| Basic Information | |
|---|---|
| Family ID | F034364 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 45 residues |
| Representative Sequence | DELRQQYVLAIEAASASEWRRLDVRVKRPSAKVKARSGYFGG |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.71 % |
| % of genes near scaffold ends (potentially truncated) | 97.14 % |
| % of genes from short scaffolds (< 2000 bps) | 95.43 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.286 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF13360 | PQQ_2 | 4.00 |
| PF13519 | VWA_2 | 2.86 |
| PF00072 | Response_reg | 2.29 |
| PF08308 | PEGA | 2.29 |
| PF07883 | Cupin_2 | 2.29 |
| PF00092 | VWA | 1.71 |
| PF00593 | TonB_dep_Rec | 1.71 |
| PF13709 | DUF4159 | 1.71 |
| PF00160 | Pro_isomerase | 1.14 |
| PF04239 | DUF421 | 1.14 |
| PF02687 | FtsX | 1.14 |
| PF13620 | CarboxypepD_reg | 1.14 |
| PF07992 | Pyr_redox_2 | 1.14 |
| PF01627 | Hpt | 1.14 |
| PF00892 | EamA | 1.14 |
| PF13400 | Tad | 0.57 |
| PF00226 | DnaJ | 0.57 |
| PF00675 | Peptidase_M16 | 0.57 |
| PF00654 | Voltage_CLC | 0.57 |
| PF12543 | DUF3738 | 0.57 |
| PF03965 | Penicillinase_R | 0.57 |
| PF00498 | FHA | 0.57 |
| PF00330 | Aconitase | 0.57 |
| PF12681 | Glyoxalase_2 | 0.57 |
| PF12762 | DDE_Tnp_IS1595 | 0.57 |
| PF00999 | Na_H_Exchanger | 0.57 |
| PF13649 | Methyltransf_25 | 0.57 |
| PF13424 | TPR_12 | 0.57 |
| PF00069 | Pkinase | 0.57 |
| PF12704 | MacB_PCD | 0.57 |
| PF04253 | TFR_dimer | 0.57 |
| PF13557 | Phenol_MetA_deg | 0.57 |
| PF00565 | SNase | 0.57 |
| PF13473 | Cupredoxin_1 | 0.57 |
| PF06983 | 3-dmu-9_3-mt | 0.57 |
| PF03652 | RuvX | 0.57 |
| PF13432 | TPR_16 | 0.57 |
| PF13637 | Ank_4 | 0.57 |
| PF06968 | BATS | 0.57 |
| PF08281 | Sigma70_r4_2 | 0.57 |
| PF00583 | Acetyltransf_1 | 0.57 |
| PF01954 | AF2212-like | 0.57 |
| PF02276 | CytoC_RC | 0.57 |
| PF02618 | YceG | 0.57 |
| PF13517 | FG-GAP_3 | 0.57 |
| PF01575 | MaoC_dehydratas | 0.57 |
| PF00561 | Abhydrolase_1 | 0.57 |
| PF07238 | PilZ | 0.57 |
| PF02547 | Queuosine_synth | 0.57 |
| PF06057 | VirJ | 0.57 |
| PF04389 | Peptidase_M28 | 0.57 |
| PF13581 | HATPase_c_2 | 0.57 |
| PF13449 | Phytase-like | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.29 |
| COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 1.14 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 1.14 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.57 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.57 |
| COG3946 | Type IV secretory pathway, VirJ component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.57 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.57 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.57 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.57 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.57 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.57 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.57 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG0816 | YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factor | Translation, ribosomal structure and biogenesis [J] | 0.57 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 0.57 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.57 |
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.29 % |
| Unclassified | root | N/A | 17.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11151099 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300000956|JGI10216J12902_106000563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300001431|F14TB_101317021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300002568|C688J35102_118884310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300002568|C688J35102_119847380 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300004156|Ga0062589_100834910 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300004157|Ga0062590_101671860 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300004606|Ga0068962_1172545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300004633|Ga0066395_10205301 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300004643|Ga0062591_102533473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 540 | Open in IMG/M |
| 3300005093|Ga0062594_103408577 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005293|Ga0065715_10975838 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005332|Ga0066388_103243703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300005353|Ga0070669_100039789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3417 | Open in IMG/M |
| 3300005364|Ga0070673_102181388 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005365|Ga0070688_100691595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300005366|Ga0070659_101670461 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005439|Ga0070711_100736259 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005451|Ga0066681_10329192 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005457|Ga0070662_101879480 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005466|Ga0070685_10763893 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005518|Ga0070699_101714433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300005543|Ga0070672_100283520 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300005546|Ga0070696_101642754 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005549|Ga0070704_100303815 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300005574|Ga0066694_10421762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300005578|Ga0068854_100058331 | All Organisms → cellular organisms → Bacteria | 2786 | Open in IMG/M |
| 3300005615|Ga0070702_100007732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5162 | Open in IMG/M |
| 3300005615|Ga0070702_101619583 | Not Available | 536 | Open in IMG/M |
| 3300005713|Ga0066905_101483572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300005713|Ga0066905_101822003 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005718|Ga0068866_10744191 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005764|Ga0066903_108895281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 509 | Open in IMG/M |
| 3300005842|Ga0068858_100158715 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
| 3300005842|Ga0068858_101564866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300005844|Ga0068862_101070986 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005844|Ga0068862_101342597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005844|Ga0068862_102278476 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006058|Ga0075432_10473653 | Not Available | 553 | Open in IMG/M |
| 3300006163|Ga0070715_10375380 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300006169|Ga0082029_1384370 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006358|Ga0068871_100934709 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300006844|Ga0075428_102426067 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006845|Ga0075421_101211068 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300006852|Ga0075433_10199604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1779 | Open in IMG/M |
| 3300006881|Ga0068865_100292647 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300006881|Ga0068865_101786559 | Not Available | 555 | Open in IMG/M |
| 3300006904|Ga0075424_100635293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
| 3300009090|Ga0099827_11677588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300009098|Ga0105245_10266165 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300009098|Ga0105245_12765926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300009147|Ga0114129_10757399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14 | 1242 | Open in IMG/M |
| 3300009162|Ga0075423_10828377 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300009162|Ga0075423_10907743 | Not Available | 934 | Open in IMG/M |
| 3300009176|Ga0105242_10371564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300009176|Ga0105242_12238804 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009177|Ga0105248_12425936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300009545|Ga0105237_12739280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300009553|Ga0105249_10210878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1906 | Open in IMG/M |
| 3300009840|Ga0126313_11776408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010038|Ga0126315_11019727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300010043|Ga0126380_11558644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300010046|Ga0126384_11733526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300010047|Ga0126382_12278276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300010333|Ga0134080_10118247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
| 3300010359|Ga0126376_12620640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300010362|Ga0126377_10813350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300010362|Ga0126377_13485416 | Not Available | 509 | Open in IMG/M |
| 3300010366|Ga0126379_10606446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1181 | Open in IMG/M |
| 3300010373|Ga0134128_13204590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300010397|Ga0134124_10785613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300010398|Ga0126383_12323875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300010399|Ga0134127_13487525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14 | 515 | Open in IMG/M |
| 3300010400|Ga0134122_11076782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300010403|Ga0134123_11546036 | Not Available | 709 | Open in IMG/M |
| 3300011079|Ga0138569_1035811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300011269|Ga0137392_11081783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300012010|Ga0120118_1160380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300012203|Ga0137399_11176317 | Not Available | 646 | Open in IMG/M |
| 3300012206|Ga0137380_10730604 | Not Available | 858 | Open in IMG/M |
| 3300012212|Ga0150985_111475401 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012361|Ga0137360_11782292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300012384|Ga0134036_1016195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300012469|Ga0150984_100806446 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012532|Ga0137373_10877223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300012684|Ga0136614_10279670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300012900|Ga0157292_10392259 | Not Available | 524 | Open in IMG/M |
| 3300012916|Ga0157310_10341417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 602 | Open in IMG/M |
| 3300012929|Ga0137404_12175835 | Not Available | 518 | Open in IMG/M |
| 3300012957|Ga0164303_10234782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300012958|Ga0164299_10124262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1385 | Open in IMG/M |
| 3300012961|Ga0164302_10822390 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012971|Ga0126369_13710722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300012987|Ga0164307_10529441 | Not Available | 896 | Open in IMG/M |
| 3300013296|Ga0157374_10637667 | Not Available | 1077 | Open in IMG/M |
| 3300013296|Ga0157374_12425709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300013306|Ga0163162_11079844 | Not Available | 909 | Open in IMG/M |
| 3300014154|Ga0134075_10528474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300014968|Ga0157379_12402677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300014969|Ga0157376_11508932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 705 | Open in IMG/M |
| 3300015077|Ga0173483_10645466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300015372|Ga0132256_102467443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14 | 622 | Open in IMG/M |
| 3300015373|Ga0132257_103357286 | Not Available | 583 | Open in IMG/M |
| 3300015374|Ga0132255_103126094 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300017656|Ga0134112_10372915 | Not Available | 585 | Open in IMG/M |
| 3300017792|Ga0163161_12074812 | Not Available | 505 | Open in IMG/M |
| 3300018053|Ga0184626_10426935 | Not Available | 525 | Open in IMG/M |
| 3300018466|Ga0190268_11543988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300018469|Ga0190270_11292348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300018469|Ga0190270_12178771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300018476|Ga0190274_12785677 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300018476|Ga0190274_13911004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300019377|Ga0190264_11105860 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300019377|Ga0190264_11910405 | Not Available | 540 | Open in IMG/M |
| 3300019377|Ga0190264_12086482 | Not Available | 523 | Open in IMG/M |
| 3300021178|Ga0210408_10505250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300021861|Ga0213853_10390446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300022756|Ga0222622_10987900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300022756|Ga0222622_11002363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300024055|Ga0247794_10283204 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025899|Ga0207642_10516344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300025904|Ga0207647_10019938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4502 | Open in IMG/M |
| 3300025907|Ga0207645_10154567 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300025913|Ga0207695_11014492 | Not Available | 709 | Open in IMG/M |
| 3300025918|Ga0207662_10663004 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300025919|Ga0207657_11513805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300025923|Ga0207681_11179276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300025930|Ga0207701_10427550 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1139 | Open in IMG/M |
| 3300025932|Ga0207690_11387718 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300025936|Ga0207670_11861148 | Not Available | 512 | Open in IMG/M |
| 3300025937|Ga0207669_11855605 | Not Available | 515 | Open in IMG/M |
| 3300025938|Ga0207704_11133487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300025938|Ga0207704_11262758 | Not Available | 631 | Open in IMG/M |
| 3300025938|Ga0207704_11873591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300025941|Ga0207711_10497967 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300025949|Ga0207667_11013491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300025960|Ga0207651_10187423 | Not Available | 1647 | Open in IMG/M |
| 3300025961|Ga0207712_10961360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300025986|Ga0207658_11292621 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300026023|Ga0207677_10697865 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300026035|Ga0207703_12236292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300026118|Ga0207675_101341940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300026310|Ga0209239_1050631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1874 | Open in IMG/M |
| 3300026535|Ga0256867_10137094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300027682|Ga0209971_1033197 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300027909|Ga0209382_10334983 | Not Available | 1699 | Open in IMG/M |
| 3300027910|Ga0209583_10226158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300028380|Ga0268265_11086948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300031198|Ga0307500_10027155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
| 3300031228|Ga0299914_10193331 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
| 3300031228|Ga0299914_10212677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1714 | Open in IMG/M |
| 3300031547|Ga0310887_10012775 | All Organisms → cellular organisms → Bacteria | 3124 | Open in IMG/M |
| 3300031548|Ga0307408_101284225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300031716|Ga0310813_11048733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300031722|Ga0311351_10388177 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031740|Ga0307468_102262123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300031744|Ga0306918_11020942 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031847|Ga0310907_10642758 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031901|Ga0307406_11474089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300031903|Ga0307407_11322432 | Not Available | 566 | Open in IMG/M |
| 3300031908|Ga0310900_11100885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300031908|Ga0310900_11232071 | Not Available | 623 | Open in IMG/M |
| 3300031911|Ga0307412_11596257 | Not Available | 595 | Open in IMG/M |
| 3300031995|Ga0307409_100702293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300032000|Ga0310903_10425400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300032002|Ga0307416_103681504 | Not Available | 513 | Open in IMG/M |
| 3300032005|Ga0307411_10053015 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2655 | Open in IMG/M |
| 3300032005|Ga0307411_10092136 | Not Available | 2119 | Open in IMG/M |
| 3300032010|Ga0318569_10521269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300032174|Ga0307470_11626989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300032179|Ga0310889_10556049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300032515|Ga0348332_10986535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300032782|Ga0335082_10686650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300032955|Ga0335076_11150240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300033413|Ga0316603_11236014 | Not Available | 707 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.43% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.14% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.14% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.57% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.57% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.57% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.57% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_111510991 | 3300000890 | Soil | RQQYVLAIEAANIPEWRRLQVRVRQPSATVKARSGYFGG* |
| JGI10216J12902_1060005631 | 3300000956 | Soil | LVHQLRQQYVLAIEAASGPEWRRLDVRVKRSSARVKARSGYYGG* |
| F14TB_1013170211 | 3300001431 | Soil | LAIEAANGREWRRLDVRVRRPSTSVKARSGYFAG* |
| C688J35102_1188843101 | 3300002568 | Soil | TETIVAASSLVDSLRQQYVLAIEAAGAREWRRLDIRVKHAAATVKARSGYFGG* |
| C688J35102_1198473801 | 3300002568 | Soil | RERYVIAIEAADSREWRRLEVRVRRSSATVRARSGYFGG* |
| Ga0062589_1008349102 | 3300004156 | Soil | SSLVETATVATTLVNDLRQQYVLAIEAAREREWRRLDVRVRRPSARVKARSGYYAG* |
| Ga0062590_1016718602 | 3300004157 | Soil | LRQQYVLAIEAANGREWRRLDVRVRRPSTVVKARSGYFAG* |
| Ga0068962_11725451 | 3300004606 | Peatlands Soil | VVASNLVNQLRLQYVLAIQAGDGPEWRRLDVRVTRHSAIVKARSGYFGG* |
| Ga0066395_102053011 | 3300004633 | Tropical Forest Soil | RQQYVLAIEAATGQQWRHLEVRVRRPSTFVKARNGYFAG* |
| Ga0062591_1025334731 | 3300004643 | Soil | ETTTAAVGLVSELRQQYVIAIEAVTAREWRRLDVRVKRPSAVVRARNGYYGG* |
| Ga0062594_1034085772 | 3300005093 | Soil | SNLTETTTAAVGLVAELRQQYVIAIEAVAAREWRRLDVRVKRPSAIVRARNGYYGG* |
| Ga0065715_109758381 | 3300005293 | Miscanthus Rhizosphere | TIVVASSIVDELRQQYVLAIEAAVGREWRRLDVRVVKNPSAAPTVRTRSGYFGG* |
| Ga0066388_1032437032 | 3300005332 | Tropical Forest Soil | RQQYVLAIEAARAREWRRLDVRVKNPSTTVKARSGYFGG* |
| Ga0070669_1000397897 | 3300005353 | Switchgrass Rhizosphere | ASTSLIDGLRQQYVLAIEAASGREWRRLDVRVRRPSTVVKARSGYFAG* |
| Ga0070673_1021813881 | 3300005364 | Switchgrass Rhizosphere | GNVLSELRQQYVLAIEAANTREWRRLEVRVKRSSASVKARSGYFGG* |
| Ga0070688_1006915952 | 3300005365 | Switchgrass Rhizosphere | NLVSELRQHYVLAIEAASAREWRRLDVRVRQPRAVVMARSGYFGG* |
| Ga0070659_1016704611 | 3300005366 | Corn Rhizosphere | LRQQYVLAIEAANTPEWRRLEVRVKRSSASVKARSGYFGG* |
| Ga0070711_1007362592 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LVETVVGASTLIDELRQQYVLAIEAASGAEWRRLDVRVRRPSTFVKARNGYFAG* |
| Ga0066681_103291922 | 3300005451 | Soil | ELRQQYVLAIEAASAREWRRLDVRVRRPSTTVKARSGYFAG* |
| Ga0070662_1018794801 | 3300005457 | Corn Rhizosphere | RQQYVLAIEAAAGREWRRLDVRVKRPSTVVKARSGYFAG* |
| Ga0070685_107638933 | 3300005466 | Switchgrass Rhizosphere | DGLRQQYVLAIEAASGREWRRLDVRVRRPSTVVKARSGYFAG* |
| Ga0070699_1017144331 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ETIVAASNLVAELRQKYLLAIEAASDHEWRRLDVRVRRPSTVVKARTGYFGG* |
| Ga0070672_1002835201 | 3300005543 | Miscanthus Rhizosphere | ETVLASTQLIDGLRQQYVIAIEAANSREWRRLDVRVRRPSTVVKARAGYFAG* |
| Ga0070696_1016427542 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LVDELRQQYVLAIEAASANEWRRLDVRVKRPSARVKARSGYFGG* |
| Ga0070704_1003038152 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDELRQQYVLAIEAANGGEWRRLDVKVKNPSAVVKARSGYFAG* |
| Ga0066694_104217622 | 3300005574 | Soil | SLVDELRQQYVLAIEAASVNEWRRLDVRVKRPSAKVKARSGYFGG* |
| Ga0068854_1000583314 | 3300005578 | Corn Rhizosphere | LAIEAASANEWRKLDIRVKRKTARVKARSGYYGG* |
| Ga0070702_1000077328 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ATTLVQELRQQYVLAIEAASANEWRKLDIRVKRKTARVKARSGYYGG* |
| Ga0070702_1016195832 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LRQQYVLAIEAAPSTEWRRLDVRVKRAAAKVKARSGYFGG* |
| Ga0066905_1014835722 | 3300005713 | Tropical Forest Soil | TVTAAAALVAELRQQYVLAIEAAPEREWRRLDVRVRRRSAVVKARSGYYGG* |
| Ga0066905_1018220031 | 3300005713 | Tropical Forest Soil | PGETVAASTQLIDGLRQQYVLAIEAAIGREWRRLDVRVRRPSTVVKARSGYFAG* |
| Ga0068866_107441912 | 3300005718 | Miscanthus Rhizosphere | DELRQQYVLSIEAAGVKEWRRLDVRVKRPAAKVKARSGYYGG* |
| Ga0066903_1088952811 | 3300005764 | Tropical Forest Soil | LAIEAASAREWRRLDVRVKHPAANVKARSGYFGG* |
| Ga0068858_1001587151 | 3300005842 | Switchgrass Rhizosphere | RLIDGLRQQYVLAIEAANSGEWRRLDVRVRRPSTFVKARSGYFAG* |
| Ga0068858_1015648662 | 3300005842 | Switchgrass Rhizosphere | TVVSELRLQYVLAIEAAGAHEWRRLDVRVKHPSAVVKARSGYFGG* |
| Ga0068862_1010709861 | 3300005844 | Switchgrass Rhizosphere | STSLIDGLRQQYVLAIEAASGREWRRLDVRVRRPSTVVKARSGYFAG* |
| Ga0068862_1013425972 | 3300005844 | Switchgrass Rhizosphere | QQYVLAIEAASSREWRRLDVRVRRPSAIVKARSGYFAG* |
| Ga0068862_1022784761 | 3300005844 | Switchgrass Rhizosphere | LRQQYVLSIEAASTPEWRRLDVRVKTPSAVVKARSGYFGG* |
| Ga0075432_104736532 | 3300006058 | Populus Rhizosphere | VKELRQQYVLAIEAAPANEWRKLDIRVKRKTAKVKARSGYYGG* |
| Ga0070715_103753802 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAANLIGELRQQYVLAIEAANGPEWRRLDVRVVRRPSTIVKARSGYYGG* |
| Ga0082029_13843701 | 3300006169 | Termite Nest | YVIAIEAVAGREWRRLDVRVKRPSAVVRARNGYYGG* |
| Ga0068871_1009347091 | 3300006358 | Miscanthus Rhizosphere | RLIDGLRQQYVLAIEAANGGEWRRLDVRVRRPSTVVKARSGYFAG* |
| Ga0075428_1024260671 | 3300006844 | Populus Rhizosphere | QYLLGIEAANDPEWRRIDVRVRRPAITVKARAGYFGG* |
| Ga0075421_1012110681 | 3300006845 | Populus Rhizosphere | LTETTTAAVGLVSELRQQYVIAIEAVAAREWRRLDVRVKRPSAVVRARNGYYGG* |
| Ga0075433_101996041 | 3300006852 | Populus Rhizosphere | TTTAAVGLVSELRQQYVLAIEAVSAREWRRLDVRVKRPSAVVRARNGYYGG* |
| Ga0068865_1002926471 | 3300006881 | Miscanthus Rhizosphere | VLAIEAASGREWRRLDVRVRRPSTTVKARNGYFAG* |
| Ga0068865_1017865592 | 3300006881 | Miscanthus Rhizosphere | TLVQELRQQYVLAIEAASANEWRKLDIRVKRKTARVKARSGYYGG* |
| Ga0075424_1006352932 | 3300006904 | Populus Rhizosphere | QYVLAIEAASGREWRRLDIRVRRPSTVVKARSGYFAG* |
| Ga0099827_116775882 | 3300009090 | Vadose Zone Soil | RQQYVLAIEAANGREWRRIDVRVRRPSAIVKARSGYFAG* |
| Ga0105245_102661651 | 3300009098 | Miscanthus Rhizosphere | SLIDGLRQQYVLAIEAANGREWRRLDVRVRRPSTVVKARSGYFSG* |
| Ga0105245_127659262 | 3300009098 | Miscanthus Rhizosphere | VTELRQHYVLAIEAASAREWRRLDVRVKQPRAVVMARSGYFGG* |
| Ga0114129_107573993 | 3300009147 | Populus Rhizosphere | ELRQQYVLAIEAIGAHEWRRLDVRVKHPAAIVKARSGYFGG* |
| Ga0075423_108283773 | 3300009162 | Populus Rhizosphere | ETVTVAASLIEQLRQQYVIAIEATSAHEWRRLDVRVRYPAASVKARSGYFGG* |
| Ga0075423_109077431 | 3300009162 | Populus Rhizosphere | REQYVLAIEAANNHEWRRLEVRVKQRSTTVKARSGYFGG* |
| Ga0105242_103715642 | 3300009176 | Miscanthus Rhizosphere | VVAASGLVDGLRLQYVLAIEAASGREWRRLDVRVKRPSTIVKARNGYFAG* |
| Ga0105242_122388041 | 3300009176 | Miscanthus Rhizosphere | QYVLAIEAAVGREWRRLDVRVVKNPSAAPTVRTRSGYFGG* |
| Ga0105248_124259361 | 3300009177 | Switchgrass Rhizosphere | VETVTSASSLIDTLRQQYVLAIEAASGREWRRLDVRVRRPSTSVKARSGYFAG* |
| Ga0105237_127392802 | 3300009545 | Corn Rhizosphere | ATSVKLIDELRQQYVLAIEAADGREWRRLEVRVRRPSAVVRARNGYFAG* |
| Ga0105249_102108782 | 3300009553 | Switchgrass Rhizosphere | LAIEAASASEWRRLDVRVKRPSAKVKARSGYFGG* |
| Ga0126313_117764081 | 3300009840 | Serpentine Soil | ELRQQYVLAIEAASTHEWRRLEVRVKRASASVKARSGYFGG* |
| Ga0126315_110197271 | 3300010038 | Serpentine Soil | NEIRQQYLLAIEATDGKEWRRLDVRVKRPSAVVKARSGYFGG* |
| Ga0126380_115586442 | 3300010043 | Tropical Forest Soil | KLIDELRQQYVLAIEAADVREWRRLEVRVRRPSAVVRARNGYFAG* |
| Ga0126384_117335261 | 3300010046 | Tropical Forest Soil | LTETVIGASTLVDELRQQYVLAIEAKAGAEWRRLDVRVRRPSTFVKARNGYFAG* |
| Ga0126382_122782761 | 3300010047 | Tropical Forest Soil | TVINASTLVEELRQQYVLAIEAASGAEWRRLDVRVRRPSTFVKARTGYFAG* |
| Ga0134080_101182471 | 3300010333 | Grasslands Soil | AAGLVDELRQQYVLAIEAGSGSEWRRLVVRVKNPSAVVKARMGYFGG* |
| Ga0126376_126206402 | 3300010359 | Tropical Forest Soil | AASVKLIDELRQQYVLAIEAADVREWRRLEVRVRRPSAVDRARNGYFAG* |
| Ga0126377_108133503 | 3300010362 | Tropical Forest Soil | ETETASTKLIDDLRQQYVLAIEAADVREWRRLEVRVHRPSAIVRARSGYYAG* |
| Ga0126377_134854161 | 3300010362 | Tropical Forest Soil | QYVLAIEAATGQQWRHLDVRVRRPSTFVKARNGYFAG* |
| Ga0126379_106064462 | 3300010366 | Tropical Forest Soil | QQYVLAIEAASDREWRRLDIKVKRPSTIVKARSGYFGG* |
| Ga0134128_132045902 | 3300010373 | Terrestrial Soil | VASSKLIDELRQQYILAIEAGSGGREWRRLDVRVRRPAATVKARSGYFAG* |
| Ga0134124_107856133 | 3300010397 | Terrestrial Soil | IDELRQQYVLAIEAADGREWRRLEVRVRRPSAVVRARNGYFAG* |
| Ga0126383_123238752 | 3300010398 | Tropical Forest Soil | IDELRQQYVLAIEAATGQQWRHLEVRVRRPSTFVKARNGYFAG* |
| Ga0134127_134875253 | 3300010399 | Terrestrial Soil | SLIDGLRQQYVLAIEAASGREWRRLDLRVRRPSTVVKARSGDFAG* |
| Ga0134122_110767821 | 3300010400 | Terrestrial Soil | LAIEAASGREWRRLDVRVRRPSTTVKARNGYFAG* |
| Ga0134123_115460362 | 3300010403 | Terrestrial Soil | QQYVIAIEAVAAREWRRLDVRVKRPSAVVRARNGYYGG* |
| Ga0138569_10358111 | 3300011079 | Peatlands Soil | VVVASNLVNQLRLQYVLAIQAGDGPEWRRLDVRVTRHSAIVKARSGYFGG* |
| Ga0137392_110817832 | 3300011269 | Vadose Zone Soil | VLTASRLVDELRQQYVLAIEAGIGREWRHLDVRVKRPAAVVKARSGYFGG* |
| Ga0120118_11603802 | 3300012010 | Permafrost | VLAGRAGAVAARFVDELRQQYVLAIEAAPEHEWRRLDVRVKSPSASTTVKARSGYFGG* |
| Ga0137399_111763171 | 3300012203 | Vadose Zone Soil | YVLAIEAGIGREWRHLDVRVKRPSAVVKARSGYFGG* |
| Ga0137380_107306042 | 3300012206 | Vadose Zone Soil | AAGLVDELRQQYVLAIEAASAREWRRLDVHVKHPSAVVKARTGYYGG* |
| Ga0150985_1114754012 | 3300012212 | Avena Fatua Rhizosphere | TASALIDGIREQYVLAIEAASAREWRRLDVRVLRRSATVKARSGYYAG* |
| Ga0137360_117822922 | 3300012361 | Vadose Zone Soil | VAASNIGDELRQQDVLAIEAALEREWRRLEVRVKDPSASATVKARSGYLGG* |
| Ga0134036_10161951 | 3300012384 | Grasslands Soil | TTTAAGSLVNELRQQYVLAIEAAGSREWRRLDVRVKQRAATSVRARSGYFGG* |
| Ga0150984_1008064461 | 3300012469 | Avena Fatua Rhizosphere | ELRQQYVLAIEAANTPEWRRLEVRVKRSSASVKARSGYFGG* |
| Ga0137373_108772231 | 3300012532 | Vadose Zone Soil | DDLRQQYVLAIETADGREWRRLDVRVKRPSTTVKARSGYFAG* |
| Ga0136614_102796701 | 3300012684 | Polar Desert Sand | ELRQQYVLAVEAAAGREWRRLNVRVKHPSAVVKARSGYFGG* |
| Ga0157292_103922592 | 3300012900 | Soil | LRQRYVLAIEAASIYEWRRLEVRVKHPAAVVKARSGYFGG* |
| Ga0157310_103414171 | 3300012916 | Soil | YVLAIEAASTHEWRRLEVRVKRASASVKARSGYFGG* |
| Ga0137404_121758352 | 3300012929 | Vadose Zone Soil | QQYVLSIEAAAVKEWRRLDVRVKRPAAKVKARSGYYGG* |
| Ga0164303_102347821 | 3300012957 | Soil | RQQYVLAIEAASTPEWRRLEVRVKRSSASVKARSGYFGG* |
| Ga0164299_101242621 | 3300012958 | Soil | LAIEAANGGEWRQLDVRVKRPATVVKARSGYFTK* |
| Ga0164302_108223901 | 3300012961 | Soil | RHQYLLGIEAAGDHEWRRLDVRVRRPASVVKARAGYFGG* |
| Ga0126369_137107222 | 3300012971 | Tropical Forest Soil | YILAIEAAAGREWRRLDVRVRRPAATVKARSGYFAG* |
| Ga0164307_105294411 | 3300012987 | Soil | VATASTLIDGIREQYVLAIEAASAREWRRLDVRVLRRSATVKARSGYYAG* |
| Ga0157374_106376672 | 3300013296 | Miscanthus Rhizosphere | VLAIEAASAREWHRLDVRVRQPRAVVMARSGYFGG* |
| Ga0157374_124257092 | 3300013296 | Miscanthus Rhizosphere | SNLVDELRQQYVLSIEAAGVKEWRRLDVRVKRPAAKVKARSGYYGG* |
| Ga0163162_110798442 | 3300013306 | Switchgrass Rhizosphere | RQHYVLAIEAASAREWRRLDVRVRQPRAVVMARSGYFGG* |
| Ga0134075_105284741 | 3300014154 | Grasslands Soil | TVTAAAGLVDELRQQYVLAIEAASSKEWRRLDVRVKTPSAIVKARTGYFGG* |
| Ga0157379_124026771 | 3300014968 | Switchgrass Rhizosphere | TVVTSTVVSELRLQYVLAIEAAGAHEWRRLDVRVKHPSAVVKARSGYFGG* |
| Ga0157376_115089322 | 3300014969 | Miscanthus Rhizosphere | LETVIAASGLIDGLRLQYVLAIEAATGREWRRLDVRVRRPSTTVKARNGYFAG* |
| Ga0173483_106454662 | 3300015077 | Soil | RQQYVLAIEAAAGREWRRLDVRVRRPSTARVKARNGYYAG* |
| Ga0132256_1024674432 | 3300015372 | Arabidopsis Rhizosphere | PAETVVASTNLIDGLRQQYVIAIEAANGREWRRLDVRVRRPSTVVKARSGDFAG* |
| Ga0132257_1033572862 | 3300015373 | Arabidopsis Rhizosphere | VEARLVDDLRLQYILAIEAANVREWRRLDVRVKARSTTVKARSGYFGG* |
| Ga0132255_1031260942 | 3300015374 | Arabidopsis Rhizosphere | SELRQQYVLAIEASNTPEWRRLEVRVKRSSASVKARSGYFGG* |
| Ga0134112_103729152 | 3300017656 | Grasslands Soil | VLAIEAADSREWRRLDVRVRRRSTIVKARSGYFAG |
| Ga0163161_120748121 | 3300017792 | Switchgrass Rhizosphere | QQYVLAIEASNTPEWRRLEVRVKRSSASVKARSGYFGG |
| Ga0184626_104269351 | 3300018053 | Groundwater Sediment | GLRQQYVLAIEAASSREWRRLEVRVKHRAAIVKARSGYFGG |
| Ga0190268_115439881 | 3300018466 | Soil | TFPQAIVAASSIIDESRQQYLLAIEATDGKEWRRLDVRVKRPSAVVKARSGYFGG |
| Ga0190270_112923482 | 3300018469 | Soil | VLAIEAASIYEWRRLEVRVKHPAAVVKARSGYFGG |
| Ga0190270_121787711 | 3300018469 | Soil | ATSIVQELRQQYVLAIEAAPEREWRRLEVLVKHPSATVKSRSGYFGS |
| Ga0190274_127856772 | 3300018476 | Soil | VLAIEAASIYEWRRLEVRVKNPAAVVKARSGYFGG |
| Ga0190274_139110041 | 3300018476 | Soil | HLAIEAAGSTEWRRLEVRVKHPTATVKTRSGYFGG |
| Ga0190264_111058602 | 3300019377 | Soil | TLVDELRQQYILAIEAATANEWRRLDVRVKRASAKVKARSGYFGG |
| Ga0190264_119104052 | 3300019377 | Soil | VVVVTSLLDELRQQYVLAIEAATGRDWRRLDVRVRRPSTIVKARSGYFAG |
| Ga0190264_120864822 | 3300019377 | Soil | AASLLDELRQQYVLAIEAASTHEWRRLEVRVKRASASVKARSGYFGG |
| Ga0210408_105052501 | 3300021178 | Soil | SVAVASNIVDQLRQQYVLAIEAGTGREWRHVDVRVKRPSAVVKARSGYFGG |
| Ga0213853_103904462 | 3300021861 | Watersheds | NQLRQQYVLAIEAAGGPEWRRLDVRVVRHSAVVKARSGYFGG |
| Ga0222622_109879001 | 3300022756 | Groundwater Sediment | ELRQRYVLAIEAAGDREWRRLEVRVRKSSAIVKARSGYFGG |
| Ga0222622_110023631 | 3300022756 | Groundwater Sediment | SRLVEELRQQYVLAIEAASVNEWRRLDVRVKRPSAKVKARSGYFGG |
| Ga0247794_102832042 | 3300024055 | Soil | NVLSELRQQYVLAIEAANTREWRRLEVRVKRSSASVKARSGYFGG |
| Ga0207642_105163441 | 3300025899 | Miscanthus Rhizosphere | VVTSTVVSELRLQYVLAIEAAGAHEWRRLDVRVKHPSEVVKARSGYFGG |
| Ga0207647_100199381 | 3300025904 | Corn Rhizosphere | LLAIEAASDREWRRLDVRVRRPSTVVKARTGYFGG |
| Ga0207645_101545672 | 3300025907 | Miscanthus Rhizosphere | VSELRQHYVLAIEAASAREWHRLDVRVRQPRAVVMARSGYFGG |
| Ga0207695_110144921 | 3300025913 | Corn Rhizosphere | ELRQQYVLAIEAAVGREWRRLDVRVVKNPSAAPTVRTRSGYFGG |
| Ga0207662_106630043 | 3300025918 | Switchgrass Rhizosphere | LVQELRQQYVLAIEAASANEWRKLDIRVKRKTARVKARSGYYGG |
| Ga0207657_115138052 | 3300025919 | Corn Rhizosphere | LRQQYVLAIEAAGGREWRRLDVRVRRPSARVKARNGYYAG |
| Ga0207681_111792761 | 3300025923 | Switchgrass Rhizosphere | DELRQQYVLAIEAASASEWRRLDVRVKRPSAKVKARSGYFGG |
| Ga0207701_104275501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIGLLAELRQQYVIAIEAVAAREWRRLDVRVKRPSAIVRARNGYYGG |
| Ga0207690_113877181 | 3300025932 | Corn Rhizosphere | ELRQQYVLAIEAANTPEWRRLEVRVKRSSASVKARSGYFGG |
| Ga0207670_118611482 | 3300025936 | Switchgrass Rhizosphere | ETITTASKLVEELRQQYVLAIEAAPSNEWRRLDVRVKRAAAKVKARSGYFGG |
| Ga0207669_118556052 | 3300025937 | Miscanthus Rhizosphere | EELRQQYVLAIEAAPSNEWRRLDVRVKRAAAKVKARSGYFGG |
| Ga0207704_111334872 | 3300025938 | Miscanthus Rhizosphere | RLQYVLAIEAASGREWRRLDVRVRRPSTTVKARNGYFAG |
| Ga0207704_112627582 | 3300025938 | Miscanthus Rhizosphere | VETVSTATTLVQELRQQYVLAIEAASANEWRKLDIRVKRKTARVKARSGYYGG |
| Ga0207704_118735911 | 3300025938 | Miscanthus Rhizosphere | GLRQQYVLAIEAASSREWRRLDVRVRRPSTVVKARSGYYAG |
| Ga0207711_104979672 | 3300025941 | Switchgrass Rhizosphere | VLAIEAAGSREWRRLDIRVKHPAATVKARSGYFGG |
| Ga0207667_110134912 | 3300025949 | Corn Rhizosphere | LIDELRQQYVLAIEAADVREWRRLEVRVRRPSAVVRARNGYFAG |
| Ga0207651_101874231 | 3300025960 | Switchgrass Rhizosphere | ATTLVQELRQQYVLAIEAASANEWRKLDIRVKRKTARVKARSGYYGG |
| Ga0207712_109613601 | 3300025961 | Switchgrass Rhizosphere | TVVASTSLIDGLRQQYVLAIEAASGREWRRLDVRVRRPSTVVKARSGYFAG |
| Ga0207658_112926212 | 3300025986 | Switchgrass Rhizosphere | SSLLDGLRQQYVLAIEAASGREWRRLDVRVRRPMTIVKARSGYFAG |
| Ga0207677_106978652 | 3300026023 | Miscanthus Rhizosphere | GLRQQYVLAIEAASGREWRRLDVRVRRPMTIVKARSGYFAG |
| Ga0207703_122362922 | 3300026035 | Switchgrass Rhizosphere | LRQQYVLAIEAANGREWRRLDVRVRRPSTTVKARSGYFAG |
| Ga0207675_1013419401 | 3300026118 | Switchgrass Rhizosphere | DGLRQQYVLAIEAANSGEWRRLDVRVRRPSTFVKARSGYFAG |
| Ga0209239_10506313 | 3300026310 | Grasslands Soil | FQETTTAAGSLVNELRQQYVLAIEAAGSREWRRLDVRVKQRAATSVRARSGYFGG |
| Ga0256867_101370941 | 3300026535 | Soil | VLAIQAATVQEWRRLEVKVKDRSATVKARSGYFGG |
| Ga0209971_10331971 | 3300027682 | Arabidopsis Thaliana Rhizosphere | QYVLAIEASSTHEWRRLEVRVKRSSASVKARSGYFGG |
| Ga0209382_103349833 | 3300027909 | Populus Rhizosphere | ASKLVEELRQQYVLAIEAAPSNEWRRLDVRVKRAAAKVKARSGYFGG |
| Ga0209583_102261582 | 3300027910 | Watersheds | LRQQYVLAIEAAGAREWRRLDIRVKHPAATVKSRSGYFGG |
| Ga0268265_110869481 | 3300028380 | Switchgrass Rhizosphere | DGLRQQYVLAIEAASGREWRRLDVRVRRPSTVVKARSGYFAG |
| Ga0307500_100271552 | 3300031198 | Soil | VIAIEAANGREWRRLDVRVRRPSTVVKARAGYFAG |
| Ga0299914_101933311 | 3300031228 | Soil | LRQQYVLAIQAATVQEWRRLEVKVKDRSATVKARSGYFGG |
| Ga0299914_102126772 | 3300031228 | Soil | ELRQQYVLAVEAVASRQWRRLDVRVRGTAAVVKARSGYFGG |
| Ga0310887_100127756 | 3300031547 | Soil | FASSFGETALVASSLVGELRQQYVLAIEAANVREYRRLDVRVKVPAATVKARSGYFGG |
| Ga0307408_1012842251 | 3300031548 | Rhizosphere | LLFASSLTETTLAAVELLTELRQQYVIAIEAVAAREWRRLDVRVKRPSAVVRARNGYYGG |
| Ga0310813_110487332 | 3300031716 | Soil | FTETIVVASSIVDELRQQYVLAIEAAPEREWRRLDVRVKNPSPSTTVKARSGYFGG |
| Ga0311351_103881771 | 3300031722 | Fen | ASSFTESASVVSSLVNELREQYVLVIEAAANAEWRRLDVRVPRRSAIVKARSGYFGG |
| Ga0307468_1022621232 | 3300031740 | Hardwood Forest Soil | ASSLINDLRQQYVLAIEAASGREWRQLDVRVRRPSIIVKARNGYFAG |
| Ga0306918_110209422 | 3300031744 | Soil | VETIATASSLIDNLRQQYVLAIEAASDREWRRLDIKVKRPSTIVKARSGYFGG |
| Ga0310907_106427581 | 3300031847 | Soil | VLAIEAANVREWRRLDVRVKNSSAKVKARSGYFGG |
| Ga0307406_114740892 | 3300031901 | Rhizosphere | QLLFASSLTETTLAAVELLTELRQQYVIAIEAVAAREWRRLDVRVKRPSAVVRARNGYYG |
| Ga0307407_113224321 | 3300031903 | Rhizosphere | VIAIEAVAAREWRRLDVRVKRPSAVVRARNGYYGG |
| Ga0310900_111008852 | 3300031908 | Soil | ILVNDLRQQYVLAIEAAGGREWRRLDVRVRRPSAARVKARNGYYAG |
| Ga0310900_112320711 | 3300031908 | Soil | YVLAIEAAPSTEWRRLDVRVKRAAAKVKARSGYFGG |
| Ga0307412_115962571 | 3300031911 | Rhizosphere | LVEELRQQYVLAIEAAPSTEWRRLDVRVKRAAAKVKARSGYYGG |
| Ga0307409_1007022931 | 3300031995 | Rhizosphere | IRQQYLLAIEATDGKEWRRLDVRVKRPSAVVKARSGYFGG |
| Ga0310903_104254002 | 3300032000 | Soil | QYVLAIEAAPERQWRRLEVRVKHPSATVKSRSGYFGS |
| Ga0307416_1036815041 | 3300032002 | Rhizosphere | RQQYVLAIEAAPSTEWRRLDVRVKRAAAKVKARSGYYGG |
| Ga0307411_100530152 | 3300032005 | Rhizosphere | LTELRQQYVIAIEAVAAREWRRLDVRVKRPSAVVRARNGYYGG |
| Ga0307411_100921361 | 3300032005 | Rhizosphere | ELRQQYILAIEAANTREWRQLQVRVRQRSATVKARNGYFGG |
| Ga0318569_105212691 | 3300032010 | Soil | ETVVAASNLVDGLRQQYVLAIEAAGSREWRRLDIRVKHPAATVKARSGYFGG |
| Ga0307470_116269891 | 3300032174 | Hardwood Forest Soil | TLVETVVGASTLIDELRQQYVLAIEAASGTEWRKLDVRVRRPSTIVKARTGYFAG |
| Ga0310889_105560491 | 3300032179 | Soil | ETTTAAVGLVSELRQQYVIAIEAVTAREWRRLDVRVKRPSAVVRARNGYYGG |
| Ga0348332_109865352 | 3300032515 | Plant Litter | VASNLVNQLRQQYVLAIEAGIGPEWRRLDVRVTRPSAVVKARSGYFGG |
| Ga0335082_106866502 | 3300032782 | Soil | VVGASTLVDELRQQYVLAIEAASGAEWRRLDVRVRRPSTFVKARNGYFAG |
| Ga0335076_111502401 | 3300032955 | Soil | TLVDELRQQYVLAIEAASGAEWRRLDVRVRRPSTFVKARNGYFAG |
| Ga0316603_112360142 | 3300033413 | Soil | FGETALAASNLIAELRQTYVLAIEAASDREWRRLDVRVRRPSAVVKARTGYFGG |
| ⦗Top⦘ |