NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F034606

Metagenome Family F034606

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034606
Family Type Metagenome
Number of Sequences 174
Average Sequence Length 120 residues
Representative Sequence SWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Number of Associated Samples 139
Number of Associated Scaffolds 174

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.15 %
% of genes near scaffold ends (potentially truncated) 99.43 %
% of genes from short scaffolds (< 2000 bps) 90.80 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.276 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.138 % of family members)
Environment Ontology (ENVO) Unclassified
(36.782 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.552 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 39.72%    Coil/Unstructured: 60.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 174 Family Scaffolds
PF00398RrnaAD 1.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 174 Family Scaffolds
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 1.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.28 %
UnclassifiedrootN/A1.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig67310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium603Open in IMG/M
2228664022|INPgaii200_c0578903All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium631Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100857976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1021Open in IMG/M
3300003319|soilL2_10048735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2211Open in IMG/M
3300004019|Ga0055439_10035148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1294Open in IMG/M
3300004156|Ga0062589_101006604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium779Open in IMG/M
3300004156|Ga0062589_101549796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium654Open in IMG/M
3300004156|Ga0062589_102430672All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea541Open in IMG/M
3300004157|Ga0062590_100266974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1303Open in IMG/M
3300004157|Ga0062590_103012127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium505Open in IMG/M
3300004463|Ga0063356_104965499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium572Open in IMG/M
3300004463|Ga0063356_106102141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea516Open in IMG/M
3300004643|Ga0062591_102477498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea545Open in IMG/M
3300005290|Ga0065712_10362713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium773Open in IMG/M
3300005331|Ga0070670_101992717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea535Open in IMG/M
3300005337|Ga0070682_100443924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium992Open in IMG/M
3300005338|Ga0068868_100955716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium782Open in IMG/M
3300005340|Ga0070689_100072527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2691Open in IMG/M
3300005343|Ga0070687_100320858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium990Open in IMG/M
3300005353|Ga0070669_100579060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium938Open in IMG/M
3300005353|Ga0070669_101737374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea544Open in IMG/M
3300005354|Ga0070675_102013672All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea532Open in IMG/M
3300005364|Ga0070673_100456173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1150Open in IMG/M
3300005365|Ga0070688_100137355All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1656Open in IMG/M
3300005365|Ga0070688_101411575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea564Open in IMG/M
3300005444|Ga0070694_101232281All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium628Open in IMG/M
3300005526|Ga0073909_10153848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium961Open in IMG/M
3300005543|Ga0070672_100672028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium906Open in IMG/M
3300005577|Ga0068857_101411584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium677Open in IMG/M
3300005615|Ga0070702_100869905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium703Open in IMG/M
3300005616|Ga0068852_100481237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1234Open in IMG/M
3300005718|Ga0068866_11129254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea563Open in IMG/M
3300005719|Ga0068861_100116978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2144Open in IMG/M
3300005834|Ga0068851_10678280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium633Open in IMG/M
3300005841|Ga0068863_102587059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium516Open in IMG/M
3300005844|Ga0068862_100543688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1108Open in IMG/M
3300006031|Ga0066651_10081631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1591Open in IMG/M
3300006237|Ga0097621_101876785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium572Open in IMG/M
3300006358|Ga0068871_100856292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium840Open in IMG/M
3300006844|Ga0075428_102650703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium511Open in IMG/M
3300006881|Ga0068865_101641041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella578Open in IMG/M
3300006894|Ga0079215_10131626All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1161Open in IMG/M
3300006918|Ga0079216_10333707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales916Open in IMG/M
3300009094|Ga0111539_11374717All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium819Open in IMG/M
3300009094|Ga0111539_12659327All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → Segetibacter koreensis580Open in IMG/M
3300009098|Ga0105245_12615136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium558Open in IMG/M
3300009100|Ga0075418_13160504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium501Open in IMG/M
3300009148|Ga0105243_11070580All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium813Open in IMG/M
3300009156|Ga0111538_10286100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2087Open in IMG/M
3300009156|Ga0111538_13112780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium578Open in IMG/M
3300009176|Ga0105242_12973535All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium524Open in IMG/M
3300009551|Ga0105238_11056740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium834Open in IMG/M
3300009553|Ga0105249_12605330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium578Open in IMG/M
3300009609|Ga0105347_1041133All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1639Open in IMG/M
3300009610|Ga0105340_1364361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium641Open in IMG/M
3300010397|Ga0134124_10776786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium955Open in IMG/M
3300011398|Ga0137348_1078537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium570Open in IMG/M
3300011400|Ga0137312_1084188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium555Open in IMG/M
3300011442|Ga0137437_1121453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium899Open in IMG/M
3300012882|Ga0157304_1004848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1315Open in IMG/M
3300012883|Ga0157281_1008256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1099Open in IMG/M
3300012883|Ga0157281_1030060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium743Open in IMG/M
3300012885|Ga0157287_1052168All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium648Open in IMG/M
3300012885|Ga0157287_1054344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium640Open in IMG/M
3300012885|Ga0157287_1067651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium600Open in IMG/M
3300012891|Ga0157305_10057688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium853Open in IMG/M
3300012893|Ga0157284_10008005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1791Open in IMG/M
3300012893|Ga0157284_10154323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium655Open in IMG/M
3300012895|Ga0157309_10073316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium897Open in IMG/M
3300012895|Ga0157309_10363530All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium507Open in IMG/M
3300012896|Ga0157303_10001867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2813Open in IMG/M
3300012898|Ga0157293_10032231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1063Open in IMG/M
3300012898|Ga0157293_10289256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium536Open in IMG/M
3300012899|Ga0157299_10191845All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium609Open in IMG/M
3300012900|Ga0157292_10244802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium620Open in IMG/M
3300012906|Ga0157295_10031937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1144Open in IMG/M
3300012911|Ga0157301_10443754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium513Open in IMG/M
3300012913|Ga0157298_10331875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium552Open in IMG/M
3300012914|Ga0157297_10473842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium520Open in IMG/M
3300012915|Ga0157302_10465921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium538Open in IMG/M
3300012916|Ga0157310_10141272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium822Open in IMG/M
3300012916|Ga0157310_10546946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium513Open in IMG/M
3300012984|Ga0164309_11139940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium651Open in IMG/M
3300012988|Ga0164306_11550075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium569Open in IMG/M
3300013104|Ga0157370_10912164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium797Open in IMG/M
3300013308|Ga0157375_13058675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea558Open in IMG/M
3300013308|Ga0157375_13269556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea540Open in IMG/M
3300014325|Ga0163163_12884610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium536Open in IMG/M
3300014325|Ga0163163_13268168All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium505Open in IMG/M
3300014326|Ga0157380_12142586All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium622Open in IMG/M
3300014968|Ga0157379_12363985All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium530Open in IMG/M
3300014969|Ga0157376_10490087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1206Open in IMG/M
3300014969|Ga0157376_12392682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium568Open in IMG/M
3300015077|Ga0173483_10404236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium702Open in IMG/M
3300015077|Ga0173483_10816304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium540Open in IMG/M
3300015200|Ga0173480_10030713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2308Open in IMG/M
3300015200|Ga0173480_10598495All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium676Open in IMG/M
3300015200|Ga0173480_10742328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium620Open in IMG/M
3300015200|Ga0173480_10904620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium573Open in IMG/M
3300015201|Ga0173478_10552005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium588Open in IMG/M
3300015201|Ga0173478_10572265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium581Open in IMG/M
3300015259|Ga0180085_1168600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium659Open in IMG/M
3300015373|Ga0132257_101798701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium787Open in IMG/M
3300015373|Ga0132257_103009911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium614Open in IMG/M
3300015374|Ga0132255_102255212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium830Open in IMG/M
3300015374|Ga0132255_105953579All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium516Open in IMG/M
3300017792|Ga0163161_10770019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium806Open in IMG/M
3300018051|Ga0184620_10235622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea613Open in IMG/M
3300018051|Ga0184620_10237513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium610Open in IMG/M
3300018067|Ga0184611_1205484All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium700Open in IMG/M
3300018067|Ga0184611_1252068All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium624Open in IMG/M
3300018074|Ga0184640_10063092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1555Open in IMG/M
3300018081|Ga0184625_10535255All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium585Open in IMG/M
3300018083|Ga0184628_10696423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium507Open in IMG/M
3300018476|Ga0190274_10420172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1305Open in IMG/M
3300018476|Ga0190274_11935803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium685Open in IMG/M
3300018481|Ga0190271_12996753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium567Open in IMG/M
3300019361|Ga0173482_10023089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1792Open in IMG/M
3300019362|Ga0173479_10636451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium564Open in IMG/M
3300020005|Ga0193697_1018324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1727Open in IMG/M
3300020009|Ga0193740_1020118All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1058Open in IMG/M
3300021082|Ga0210380_10131632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1117Open in IMG/M
3300021968|Ga0193698_1007411All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1368Open in IMG/M
3300022737|Ga0247747_1006076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1174Open in IMG/M
3300022870|Ga0247782_1028007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium740Open in IMG/M
3300022886|Ga0247746_1088876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium746Open in IMG/M
3300022898|Ga0247745_1036879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium744Open in IMG/M
3300022899|Ga0247795_1001453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae3989Open in IMG/M
3300022915|Ga0247790_10183246Not Available551Open in IMG/M
3300023057|Ga0247797_1071599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium519Open in IMG/M
3300023066|Ga0247793_1062507All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → Segetibacter koreensis611Open in IMG/M
3300023069|Ga0247751_1000958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3259Open in IMG/M
3300023070|Ga0247755_1069006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium738Open in IMG/M
3300023078|Ga0247756_1015937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1089Open in IMG/M
3300023168|Ga0247748_1025459All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium840Open in IMG/M
3300023263|Ga0247800_1148712All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium504Open in IMG/M
3300023265|Ga0247780_1084939All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium822Open in IMG/M
3300025271|Ga0207666_1039981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium732Open in IMG/M
3300025899|Ga0207642_10182980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1143Open in IMG/M
3300025903|Ga0207680_10314766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1093Open in IMG/M
3300025918|Ga0207662_10095888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1831Open in IMG/M
3300025926|Ga0207659_10762730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium830Open in IMG/M
3300025930|Ga0207701_11126904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium649Open in IMG/M
3300025934|Ga0207686_10137742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1683Open in IMG/M
3300025936|Ga0207670_10340440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter → Flavisolibacter tropicus1185Open in IMG/M
3300025940|Ga0207691_10653097All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium889Open in IMG/M
3300025940|Ga0207691_10676046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium871Open in IMG/M
3300025941|Ga0207711_10058334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavisolibacter3322Open in IMG/M
3300025960|Ga0207651_10412247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1151Open in IMG/M
3300025960|Ga0207651_11374465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium635Open in IMG/M
3300025960|Ga0207651_11829165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium546Open in IMG/M
3300025972|Ga0207668_11031660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium736Open in IMG/M
3300025981|Ga0207640_10878903All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium782Open in IMG/M
3300026041|Ga0207639_11123982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium737Open in IMG/M
3300026075|Ga0207708_10119859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2050Open in IMG/M
3300026116|Ga0207674_10357620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1411Open in IMG/M
3300026121|Ga0207683_10168323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1984Open in IMG/M
3300026121|Ga0207683_11697011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium581Open in IMG/M
3300026142|Ga0207698_10780737All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium956Open in IMG/M
3300027886|Ga0209486_10020970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3054Open in IMG/M
3300027907|Ga0207428_10438211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium953Open in IMG/M
3300027907|Ga0207428_10675414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium740Open in IMG/M
3300028380|Ga0268265_10049533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3160Open in IMG/M
3300028380|Ga0268265_12499919All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea522Open in IMG/M
3300031547|Ga0310887_10032082All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2209Open in IMG/M
3300031858|Ga0310892_10047909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2101Open in IMG/M
3300031892|Ga0310893_10212142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium786Open in IMG/M
3300031908|Ga0310900_11431750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium581Open in IMG/M
3300032000|Ga0310903_10786383Not Available520Open in IMG/M
3300032012|Ga0310902_10042011All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium2182Open in IMG/M
3300032012|Ga0310902_10670172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium696Open in IMG/M
3300032179|Ga0310889_10691410Not Available532Open in IMG/M
3300032211|Ga0310896_10104385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium1274Open in IMG/M
3300033412|Ga0310810_10116545All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium3160Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.17%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.02%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.02%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.45%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.30%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.30%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.30%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.15%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.15%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.15%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.15%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.15%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.57%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.57%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.57%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.57%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022870Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L019-104C-5EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023070Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4EnvironmentalOpen in IMG/M
3300023078Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_039821002124908045SoilGELEGFNDPDAENNSYRFADPEFLDNTISYYRIKAIKTQDNKFKYSKVIQLIGDKAGLQIESLINPFSSQVKFDLISGDEGLVQVQIFDQYQHKLKSANYNLVQGKNKITISNTGNLPAGFYILKV
INPgaii200_057890322228664022SoilSFVTIGEITGYKDPSAETNRYTYVDPELLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKMGSYNLVKGRNSINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
INPhiseqgaiiFebDRAFT_10085797623300000364SoilKVXQLIGDKAGLXXESXXNPFNSHVKFDLISGDDGLVQVEILDQYQHKLKIGSYNLVKGRNKIDILNTDNLPAGFYILRVMSGTDVINRKXIKRG*
soilL2_1004873523300003319Sugarcane Root And Bulk SoilLSWYRLKTVETQNNKYKYSKVVQLIGNDAGLKIESLVNPFKSDVKFDLISGVDGMVSVQLIDMYQHSLKSLNFNLIKGTNKISIANTDNLPAGFYILKVVSGTNIINKKIIKRN*
Ga0055439_1003514813300004019Natural And Restored WetlandsVVGFKNPALETNHYTFNDPEALDNNNISWYRIKAIKTQDNKSKYSKVIQLIGDKAGLKIESLLNPFSSNLKFDLISGDDGLVQVEILDQYQHKLKIGSYTLVKGRNKINIANTDNLPAGFYILRVVSGTNVINRKIIKRN*
Ga0062589_10100660413300004156SoilLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKIGSYNLMKGKNKIDISNTDKLPAGFYILRVISGNHIVNRKIIKKG*
Ga0062589_10154979623300004156SoilYKDPSAETNSYTYVDPELLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKMGSYNLVKGRNSINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0062589_10243067213300004156SoilRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIRRG*
Ga0062590_10026697423300004157SoilVASTSANLSNSSCRFSGGATIALTVDQCSPVLGLDILSFRGRNESNKGVLYWTVSKEEEPIKYEIQKSKDGSRFISIGEVQGFRDPTAEVNNYNYTDPESLDNTLSWYRIKAVKTQTDKYSYSKVIQLIGDKAGFQIESLINPFKSEVKFDLISGVDGLVQVQIIDQYQHRLKTVNYNLVKGKNKITITNTDNLPPGFYILKVISGANVINRKIIKRN*
Ga0062590_10301212713300004157SoilGDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0063356_10496549913300004463Arabidopsis Thaliana RhizosphereYRIKAIKTLDNKYKYSKVIQLIGDKAGFQIESLINPFKSEVKFDLISGVDGLVQIQIIDQYQHRLKTVNYNLVKGKNKIVISNTDNLPAGFYILKVVSGSHDINRKIIKRN*
Ga0063356_10610214113300004463Arabidopsis Thaliana RhizosphereTDKYSYSKVIQLIGDKAGFQIESLINPFKSEVKFDLISGVDGLVQVQIIDQYQHRLKTVNYNLVKGKNKITITNTDNLPPGFYILKVISGANVINRKIIKRN*
Ga0062591_10247749813300004643SoilNTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0065712_1036271323300005290Miscanthus RhizosphereYTYVDPELLDNTLSWYRIKAIKTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHKLKMGSYNLVKGRNTINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0070670_10199271713300005331Switchgrass RhizosphereRYTYIDPESLDNTIAWYRIKAIKMQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070682_10044392423300005337Corn RhizosphereYKDPSAETNHYTYVDPEPLDNTISWYRIKAVKTQDNKSIYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGLVQVEILDQYQHTLKRGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG*
Ga0068868_10095571623300005338Miscanthus RhizosphereYRIKAINTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070689_10007252713300005340Switchgrass RhizosphereINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070687_10032085813300005343Switchgrass RhizosphereSWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070669_10057906013300005353Switchgrass RhizosphereQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070669_10173737413300005353Switchgrass RhizosphereIGEITGYKDPSAEINRYTYVDPELLDNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLVSGDDGLVQVDILDQYQHKVKSVSYNLVKGRNRINIDNTDNLPAGFYILRVVSDNNVINRKIIKRG*
Ga0070675_10201367213300005354Miscanthus RhizosphereESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070673_10045617313300005364Switchgrass RhizospherePELLDNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070688_10013735533300005365Switchgrass RhizosphereFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINMDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0070688_10141157513300005365Switchgrass RhizosphereLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070694_10123228113300005444Corn, Switchgrass And Miscanthus RhizosphereDPESLDNTIAWYRIKAIKMQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0073909_1015384823300005526Surface SoilKSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLIQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0070672_10067202813300005543Miscanthus RhizospherePEPLDNTISWYRIKAVKTQDNKSIYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGSAQVEILDQYQHKVKTGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG*
Ga0068857_10141158423300005577Corn RhizosphereDPCGALLDVDILSFKGKNENSTATLYLTTSKEEEPVKYEIQKSKDGSRFVTIGEVIGFKDPSAETNQYTYVDPEPLDNTLSWYRIKAIKTQNNKFKYSKVIQMIGDKAGLQIESLINPFSSHVKFDLISGNDGLVQVEILDQYQHKLKIGSYNLMKGRNKIDIANTNTLPAGFYILRVISGNNIVNRKIIKKG*
Ga0070702_10086990533300005615Corn, Switchgrass And Miscanthus RhizosphereYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRIISDNNVINRKIIKRG*
Ga0068852_10048123713300005616Corn RhizosphereQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0068866_1112925413300005718Miscanthus RhizosphereKEQEPVKYEIQKSKEGSRFVKIGEIAGYKDPSAETNRYTYVDPELLDNTLSWHRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0068861_10011697813300005719Switchgrass RhizosphereWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0068851_1067828013300005834Corn RhizosphereNSHVKFDLISADDGLVQVEILDQYQHTLKRGSYNLVKGRNRINIDNTDKFPAGFYILRVISNNNVINRKIIKRG*
Ga0068863_10258705923300005841Switchgrass RhizosphereINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0068862_10054368813300005844Switchgrass RhizosphereQGFKNAASDLNNYSYTDPESLENTLSWYRIKALKTQSNKFKYSKVIQLIGDKAGLQIESLVNPFKSEIKFDIISGVEGLAQVQVLDQYQHKLISASYNLVKGKNQITVTNTDNLPAGFYILRLNSGISVINKKIIKRN*
Ga0066651_1008163113300006031SoilIESLINPFNSHVKFDLISGDDGLIQVEILDQYQHRLKFGSYNLIKGRNRINIDNTDNLPAGFYILRVTSNNNVINRKIIKRG*
Ga0097621_10187678513300006237Miscanthus RhizosphereFNSHVKFDLISGDDGLVKVEILDQYQHRLKFGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG*
Ga0068871_10085629233300006358Miscanthus RhizosphereNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0075428_10265070323300006844Populus RhizosphereLDNTLSWYRIKAIKTQNNKFKYSKVIQMIGDKAGLQIESLINPFSSHVKFDLISGDDGLAQIEILDQYQHKLKVGSYNLLKGKNRIDIANTNKLPAGFYILRVVSGNNIINRKIIKKG*
Ga0068865_10164104113300006881Miscanthus RhizosphereSNKSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0079215_1013162633300006894Agricultural SoilYFEKIGELEGFKHPDAENNSYHFTDPEFLDNTISYYRIKEIKTQDNKFKYTKVIQLIGDKAGLQIESLINPFNSNVKFDLISGDDGFVQVDILDQYQHKVKVASYNLVKGRNRINIDNTENLPAGFYILRVTSNNNVINRKIIKRG*
Ga0079216_1033370713300006918Agricultural SoilIKTLENKYQYTKVIQLIGNDAGLQIESLLNPFSAQVQFDLISGIEGPVNVFILDQYQHVLKTGAYSLNKGRNRINIANTNSLPAGFYILKIVSGDIIINRKIIKKD*
Ga0111539_1137471723300009094Populus RhizosphereSKVIQLIGDKAVLQIVSLINPFNSHVNFDLISGDDGLVQVEILDQYQHTLKMGTYNLVKGRNRINIDNTDKLPAGFYILRIISDNNVINRKIIKRG*
Ga0111539_1265932713300009094Populus RhizosphereSFKGKNENNTATLYLTTSKEEEPVKYEIQKSKDGSRFVTIGEITGFKDPSAETNHYTYVDPEQLDNTLSWYRIKAIKTQNNKFKYSKVIQMIGDKAGLQIESLINPFSSHVKFDLISGDDGLAQIEILDQYQHKLKVGSYNLLKGKNRLDIANTNKLPAGFYIL*
Ga0105245_1261513613300009098Miscanthus RhizosphereQKSKDASSFITIGEITGYKDPSAEINHYTYVDPEMLDNNLSWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHIKFDLISGDDGLVKVEILDQYQHKLKIGGYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0075418_1316050423300009100Populus RhizosphereVDPELLDNTLSWYRIKAIKTQNNKFKYSKVIQMIGDKAGLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKIGSYNLMKGKNKIDIANTDKLPAGFYILRVISGNNIVNRKIIKKG*
Ga0105243_1107058023300009148Miscanthus RhizosphereYRIKEIKTQSNKSKFSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0111538_1028610013300009156Populus RhizosphereEPVTYEIQRSKNGIYFEKIGELAGYKHPDTENNSYQFTDPEFLDNTIRYYRIKAIKPQDNKFKYTKVIQLIGDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGTYNLVKGRNRINIDNTDKLPAGFYILRIISDNNVINRKIIKRG*
Ga0111538_1311278013300009156Populus RhizosphereKGKNENNTATLYLTTSKEEEPVKYEIQKSKDGSRFVTIGEITGFKDPSAETNHYTYVDPEQLDNTLSWYRIKAIKTQNNKFKYSKVIQMIGDKAGLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKIGSYNLMKGKNKIDIANTDKLPAGFYILRVVSGNNIINRKIIKKG*
Ga0105242_1297353513300009176Miscanthus RhizosphereQSNKSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHRLKFGTYNLIKGRNRINIDNTDNLPAGFYILRVTSNNNVTNRKIIKRG*
Ga0105238_1105674023300009551Corn RhizosphereGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0105249_1260533013300009553Switchgrass RhizosphereSNKSKFSKVVQLIGDKAGLQIESLINPFNSYVKFDLISGDDGLVQVEILDQYQHRLRHGSYNLVKGRNRINIDNTDNLPAGFYILRVTSNNNVINRKIIKRG*
Ga0105347_104113313300009609SoilIQKSKDGSSFVTIGEITGYKDPSAETNRYTYVDPELLDNTLSWYRIKEIKTQSNKSKYSKVVQLIGDKAGLQIESLINPFNSNVKFDLISGDDGLVQVEILDQYQHKLKIGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG*
Ga0105340_136436113300009610SoilKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNLLKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0134124_1077678613300010397Terrestrial SoilRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINMDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0137348_107853713300011398SoilINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEIIDQYQHTLKIGNYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0137312_108418813300011400SoilITGYKDPSAETNRYTYVDPEMLDNTLSWYRIKEIKTQSNKSKYSKVVQLIGDKAGLQIESLINPFNSNVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNLVKGRNRINIGNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0137437_112145323300011442SoilEVVGFKNPSLETNHYTFNDPEALDNNNITWYRIKAIKTQNNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0157304_100484833300012882SoilKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGNYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157281_100825613300012883SoilIGEMEGFKHPDAENNSYRFADPELLDNTISYYRIKTIKTQDNKFKYTKVIQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0157281_103006023300012883SoilNSHVKFDLVSGDDGLVQVEIIDQYQHTLKMGTYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157287_105216813300012885SoilTYTDPELLDNTVSWYRIKEIKTQSNKSKFSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKVGNYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157287_105434413300012885SoilPSAETNYYSYVDPESLDNTLSWYRIKAIKTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKKGSYNLVTGRNNINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0157287_106765113300012885SoilETNLYIYADPELLDNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNTHVKFDLVSGDDGLVQVEILDQYQHTLKIGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157305_1005768813300012891SoilKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157284_1000800533300012893SoilSAETNRYTFIDPEFLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFNSYVKFDLVSGDEGLVQVEIIDQYQHTLKMKSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0157284_1015432323300012893SoilVKYEIQKSKGAGSFITIGEITGYKDPSAETNRYTYVDPELLDNTLSWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKIGNYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157309_1007331623300012895SoilFVKIGEITGYKDPSAETNRYTYTDPELLDNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLVSGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157309_1036353013300012895SoilVKYEIQKSKEGSRFVKIGEIAGYKDPSAETNRYTYVDPELLDNTISWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKVKMGSYNLVKGRNNINIGNTDKLPAGFYILRVTSNNSVINRKIIKRG*
Ga0157303_1000186713300012896SoilETNRYTYTDPELLDNTVSWYRIKEIKTQSNKSKFSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157293_1003223113300012898SoilSLDNTLSWYRIKAIKTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKKGSYNLVTGRNNINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0157293_1028925613300012898SoilFVKIGEITGYKDPSAETNRYTYVDPELLDNTISWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHIKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157299_1019184513300012899SoilRYTYVDPELLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNIINRKIIKRG*
Ga0157292_1024480223300012900SoilPVKYEIERSKDASSFVTIGEITGYKDPSAETNRYTYTDPELLDNTVSWYRIKEIKTQSNKSKFSKVVQLIGDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKVGNYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157295_1003193713300012906SoilVAIGEITGFKNPSAETNYYSYADPESLDNTLSWYRIKAIKTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKKGSYNLVTGRNNINIDNTDKLPAGFYILRVTSNNHVINRKIIKRG*
Ga0157301_1044375413300012911SoilINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0157298_1033187513300012913SoilVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157297_1047384213300012914SoilKYEIQKSKDGSRFVKIGEVTGYKDPSAETNFYTYADPELLDNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNLVKGRNRINIDNTNKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157302_1046592123300012915SoilENNSYQFTDPELLDNTIRYYRIKAIKPQDNKSKYTKVIQLIGDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKMIKRG*
Ga0157310_1014127213300012916SoilNSHVKFDLISGDDGLVQVEILDQYQHKLKVGNYNLVKGRNRINIENTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157310_1054694613300012916SoilKDASSFVTIGEIVGYKDPSVETNRYTYIDPELLDNTISWYRLKEINTLDNKLRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKRGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG*
Ga0164309_1113994013300012984SoilYEIQKSKETGSFVTIGEISGYKDPSAETNHYTYVDPEPLDNTISWYRIKAVKTQDNKSIYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGLVQVEILDQYQHTLKRGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG*
Ga0164306_1155007513300012988SoilGEIRGYKDPSAETNHYTYVDPEPLDNTISWYRIKAVKTQDNKSIYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGLVQVEILDQYQHTLKRGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG*
Ga0157370_1091216413300013104Corn RhizosphereSLDNTIAWYRIKAIKTQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLIQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157375_1305867513300013308Miscanthus RhizosphereNNSYQFTDPENLDNTIRYYRIKAIKPQDNKSKYSKVVQLIGDKAGLKIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHRLKFGTYNLVKGRNRINIDNTDKLPAGLYILRIASNNNVINRKIIKRG*
Ga0157375_1326955613300013308Miscanthus RhizosphereRNENNNGVLQWTVSKEEEPVKYEIQKSKDGSRFETIGTVAGFKNPAAELNSYVFTDPELLDNTLSWYRIKAIKTQNNKIKYSKVIQLIGNDAGLQIESLINPFKSQIKFDLISGVEGMVQVQVIDQYQHVLKAANFNLFKGTNKLSILNTDNFPAGFYILKITSGVNVINKKIIKRN*
Ga0163163_1288461013300014325Switchgrass RhizosphereQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0163163_1326816813300014325Switchgrass RhizosphereFNDPEPLDNSISWYRIKAIKTQDNKSRYSKTIQLIGDKAGLQIESLINPFNSNVKFDLISGEDGLVQVEILDQYQHKLKMGSYTLVKGRNKINIANTDNLPAGFYILRVVSGTNIINRKIIKRN*
Ga0157380_1214258633300014326Switchgrass RhizosphereAWYRIKAIKMQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKVGNYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0157379_1236398513300014968Switchgrass RhizosphereNTLSWYRIKEIKTQSNKSKFSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVLNRKIIKRG*
Ga0157376_1049008723300014969Miscanthus RhizosphereSKEQEPVKYEIQKSKEGSRFVKIGEITGYKDPSAETNRYTYVDPELLDNTISWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVLNRKIIKRG*
Ga0157376_1239268213300014969Miscanthus RhizosphereRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0173483_1040423623300015077SoilQLIGDKAGLQIESLINPFNSHVKFDLVSGDDGLVQVEILDQYQHTLKIGNYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0173483_1081630413300015077SoilTATLYLTTSREEEPVTYEIQKSKDGSRFVAIGEITGFKNPSAETNYYSYVDPESLDNTLSWYRIKAIKTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKKGSYNLVTGRNNINIDNTDKLPAGFYILRVTSNNHVINRKIIKRG*
Ga0173480_1003071343300015200SoilSKEDEPVKYEIQKSKNASSFVTIGEITGYKDPSAETNRYTYVDPELLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKNGSYNLVKGRNNINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0173480_1059849513300015200SoilSKEQEPVKYEIQKSKNGSRFVKIGEITGYKDPSAEINRYTYVDPELLDNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHKLKVGNYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0173480_1074232823300015200SoilLDNTVSWYRIKEIKTQSNKSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLVSGDDGLVQVDILDQYQHKLKSVSYNLVKGRNRINIDNTDKLPA
Ga0173480_1090462013300015200SoilTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0173478_1055200513300015201SoilGYKDPSAETNRYTYIDPEFLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLVSGDEGLVQVEIIDQYQHQLKMKSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0173478_1057226513300015201SoilKVIQLIGDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSLSFNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG*
Ga0180085_116860013300015259SoilDPALELNNYTYADPESLDNTLSWYRIKAIKTQSNKYKYSKVIQLIGDKAGLQIESLINPFKSQVKFDLISGDDGLVQVQILDQYQHKLKSASYNLVKGKNKITIANTDNLPAGFYILRVISGNNVINRKIIKRN*
Ga0132257_10179870113300015373Arabidopsis RhizosphereEIQKSKDASSFVTIGEIAGYKDPSAETNRYSYVDPELLDNTLSWYRIKAIKTQDNKHKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLIQVEILDQYQHRLKLGSYNLVKGRNSINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0132257_10300991123300015373Arabidopsis RhizosphereKYEIQKSKDGSSFVTIGEITGYKDPSAEINRYTYTDPDLLDNTLSWYRIKEIKTQSNKSKFSKVVQLIGDKAGLQIETLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKKGSYNLVKGRSRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0132255_10225521223300015374Arabidopsis RhizosphereQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKKGSYNLVKGRSRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG*
Ga0132255_10595357923300015374Arabidopsis RhizosphereLKIESLINPFSSNVKFDLISGDDGLAQVEILDQYQHKLKIGSYTLVKGRNRINIASTDNLPAGFYILRVISGNNIVNRKIIKRG*
Ga0163161_1077001923300017792Switchgrass RhizosphereAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0184620_1023562213300018051Groundwater SedimentWYRIKAIKTQDNKYRYSKVVQLIGDKAGLKLESLINPFNSQVTFNLISGNDALAHVEILDQYSHTLRSGNYNIMKGRNNVTITNTNNFPAGIYILRINSGNTIINKKIIKRS
Ga0184620_1023751313300018051Groundwater SedimentNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGTYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0184611_120548413300018067Groundwater SedimentKAIKPQNNKFKYTKVIQLIGDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRIISDNNVINRKIIKRG
Ga0184611_125206813300018067Groundwater SedimentEFLDNTISYYRIKAINTQDNKFKYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKMGNYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIVKRG
Ga0184640_1006309233300018074Groundwater SedimentTYEIQRSKDGSYFEKIGELEGFKHPDAENNSYRFADPEFLDNTISYYRIKAINTQDNKFKYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNLVKGRNRINIDTTDKLPAGFYILRVTSNNNVINRKIVKRG
Ga0184625_1053525513300018081Groundwater SedimentAINTQDNKFKYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKMGNYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIVKRG
Ga0184628_1069642323300018083Groundwater SedimentKTQDNKFKYTKVIQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNLVKGRNKINIDNTDKFPASFYILRVTSNNNVINRKIIKRG
Ga0190274_1042017213300018476SoilTQDSKFKYSKVIQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHTLKIGNYNVVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0190274_1193580323300018476SoilLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLVSGDDGLVQVEILDQYQHTLKRGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0190271_1299675313300018481SoilEKIGELEGFKHPDAENNSYRFADPELLDNTISYYRIKAINTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSNVKFDLISGDDGLVQVEILDQYQHKVKVGSYNLVKGRNRINIDNTEKLPAGFYILRVISDNNVINRKIIKRG
Ga0173482_1002308913300019361SoilGYKDPSAETNRYTYFDPELLDNTISWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0173479_1063645113300019362SoilIYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGLAQVEILDQYQHKVKTGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG
Ga0193697_101832413300020005SoilSWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNKINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0193740_102011823300020009SoilVQGFKDPNSELNNYTYTDPESLDNTLSWYRIKAVKTQSDKYKYSKVIQLIGDKAGLQIESLVNPFKSEIKFDLISGDDGLAQVEILDQYQHALKSFSYNLVKGKNKITITNTDSFPAGFYILRVNSGSAVINKKIIKRN
Ga0210380_1013163233300021082Groundwater SedimentGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHQLKMKSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0193698_100741113300021968SoilSLDNTIAWYRIKAIKMQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHRLKFGTYNLVKGRNRINIDNTDKLPAGLYILRIASNNNVINRKIIKRG
Ga0247747_100607623300022737SoilETNRYTYVDPELLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKMGSYNLVKGRNSINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0247782_102800723300022870Plant LitterEPLDNTISWYRIKAVKTQDNKSIYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGSAQVEILDQYQHKVKTGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG
Ga0247746_108887623300022886SoilLLDNTLSWYRIKAINTQDNKFKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLVSGDDGLVQVDILDQYQHKVKSVSYNLVKGRNRINIDNTDNLPAGFYILRVVSDNNVINRKIIKRG
Ga0247745_103687913300022898SoilKEGSRFVKIGEITGYKDPSAETNRYTYVDPELLDNTISWYRIKVINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0247795_100145313300022899SoilESLINPFNSYVKFDLVSGDEGWVQVEIIDQYQHTLKMKSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0247790_1018324633300022915SoilIESLINPFNSHVKFDLVSGDEGWVQVEIIDQYQHQLKMKSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0247797_107159913300023057SoilNKFKYSKVIQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKKGSYNLVTGRNNINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0247793_106250713300023066SoilSTPSNLSSSSCSFSGGATVTLTVDPCGALLDVGILAFKGKNENNTATLYLTTSREEEPVTYEIQKSKDGSRFVAIGEITGFKNPSAETNYYSYVDPESLDNTLSWYRIKAIKTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKKGSYNLVTGRNNINIDNTDKLPAGFYILRVTS
Ga0247751_100095813300023069SoilKEEGPVKYEIQRSKDASSFVTIGEITGYKDPSAETNRYTYIDPEFLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLVSGDEGWVQVEIIDQYQHQLKMKSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0247755_106900623300023070Plant LitterGATITLNVDPCDFLLDVGILSFKGRNENNQGVLYWTSSKEEEPVKYEIQKSKGAGSFITIGEITGYKDPSAETNRYTYTDPELLDNTVSWYRIKEIKTQSNKSKFSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKVKTGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0247756_101593713300023078Plant LitterNPFNSHVKFDLISGDDGLVQVEILDQYQHKLKVGNYNLVKGRNRINIENTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0247748_102545923300023168SoilIKTQSNKSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDGGLVQVEIIDQYQHTLKIGNYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0247800_114871223300023263SoilAETNYYSYVDPESLDNTLSWYRIKAIKTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSHVRFDLISGDDGLVQVEILDQYQHKLKKGSYNLVTGRNNINIDNTDKLPAGFYILRVTSNNHVINRKIIKRG
Ga0247780_108493913300023265Plant LitterGLQIESLINPFNSHVKFDLISGDDGLVQVEIIDQYQHKLKVGNYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207666_103998113300025271Corn, Switchgrass And Miscanthus RhizosphereDGSRFVKIGEITGYKDPSAETNRYTYVDPELLDNTLSWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHIKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207642_1018298013300025899Miscanthus RhizosphereNTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0207680_1031476613300025903Switchgrass RhizosphereAGRFVTIGEISGYKDPSAETNRYTYIDPESLDNTIAWYRIKAIKMQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINMDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0207662_1009588813300025918Switchgrass RhizosphereRFVKIGEITGYKDPSAETNRYTYVDPELLDNTLSWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHRLKFGTYNLVKGRNRINIDNTDKLPAGLYILRIASNNNVINRKIIKRG
Ga0207659_1076273013300025926Miscanthus RhizosphereIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNKINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207701_1112690413300025930Corn, Switchgrass And Miscanthus RhizosphereRYTYVDPELLDNTLSWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207686_1013774213300025934Miscanthus RhizosphereRIKAIKMQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207670_1034044013300025936Switchgrass RhizosphereKVINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207691_1065309723300025940Miscanthus RhizosphereGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207691_1067604623300025940Miscanthus RhizosphereNRYTYVDPEPLDNTISWYRIKAVKTQDNKSIYTKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGSAQVEILDQYQHKVKTGSYNLVKGRNRINIDNTDKLPAGFYILRVISNNNVINRKIIKRG
Ga0207711_1005833433300025941Switchgrass RhizosphereKDPPAETNRYTYVDPELLDNTISWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207651_1041224713300025960Switchgrass RhizosphereDNTISWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207651_1137446523300025960Switchgrass RhizosphereSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207651_1182916513300025960Switchgrass RhizosphereSAETNLYTYADPELLDNTLSWYRIKAINTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207668_1103166013300025972Switchgrass RhizosphereAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHRLKFGTYNLVKGRNRINIDNTDKLPAGLYILRIASNNNVINRKIIKRG
Ga0207640_1087890323300025981Corn RhizosphereELLDNTLSWYRIKEIKTQSNKSKYSKVVQLIGDKAGLQIESLINPFNSNVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRIISDNNVINRKIIKRG
Ga0207639_1112398213300026041Corn RhizospherePFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINMDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0207708_1011985913300026075Corn, Switchgrass And Miscanthus RhizosphereYEIQKSKNASSFVTIGEITGYKDPSAETNRYTYVDPELLDNTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFSSHVKFDLISGDDGLVQVEILDQYQHKLKMGSYNLVKGRNNINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0207674_1035762013300026116Corn RhizosphereDPCGALLDVDILSFKGKNENSTATLYLTTSKEEEPVKYEIQKSKDGSRFVTIGEVIGFKDPSAETNQYTYVDPEPLDNTLSWYRIKAIKTQNNKFKYSKVIQMIGDKAGLQIESLINPFSSHVKFDLISGNDGLVQVEILDQYQHKLKIGSYNLMKGRNKIDIANTNTLPAGFYILRVISGNNIVNRKIIKKG
Ga0207683_1016832333300026121Miscanthus RhizosphereEAGRFVTIGEISGYKDPSAETNRYTYIDPESLDNTIAWYRIKAIKMQDNNSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0207683_1169701113300026121Miscanthus RhizosphereVTGYKDPSAETNLYTYADPELLDNTLSWYRIKAINTQDNKFKYSKVIQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0207698_1078073713300026142Corn RhizosphereDPSAETNRYTYVDPELLDNTISWYRIKAINTQDNKFRYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGKNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0209486_1002097043300027886Agricultural SoilKVIQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKVKVGSYNLVKGRNRINIDNTEKLPAGFYILRVISDNNVINRKIIKRG
Ga0207428_1043821113300027907Populus RhizosphereSKEASPVTYEIQKSKNGSFFEKIGELEGFKDPNAENNAYRFADPELLDNTISYYRVKAIKTQDNKFKYSKVIQLIGDKAGLQIESLINPFSSHVKFDLISGEEGLVQVQIFDQYQHKLKSASYNLVQGKNKITISNTDNLPAGFYILKVVSGTNIITRKIIKRN
Ga0207428_1067541413300027907Populus RhizosphereDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVEILDQYQHTLKMGTYNLVKGRNRINIDNTDKLPAGFYILRIISDNNVINRKIIKRG
Ga0268265_1004953313300028380Switchgrass RhizosphereGFQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQHKLKSGSYNLVKGRNKINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0268265_1249991913300028380Switchgrass RhizosphereKDASRFVTIGEVQGFKNAASDLNNYSYTDPESLENTLSWYRIKALKTQSNKFKYSKVIQLIGDKAGLQIESLVNPFKSEIKFDIISGVEGLAQVQVLDQYQHKLISASYNLVKGKNQITVTNTDNLPAGFYILRLNSGISVINKKIIKRN
Ga0310887_1003208213300031547SoilSKVIQLIGDKAGLQIESLINPFNSHVKFDLVSGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0310892_1004790913300031858SoilQIESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0310893_1021214223300031892SoilINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0310900_1143175013300031908SoilLQIESLINPFNSHVKFDLISADDGLVQVEILDQYYHKLRIGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0310903_1078638313300032000SoilKYTKVIQLIGDKAGLQIVSLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0310902_1004201133300032012SoilESLINPFNSHVKFDLISGDDGLVQVDILDQYQHKLKSGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0310902_1067017213300032012SoilTLSWYRIKAIKTQDNKPKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISGDDGLVQVEILDQYQRKLKMGSYNLVKGRNSINIDNTDKLPAGFYILRVTSNNNVINRKIIKRG
Ga0310889_1069141023300032179SoilAGLQIESLINPFSSQVKFDLISGDEGLVQVQIFDQYQHKLKSANYNLVQGKNKITISNTDNLPAGFYILKVVSGTNIINRKIIKRN
Ga0310896_1010438513300032211SoilDNTLSLYRIKEIKTQSNKSKYSKVVQLIGDKAGLQIESLINPFNSHVKFDLISADDGLVQVEILDQYYHKLRIGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG
Ga0310810_1011654513300033412SoilIESLINPFNSHVKFDLISGDDGLVKVEILDQYQHKLKIGSYNLVKGRNRINIDNTDKLPAGFYILRVISDNNVINRKIIKRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.