618592 | 3300012207 | Vadose Zone Soil | GQEIEVRTAASAADQFTVGLDGGERAISEKAAAGLFVRPVRA* |
| Ga0137378_116887752 | 3300012210 | Vadose Zone Soil | VRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPA* |
| Ga0137367_102418841 | 3300012353 | Vadose Zone Soil | EVEVREAQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPAG* |
| Ga0137366_107354832 | 3300012354 | Vadose Zone Soil | REIEVRDAQPAAGQMTVRLNGKEQAIGEKAAAGLFVRPRDS* |
| Ga0137369_110923891 | 3300012355 | Vadose Zone Soil | EIEVEATHPEAGQFTVRLNGDERAVSEKAAAGLFVRPE* |
| Ga0137368_101344053 | 3300012358 | Vadose Zone Soil | GREIEVEATHPEAGQFTVRLNGDERAVSEKAAAGLFVRPE* |
| Ga0157347_10298641 | 3300012502 | Arabidopsis Rhizosphere | TAAEPAAGQLRVRLGGAEKTIGDKAADGLFVRPSR* |
| Ga0136630_13781282 | 3300012529 | Polar Desert Sand | VELREAQPAAGQFKVCLAGAERAIGEKAAAGLYVKLVG* |
| Ga0137373_104453702 | 3300012532 | Vadose Zone Soil | VEATHPEAGQFTVRLNGDERAVSEKAAAGLFVRPE* |
| Ga0137373_105165652 | 3300012532 | Vadose Zone Soil | GREIELAEVAGELTVRLNGDERKVGEKAAAGLFVRPA* |
| Ga0157216_102292361 | 3300012668 | Glacier Forefield Soil | AQPAAGQFKISLAGTERAIGEKAAAGLYVRALVAS* |
| Ga0157299_101776971 | 3300012899 | Soil | EVEVRETQPAAEQLTVHLDGHEQTIAEKAAAGLFVRPTG* |
| Ga0157295_102240262 | 3300012906 | Soil | RELEVRAVNPEADEMTIALDGTERAIGEKAAAGLFVRSA* |
| Ga0157302_102156352 | 3300012915 | Soil | RDAQPAAGQLTVGLNGDEREVGERAAAGLFVRLS* |
| Ga0137359_106456561 | 3300012923 | Vadose Zone Soil | EIVLRASQPAAGQFRVKLDGAEKAIGEKAAAGLFVKPA* |
| Ga0137410_118768092 | 3300012944 | Vadose Zone Soil | MRSSEPAADQFTIGLIDNGAPDGERAISEKAAAGLFVKPA* |
| Ga0126375_120930212 | 3300012948 | Tropical Forest Soil | EVEVREAQPAAEQLTVSLDGHEQTIAEKAAAGLFVRPTASK* |
| Ga0164298_116083952 | 3300012955 | Soil | PGQEIELRSAEPAADQFTVSLDGSDRAVSERAAAGLFVRLA* |
| Ga0164299_110694282 | 3300012958 | Soil | LSLGGEVVELRAVEPAAGQFRVAVGGVEKAIGEKAAGGLFVRR* |
| Ga0164299_110883502 | 3300012958 | Soil | EVRDAQTAAAQVTVKLNGQERAIGEQAAAGLFARPA* |
| Ga0164299_111662542 | 3300012958 | Soil | EVQETQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPA* |
| Ga0164301_102965822 | 3300012960 | Soil | EVRETQPAAEQLTVQLNGHEQTIAEKAAAGLFVRPG* |
| Ga0126369_136180992 | 3300012971 | Tropical Forest Soil | LQAAEPAAGQFTVRIDGAEKAIGEKAAAGLFVRPES* |
| Ga0164308_116542812 | 3300012985 | Soil | TPGTKSELRDAQPAAGQFTVRREGEDRAIGEKAAAGLFVKPV* |
| Ga0164305_108399472 | 3300012989 | Soil | VPGTPLELRAAEPAAGQFRITINGGEKAISEKAAAGLFVKRG* |
| Ga0164305_111025302 | 3300012989 | Soil | SSEPAADQFTIALDGGVRAVSEKAAAGLFVKPAA* |
| Ga0157373_104265142 | 3300013100 | Corn Rhizosphere | LVRTAEPAADQFTVAIEHVGERAISEKAAAGLFVRPA* |
| Ga0157371_109825742 | 3300013102 | Corn Rhizosphere | RETQPAADQLTVRLNGHEQTIAEKAAAGLFVRPG* |
| Ga0157370_108027531 | 3300013104 | Corn Rhizosphere | LVPGEVVELRAAEPAAGQFRVVVGGVEKAIGERAAGGLFVRR* |
| Ga0157374_113231381 | 3300013296 | Miscanthus Rhizosphere | MCEGIETRSAEPAADQFTVSLDGGDRAVSERAAAGLFVKLV* |
| Ga0157374_116666272 | 3300013296 | Miscanthus Rhizosphere | RTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS* |
| Ga0157378_108580613 | 3300013297 | Miscanthus Rhizosphere | AQPAAEQLTVRLDGHEQTIAEKAAAGLFVRPSGSK* |
| Ga0157372_102844101 | 3300013307 | Corn Rhizosphere | ILVRTAEPASDQFTVAIEKIGERAISEKAAAGLFVRPSG* |
| Ga0157372_118815321 | 3300013307 | Corn Rhizosphere | LRAAEPAAGQFRVAVGGVEKAIGEKAAGGLFVRR* |
| Ga0120106_10842172 | 3300013427 | Permafrost | IAEPAADQFTIGVENDGERAISEKAASGLFVRTLR* |
| Ga0120179_10142243 | 3300013763 | Permafrost | VEIELREPQPAAGQLTVKLNGDERAIGEKAAAGLFVRPAA* |
| Ga0120172_10066855 | 3300013765 | Permafrost | EAQPAAGQLTVKLNGDERAIGEKAAAGLFVRPAA* |
| Ga0134078_100820061 | 3300014157 | Grasslands Soil | ILVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPSG* |
| Ga0182000_104784331 | 3300014487 | Soil | LAGAAEPAAGTFTVALNGDERAIGEKAAAGLFVKPER* |
| Ga0173478_100032401 | 3300015201 | Soil | GAKIELREVQPAAGQFTVKLKGREQAIGEKAAAGLFVKPQ* |
| Ga0134072_101839881 | 3300015357 | Grasslands Soil | AEPAAGQFTVRVDGSEKAIGEKAAAGLFVRPESR* |
| Ga0132257_1031056262 | 3300015373 | Arabidopsis Rhizosphere | EVRAFEPAAEQMTVRLNGSERAIGDRAAACLFVRRTA* |
| Ga0182032_110765772 | 3300016357 | Soil | ELEVRAVEPAAGQFRVTVAGGEQAIGEKAAAGLYVRPA |
| Ga0134069_12499811 | 3300017654 | Grasslands Soil | REIEVRDAQPAAGQMTVKLNGQERAIGEKAAAGLFVRPA |
| Ga0187822_100949242 | 3300017994 | Freshwater Sediment | MPAAARSAEPAADQFTIGVGRGGRGRAISEKAAAGLFVKPV |
| Ga0184604_101650761 | 3300018000 | Groundwater Sediment | VLKAAEPAAGQFRVRLAGAEKAIGEKAAAGLFVKPR |
| Ga0184623_103032312 | 3300018056 | Groundwater Sediment | VQLREAQPAAGLFTVVIGGREQAIGEKAAAGLFVKPS |
| Ga0066655_111085552 | 3300018431 | Grasslands Soil | RAAQPEAGQFTVRLNGHERAIGERAAAGLFVRQAD |
| Ga0066667_108988831 | 3300018433 | Grasslands Soil | GRELVVRDAQPAAGQMTVALNGAEQAIGEKAAAGLFVRPD |
| Ga0190268_121988541 | 3300018466 | Soil | IRRAEPAAGQFAVTVNGDERAIGEKAAAGLFVRPAT |
| Ga0190273_122111122 | 3300018920 | Soil | LRESQPEEGPITVKLNGGEREIGERAAAGLFVRAA |
| Ga0173482_103749121 | 3300019361 | Soil | ELRAAEPAAGQLRVAVGGVEKSIGEKAADGLFVRPAA |
| Ga0193741_11252031 | 3300019884 | Soil | IEVRTAGPVTGLTVKLNGGERAVSEKAAAGLFVRPA |
| Ga0206354_100962752 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVTAAEPAADQFTVTLGTDGERAISEKAAAGLFVRPSSA |
| Ga0210382_100106531 | 3300021080 | Groundwater Sediment | ELKSAQPAAGQFTVKVDGSEKAIGEKAAAGLFVRPA |
| Ga0182009_108034081 | 3300021445 | Soil | VRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPA |
| Ga0222621_10395501 | 3300021510 | Groundwater Sediment | VPGTTIELRTAEPGGEFTLKVNGDERAIDEKAAAGLFVRPAA |
| Ga0222621_10933451 | 3300021510 | Groundwater Sediment | ELRAAEPAAGQLRVAVDGVEKSIGEKAADGLFVRVG |
| Ga0126371_106636693 | 3300021560 | Tropical Forest Soil | VEVRESQPAAEQLTVRLDGHEQTIAEKAAAGLFVRPSVSK |
| Ga0224712_104889962 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | RAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS |
| Ga0247794_100597251 | 3300024055 | Soil | VPGTKLELRDAQPAAGQFTVRRNGEDQAIGEKAAAGLFVKRG |
| Ga0247794_102522882 | 3300024055 | Soil | QVSSAEPAAGQVTVKLNGDERSIGERAAGGLFVRPA |
| Ga0247693_10641982 | 3300024181 | Soil | EVRETQPAADQLTVRLNDHEQTIAEKAAAGLFVRPG |
| Ga0247690_10020351 | 3300024287 | Soil | RTAEPAADQFTVSIEKVGERAISEKAAAGLFVRPS |
| Ga0209584_102127542 | 3300025878 | Arctic Peat Soil | PGQEIEMRSAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPAAA |
| Ga0209584_103989761 | 3300025878 | Arctic Peat Soil | SAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPAAA |
| Ga0207699_109372222 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | QEIEMRRAEPAADQFTVALINGGGNDERAISEKAAAGLFVKPA |
| Ga0207707_101679333 | 3300025912 | Corn Rhizosphere | LRAAEPAAGQFRVTVNDDEKAIGEKAADGLYVRRG |
| Ga0207694_102272151 | 3300025924 | Corn Rhizosphere | VELRAAEPAAGQFRVAVGGVEKAIGEKAAGGLFVRR |
| Ga0207687_104317712 | 3300025927 | Miscanthus Rhizosphere | KLQVSSAEPAAGQVTVKLNGDERSIGERAAGGLFVRPA |
| Ga0207700_113615681 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ELRAAEPAAGQFRVVVDGREQSVGEKAADGLFVKRAA |
| Ga0207669_100348233 | 3300025937 | Miscanthus Rhizosphere | ELELRAAETAAGQFRVAVDGGEKAIGEKAAAGLFVKAA |
| Ga0207665_100438674 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AEPAAGQFTVRLNSSTRAVGEKAAAGLFVRRAACADRG |
| Ga0207665_109688011 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RTAASAADQFTVGLDGGERAISEKAAAGLFVRARD |
| Ga0207679_121951842 | 3300025945 | Corn Rhizosphere | TLEVVAAEPAAGQFTITLDGRERAVGDKAAAGLFVRRGS |
| Ga0207667_121602033 | 3300025949 | Corn Rhizosphere | AEVEVRETQPAAEQLTVHLDGHEQTIAEKAAAGLFVRPTG |
| Ga0207640_104303901 | 3300025981 | Corn Rhizosphere | VEVQETQPAADQLTVRLNGHEQTIAEKAAAGLFVRPAG |
| Ga0207640_115100222 | 3300025981 | Corn Rhizosphere | ELQAAQPAAGQFTVKVDGNEKAIGEKAAAGLFVRPT |
| Ga0207998_10353372 | 3300025989 | Rice Paddy Soil | VVRADAAADQFVVRVGDRSRAVSEKAAAGLFVRPG |
| Ga0207674_108008792 | 3300026116 | Corn Rhizosphere | VPGTPLELRAAEPAAGQFRITINGGEKAISEKAAAGLFVKRG |
| Ga0207683_107857082 | 3300026121 | Miscanthus Rhizosphere | EREIEVEAAHPEAGQFTVRLNGDKRAVGDKAAAGLFVRPA |
| Ga0209848_10490592 | 3300026221 | Permafrost Soil | VPGAAVELRAVEAAAGQYRVVVDGREQAIGEKAADGLFVRRAP |
| Ga0209848_10601522 | 3300026221 | Permafrost Soil | MRRAEPAADQFTIGFLDDGTPSSGDRAISEKAAAGLFVKPAA |
| Ga0209805_10638701 | 3300026542 | Soil | VRQAQPAAEQLTVRLNGGERTIAEKAAAGLFVRPA |
| Ga0209689_12236682 | 3300027748 | Soil | EIEIGDPQPAAGQITVRLNGAERAIGEKAAAGLFVKPS |
| Ga0209814_101194042 | 3300027873 | Populus Rhizosphere | RELEVRDCEPAAGQMTVRLNGAERAIGEKAAAGLFVKPA |
| Ga0207428_105015411 | 3300027907 | Populus Rhizosphere | IEVRKAQPSAGQFTVRVNGDERAIGEKAAAGLFVRPAA |
| Ga0209382_113584112 | 3300027909 | Populus Rhizosphere | HVEVRAAHPEAGQFTVTLDGGERAIGEKAAAGLFVRPEG |
| Ga0265337_11800121 | 3300028556 | Rhizosphere | GQEIEMRSAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPSAG |
| Ga0265334_101662012 | 3300028573 | Rhizosphere | QEIEMRSAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPSAG |
| Ga0307276_102154772 | 3300028705 | Soil | ELRAAEPAAGQLRVGVGGAEKAIGDKAAAGLFVRPAA |
| Ga0307295_100851762 | 3300028708 | Soil | EIEVREAHPAAGQVTVKLNGQDRAIGEKAAAGLFVRPA |
| Ga0307309_101073782 | 3300028714 | Soil | EVREAHPAAGQVTVKLNGQDRAIGEKAAAGLFVRPA |
| Ga0307307_100279863 | 3300028718 | Soil | LKSAQPAAGQFTVKVDGSEKAIGEKAAAGLFVRPA |
| Ga0307307_102993422 | 3300028718 | Soil | VPEREIQVEAAHPEAGQFTVRLNGDQRAVSEKAAAGLFVRPA |
| Ga0307315_101004923 | 3300028721 | Soil | ELREAQPAAGQFTVQLNGDERAIGEKAAAGLFVRPD |
| Ga0307318_101149782 | 3300028744 | Soil | IEVREAQPAAGQVTVKLNGQDRAIGEKAAAGLFVRPA |
| Ga0307316_100977471 | 3300028755 | Soil | EVEVREAQPAAEQLTVRLNGGDRTIAEKAAAGLFVRPA |
| Ga0307320_100065721 | 3300028771 | Soil | REAQPAAEQLTVRLNGHEQTIAEKAAAGLFVRPAS |
| Ga0307320_101189242 | 3300028771 | Soil | QLREAQPAAGQFTVKLNGREQAIGEKAAAGLFVKPA |
| Ga0307290_101585402 | 3300028791 | Soil | EVSDAPAKGEFALKVNGDERSIDEKAAAGLFVRAA |
| Ga0307284_100818961 | 3300028799 | Soil | PCTELEVQETQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPA |
| Ga0307284_101474792 | 3300028799 | Soil | EIEVRDAQPAAGQMTVRLNGGDRAIGEKAAAGLFVRPG |
| Ga0307312_103922871 | 3300028828 | Soil | QEIDVRTAASAADQFTVGLDDGERAISEKAAAGLFVRPVPA |
| Ga0307312_106443322 | 3300028828 | Soil | RAAQPAAGQFTVKLNGDERAIGEKAAAGLFVRPAA |
| Ga0247826_107228052 | 3300030336 | Soil | VEVREAQHAADQLKVLLDGRERAISEKAAGGLYVKASS |
| Ga0102757_114809731 | 3300030785 | Soil | TTVELREAGSGADRFTVKVNGDERAIGEKAAAGLFVRPA |
| Ga0308205_10165131 | 3300030830 | Soil | TVELCEAGAGRDQFTVEVDGDERAIGEKAAAGLFVRPA |
| Ga0265314_100637933 | 3300031711 | Rhizosphere | LHAAQPAADQFTVKLDGGERAVSARAAAGLFVRPS |
| Ga0310813_119043661 | 3300031716 | Soil | GAEIQLESAEPAAGQFTVRLNGSTRAVGEKAAAGLFVRRAA |
| Ga0318567_100216211 | 3300031821 | Soil | IELRAAQPAAGQFQIALGGREMAIGEKAAAGLYVRPA |
| Ga0318499_102497331 | 3300031832 | Soil | LEVRAVESAAGQFRVTVGGGEQAIGEKAAAGLYVRPA |
| Ga0306919_100872611 | 3300031879 | Soil | EVRAVESAAGQFRVTVGGGEQAIGEKAAAGLYVRPA |
| Ga0307412_118778872 | 3300031911 | Rhizosphere | TVELRAAPTAGQFTLKVNGGERAIEEKAAAGLFVRPS |
| Ga0308173_117552782 | 3300032074 | Soil | GEVELRAVQRAAGQFTVRLNGADRAIGEKAAAGLFVRAA |
| Ga0335079_104921463 | 3300032783 | Soil | TEVEVREAQPAAEQLTVRLNGDERTIAEKAASGLFVRPA |
| Ga0335070_107087761 | 3300032829 | Soil | AEIVVESAEPAADQFVVLVEGDPRAVSEKAATGLFVRPS |
| Ga0335084_109545432 | 3300033004 | Soil | GTSILVRAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS |
| Ga0370501_0109781_806_931 | 3300034195 | Untreated Peat Soil | PGATVELRAAQPAAGQFRVVLAGNETGIGEKAAAGLFVKRG |
| ⦗Top⦘ |