| Basic Information | |
|---|---|
| Family ID | F034359 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LKSASLQYANALADIALAQGAAEPAAKQLADFGAAYAESA |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.29 % |
| % of genes near scaffold ends (potentially truncated) | 97.71 % |
| % of genes from short scaffolds (< 2000 bps) | 93.71 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF00430 | ATP-synt_B | 93.14 |
| PF00213 | OSCP | 2.29 |
| PF13662 | Toprim_4 | 0.57 |
| PF13442 | Cytochrome_CBB3 | 0.57 |
| PF00884 | Sulfatase | 0.57 |
| PF13360 | PQQ_2 | 0.57 |
| PF12833 | HTH_18 | 0.57 |
| PF02754 | CCG | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 93.14 |
| COG0712 | FoF1-type ATP synthase, delta subunit | Energy production and conversion [C] | 2.29 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.57 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.00 % |
| Unclassified | root | N/A | 28.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_108386693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300002917|JGI25616J43925_10262148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300004268|Ga0066398_10223659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005148|Ga0066819_1005440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300005363|Ga0008090_10069546 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300005434|Ga0070709_10517589 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005540|Ga0066697_10044223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2510 | Open in IMG/M |
| 3300005555|Ga0066692_10678786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300005586|Ga0066691_10707545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300005610|Ga0070763_10536000 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300006028|Ga0070717_11638932 | Not Available | 583 | Open in IMG/M |
| 3300006041|Ga0075023_100279430 | Not Available | 679 | Open in IMG/M |
| 3300006059|Ga0075017_100524738 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300006163|Ga0070715_10943400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300006173|Ga0070716_100294889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300006175|Ga0070712_101904710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300007258|Ga0099793_10704815 | Not Available | 509 | Open in IMG/M |
| 3300009038|Ga0099829_11103009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300009038|Ga0099829_11726008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300009088|Ga0099830_11685969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300009089|Ga0099828_11507220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300009700|Ga0116217_10195170 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300010043|Ga0126380_12050193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010043|Ga0126380_12274158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010303|Ga0134082_10094164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
| 3300010359|Ga0126376_13110888 | Not Available | 513 | Open in IMG/M |
| 3300010360|Ga0126372_10498511 | Not Available | 1143 | Open in IMG/M |
| 3300010360|Ga0126372_10690564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300010360|Ga0126372_11477614 | Not Available | 715 | Open in IMG/M |
| 3300011270|Ga0137391_10953056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300012202|Ga0137363_10358400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1208 | Open in IMG/M |
| 3300012202|Ga0137363_11675972 | Not Available | 528 | Open in IMG/M |
| 3300012202|Ga0137363_11756732 | Not Available | 513 | Open in IMG/M |
| 3300012203|Ga0137399_10170479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1751 | Open in IMG/M |
| 3300012205|Ga0137362_10937718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300012206|Ga0137380_11109818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300012349|Ga0137387_10935519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300012351|Ga0137386_10235458 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300012356|Ga0137371_10099164 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
| 3300012357|Ga0137384_10551548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300012582|Ga0137358_10053225 | All Organisms → cellular organisms → Bacteria | 2700 | Open in IMG/M |
| 3300012683|Ga0137398_10245404 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300012685|Ga0137397_10202376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1477 | Open in IMG/M |
| 3300012685|Ga0137397_10338911 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300012918|Ga0137396_10797482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300012925|Ga0137419_10318080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300012927|Ga0137416_10031593 | All Organisms → cellular organisms → Bacteria | 3533 | Open in IMG/M |
| 3300012930|Ga0137407_10252186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1600 | Open in IMG/M |
| 3300012944|Ga0137410_11333968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300012961|Ga0164302_11187271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300012971|Ga0126369_12211772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300013296|Ga0157374_11419333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300014498|Ga0182019_11342940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300015053|Ga0137405_1267522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300015242|Ga0137412_10694432 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300015358|Ga0134089_10574291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300015359|Ga0134085_10006358 | All Organisms → cellular organisms → Bacteria | 4307 | Open in IMG/M |
| 3300016404|Ga0182037_11140544 | Not Available | 683 | Open in IMG/M |
| 3300016445|Ga0182038_10186249 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300016750|Ga0181505_10635321 | Not Available | 517 | Open in IMG/M |
| 3300017822|Ga0187802_10365838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300017942|Ga0187808_10320612 | Not Available | 700 | Open in IMG/M |
| 3300017955|Ga0187817_11124831 | Not Available | 504 | Open in IMG/M |
| 3300017995|Ga0187816_10407172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300017995|Ga0187816_10568526 | Not Available | 510 | Open in IMG/M |
| 3300018088|Ga0187771_11421413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300018482|Ga0066669_12352538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300020140|Ga0179590_1224577 | Not Available | 514 | Open in IMG/M |
| 3300020579|Ga0210407_10459321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300020579|Ga0210407_10918404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300020579|Ga0210407_11380027 | Not Available | 523 | Open in IMG/M |
| 3300020580|Ga0210403_10494947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
| 3300020580|Ga0210403_11485146 | Not Available | 510 | Open in IMG/M |
| 3300020581|Ga0210399_10768433 | Not Available | 788 | Open in IMG/M |
| 3300020583|Ga0210401_10299671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1468 | Open in IMG/M |
| 3300020583|Ga0210401_10398714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300021046|Ga0215015_10969832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300021088|Ga0210404_10640187 | Not Available | 605 | Open in IMG/M |
| 3300021168|Ga0210406_10315605 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300021168|Ga0210406_10841075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300021170|Ga0210400_10337261 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300021170|Ga0210400_10606619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300021170|Ga0210400_10811484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
| 3300021170|Ga0210400_11410427 | Not Available | 555 | Open in IMG/M |
| 3300021171|Ga0210405_10340617 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300021178|Ga0210408_10465259 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300021180|Ga0210396_11697010 | Not Available | 513 | Open in IMG/M |
| 3300021401|Ga0210393_10398843 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300021403|Ga0210397_11333739 | Not Available | 557 | Open in IMG/M |
| 3300021432|Ga0210384_10676803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300021432|Ga0210384_11891408 | Not Available | 502 | Open in IMG/M |
| 3300021433|Ga0210391_10565282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300021474|Ga0210390_10565946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300021475|Ga0210392_11000479 | Not Available | 626 | Open in IMG/M |
| 3300021478|Ga0210402_10887262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300021478|Ga0210402_11175542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300021478|Ga0210402_11316860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300021479|Ga0210410_10710619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300021559|Ga0210409_10260946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1567 | Open in IMG/M |
| 3300022533|Ga0242662_10156322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300022840|Ga0224549_1032165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300024254|Ga0247661_1070586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300024330|Ga0137417_1104296 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300024330|Ga0137417_1372445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1403 | Open in IMG/M |
| 3300025885|Ga0207653_10004257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4496 | Open in IMG/M |
| 3300025906|Ga0207699_10179105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
| 3300025915|Ga0207693_10317451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1220 | Open in IMG/M |
| 3300025928|Ga0207700_10705476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300026300|Ga0209027_1212014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300026304|Ga0209240_1110557 | Not Available | 963 | Open in IMG/M |
| 3300026317|Ga0209154_1284586 | Not Available | 549 | Open in IMG/M |
| 3300026333|Ga0209158_1247494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300026334|Ga0209377_1069231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
| 3300026523|Ga0209808_1160487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300026557|Ga0179587_11102265 | Not Available | 522 | Open in IMG/M |
| 3300026928|Ga0207779_1016314 | Not Available | 978 | Open in IMG/M |
| 3300027330|Ga0207777_1014538 | Not Available | 1589 | Open in IMG/M |
| 3300027605|Ga0209329_1109806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300027655|Ga0209388_1045553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1266 | Open in IMG/M |
| 3300027671|Ga0209588_1090171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300027727|Ga0209328_10233558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300027729|Ga0209248_10054373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1226 | Open in IMG/M |
| 3300027795|Ga0209139_10274080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300027812|Ga0209656_10458615 | Not Available | 563 | Open in IMG/M |
| 3300027862|Ga0209701_10222327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
| 3300027862|Ga0209701_10580349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300027875|Ga0209283_10862013 | Not Available | 551 | Open in IMG/M |
| 3300027898|Ga0209067_10782032 | Not Available | 556 | Open in IMG/M |
| 3300027903|Ga0209488_10569318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300027903|Ga0209488_11043412 | Not Available | 562 | Open in IMG/M |
| 3300027908|Ga0209006_10783056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300028016|Ga0265354_1018651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300028146|Ga0247682_1019752 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300028381|Ga0268264_10708157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300029636|Ga0222749_10195509 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300030878|Ga0265770_1143035 | Not Available | 520 | Open in IMG/M |
| 3300030879|Ga0265765_1015675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1080034 | Not Available | 698 | Open in IMG/M |
| 3300031240|Ga0265320_10150850 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031718|Ga0307474_10096188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2212 | Open in IMG/M |
| 3300031740|Ga0307468_101214828 | Not Available | 680 | Open in IMG/M |
| 3300031748|Ga0318492_10090145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300031753|Ga0307477_10829934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300031777|Ga0318543_10503105 | Not Available | 543 | Open in IMG/M |
| 3300031792|Ga0318529_10023837 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300031819|Ga0318568_10416926 | Not Available | 837 | Open in IMG/M |
| 3300031823|Ga0307478_10193097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1635 | Open in IMG/M |
| 3300031823|Ga0307478_10849168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300031910|Ga0306923_11968549 | Not Available | 594 | Open in IMG/M |
| 3300031942|Ga0310916_10261510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300031947|Ga0310909_10928805 | Not Available | 713 | Open in IMG/M |
| 3300031947|Ga0310909_11265844 | Not Available | 594 | Open in IMG/M |
| 3300031954|Ga0306926_11061075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300031962|Ga0307479_10149536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2290 | Open in IMG/M |
| 3300031962|Ga0307479_10364554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1428 | Open in IMG/M |
| 3300031962|Ga0307479_10841650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 892 | Open in IMG/M |
| 3300031962|Ga0307479_11825431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300032010|Ga0318569_10275250 | Not Available | 783 | Open in IMG/M |
| 3300032063|Ga0318504_10302934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300032066|Ga0318514_10341042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300032067|Ga0318524_10734608 | Not Available | 521 | Open in IMG/M |
| 3300032180|Ga0307471_100172797 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300032180|Ga0307471_100184455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2063 | Open in IMG/M |
| 3300032180|Ga0307471_101042212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300032180|Ga0307471_102254836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300032180|Ga0307471_102528914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300032180|Ga0307471_104346531 | Not Available | 500 | Open in IMG/M |
| 3300032205|Ga0307472_100862940 | Not Available | 834 | Open in IMG/M |
| 3300032782|Ga0335082_11218743 | Not Available | 620 | Open in IMG/M |
| 3300032782|Ga0335082_11717717 | Not Available | 502 | Open in IMG/M |
| 3300032828|Ga0335080_11219290 | Not Available | 755 | Open in IMG/M |
| 3300032892|Ga0335081_10783124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300033004|Ga0335084_12083474 | Not Available | 551 | Open in IMG/M |
| 3300033134|Ga0335073_11449903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300033289|Ga0310914_10497050 | Not Available | 1103 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.43% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.29% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.71% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.57% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.57% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.57% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.57% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026928 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 44 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1083866932 | 3300000955 | Soil | LKSASLQYANALADIALAQGAAEPTARQLNDFGTSY |
| JGI25616J43925_102621481 | 3300002917 | Grasslands Soil | LKSASLQYANAMADVALAQGAAEPAAKQLHEFGAAYGQSAELRTFL |
| Ga0066398_102236592 | 3300004268 | Tropical Forest Soil | LKSASLQYANALADIALAQGAAVPVTQQLGDFTAAYASSTEL |
| Ga0066819_10054402 | 3300005148 | Soil | LKSASLQYANALADIALAQGAGDPAAKQLNEFGAAYAQSAELRT |
| Ga0008090_100695461 | 3300005363 | Tropical Rainforest Soil | LKSVSLQYANALADVALEQGAAEPARKQLAEFVAMYEESA |
| Ga0070709_105175893 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANALADVAVQQRAADTVAQELAGFGALYAESAELRNF |
| Ga0066697_100442235 | 3300005540 | Soil | LRSASLQYANALADIALEQGAAEPTAKQLSAFGAVYAES |
| Ga0066692_106787862 | 3300005555 | Soil | LKSASLQYANALADIALAQGAAAPVAEQLGDFTTAYVDSSE |
| Ga0066691_107075452 | 3300005586 | Soil | LKSASLQYANALADIALTQGAAAPVVEQLGDFTTAYID |
| Ga0070763_105360002 | 3300005610 | Soil | LKSANLQYANALADVALAQGAGDAALRQLIDFRDAYAESAELRNFLAT |
| Ga0070717_116389321 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANALADIALEQGAAGPVIQQLSDFTAAYSSFAE |
| Ga0075023_1002794301 | 3300006041 | Watersheds | LKSASLQYANALADIAMAQGAAEAAVQQLSGFGALYAE |
| Ga0075017_1005247381 | 3300006059 | Watersheds | LKSASLQYANALADIALTQGAGDPAAKQLNEFGAAYA |
| Ga0070715_109434001 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANALADIALEQGAAAPVMQQLGDFVAAY |
| Ga0070716_1002948891 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSAALQYATALAEIALEQGATEPVLNQLGDFARA |
| Ga0070712_1019047101 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANALADIALAQGAAAPVVEQLGDFTAAYIDSSELRN |
| Ga0099793_107048151 | 3300007258 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAADTVAQQLIGFGALYAESAEL |
| Ga0099829_111030091 | 3300009038 | Vadose Zone Soil | LRSASLQYANALADIALAQEAAEATAKQLNAFGEAYAESAEL |
| Ga0099829_117260081 | 3300009038 | Vadose Zone Soil | MEAELKSASLQYANAMADIALAQGAAEPAAKQLHE |
| Ga0099830_116859691 | 3300009088 | Vadose Zone Soil | LKSASLQYANAMADIALAQGAAEPTAKQLRDFGAAYAESTELGTFL |
| Ga0099828_115072201 | 3300009089 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAAEPAVQQLVGFGALYAESA |
| Ga0116217_101951704 | 3300009700 | Peatlands Soil | LRSASLQYANALADIALEQGAAEPMLKQLSEFGAAFAES |
| Ga0126380_120501932 | 3300010043 | Tropical Forest Soil | LKSASLQYANALADIALAQGAARAVTQQLGDFTAAYASSA |
| Ga0126380_122741581 | 3300010043 | Tropical Forest Soil | LKSASLQYANALADIALAQGAVAPVTQQLGDLSAAYDSSAELRN |
| Ga0134082_100941643 | 3300010303 | Grasslands Soil | LKSASLQYANAMADIALAQGAGEPAAKQLHEFAAAYAQSAELRTF |
| Ga0126376_131108881 | 3300010359 | Tropical Forest Soil | LKSASLQYANALADVALQQGAAEPVLKQLNDFVDAYAASAEL |
| Ga0126372_104985111 | 3300010360 | Tropical Forest Soil | LKSASLQYANALADIALAQGAAVPVTQQLGDFTAV |
| Ga0126372_106905641 | 3300010360 | Tropical Forest Soil | LKSASLQYANALADIALAQGAAEAAAKQLGNFGAA |
| Ga0126372_114776141 | 3300010360 | Tropical Forest Soil | LKSASLQYANALADIALEQSAADAAAKQLGEFGAAYEASAELR |
| Ga0137391_109530561 | 3300011270 | Vadose Zone Soil | LKSVSLQYANALADIAIAQGAAEEIKQQLTGFGALYAE |
| Ga0137363_103584001 | 3300012202 | Vadose Zone Soil | MQYANALADIAMAQGSADTATQQLIGFGALYAESAELRN |
| Ga0137363_116759722 | 3300012202 | Vadose Zone Soil | LKSASLQYANALADIALAQGPAEPAVKQLTDFGATFADSAELRNFL |
| Ga0137363_117567322 | 3300012202 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAAEPAMQQLVGFGALYAESAELR |
| Ga0137399_101704794 | 3300012203 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAAEPAMQQLVGFGALYAESAELRNFLSS |
| Ga0137362_109377181 | 3300012205 | Vadose Zone Soil | LKSASLQYANAMADVALAQGAAEPAAKQLHEFGAA |
| Ga0137380_111098181 | 3300012206 | Vadose Zone Soil | LRSASLQYANALADIALEQGAAEPAAKQLSAFGAVY |
| Ga0137387_109355192 | 3300012349 | Vadose Zone Soil | LRSASLQYANALADIALEQGAAEPAAKQLSAFGAVYAES |
| Ga0137386_102354581 | 3300012351 | Vadose Zone Soil | LKSASLQYANALADVALQQGAAEPVLKQLNDFASAYSESSE |
| Ga0137371_100991641 | 3300012356 | Vadose Zone Soil | LRSASLQYANVLADIALEQGAAEPAAKQLSAFGAAYAESAE |
| Ga0137384_105515483 | 3300012357 | Vadose Zone Soil | LKSSSLQYANAMADIALAQGAAEPAAKQLYEFGAAYEQSAELHTFLA |
| Ga0137358_100532251 | 3300012582 | Vadose Zone Soil | LKSASLQYANALADIALAQGAGDPAAKQLNEFGAAYGQS |
| Ga0137398_102454041 | 3300012683 | Vadose Zone Soil | LKSASLQYANALADVALQQGAAEPVLKQLNDFAGAYS |
| Ga0137397_102023761 | 3300012685 | Vadose Zone Soil | LRSASLQYATALADIALEQGAAEPVKKQLEDFGAAYAES |
| Ga0137397_103389111 | 3300012685 | Vadose Zone Soil | LKSASLQYANALADIAIAQGAAKPLVEQLIGFGALYAESAELRN |
| Ga0137396_107974821 | 3300012918 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAAKQIGEQLTGFGALYA |
| Ga0137419_103180803 | 3300012925 | Vadose Zone Soil | LKSASLQYANALADIALEQGAAAPVMQQLGDFTAAYSSSAELR |
| Ga0137416_100315934 | 3300012927 | Vadose Zone Soil | LKSVGLQYANALADIALAQSAAEAVTQELTGFGALYAES |
| Ga0137407_102521861 | 3300012930 | Vadose Zone Soil | LKSASLQYANALADIALAQGAAAPVAEQLGDFTTAY |
| Ga0137410_113339682 | 3300012944 | Vadose Zone Soil | LKSASLQYANALADIALAQGAAEPTARQLSDFGTSYAQSAELR |
| Ga0164302_111872712 | 3300012961 | Soil | LKSASLQYANALADIALAQGAADAVNKQLADVGAMY |
| Ga0126369_122117722 | 3300012971 | Tropical Forest Soil | LKSASLQYANALADIALEQGAADPAAKQLESFGAVYEESA* |
| Ga0157374_114193331 | 3300013296 | Miscanthus Rhizosphere | LKSASLQYANALADIALAQGAADAVNKQLADVGAMYA |
| Ga0182019_113429401 | 3300014498 | Fen | LKSAPLQYANALADIALEQGAAEPVLKQLTDFSNA |
| Ga0137405_12675222 | 3300015053 | Vadose Zone Soil | LKSASLQYANALADIALAQGAAAPVAEQLGDFTTAYVD |
| Ga0137412_106944323 | 3300015242 | Vadose Zone Soil | LKSASLQYANALADVVLAQGAGDPTLRQLSDFRDAYAESFELRNFLASP |
| Ga0134089_105742911 | 3300015358 | Grasslands Soil | LRSASLQYANALADIALEQGAAEPTAKQLSAFGAV |
| Ga0134085_100063586 | 3300015359 | Grasslands Soil | LKSASLQYANAMADIALAQGAAEPAAKQLQEFGGAYAQSA |
| Ga0182037_111405442 | 3300016404 | Soil | LKSASLQYANALADIVLEQGAAEPARKQLMDFEGAY |
| Ga0182038_101862494 | 3300016445 | Soil | LKSASLQYANALADVVLEQGAAEPVRKQLAEFVRLYE |
| Ga0181505_106353212 | 3300016750 | Peatland | LKSASLQYANALADIALEQGAAEPTLKQLGEFGAAFA |
| Ga0187802_103658381 | 3300017822 | Freshwater Sediment | LKSASLQYANALADIVLEQGAGEPARKQLEDFAAAYAE |
| Ga0187808_103206122 | 3300017942 | Freshwater Sediment | LKSASLQYANALADIVLQQGAAEPARKQLEDFQAAYTESV |
| Ga0187817_111248311 | 3300017955 | Freshwater Sediment | LRSASLQYANALADIVLEQGAAEPARKQLADFEAAYAESAEL |
| Ga0187816_104071722 | 3300017995 | Freshwater Sediment | CAESARETELRSASLQYANALADIALEQGAVEPVLKQLSEFAAAFAE |
| Ga0187816_105685261 | 3300017995 | Freshwater Sediment | LKSASLQYATALADIVLEQGAAEPTRIQLEEFRAAFAES |
| Ga0187771_114214132 | 3300018088 | Tropical Peatland | LKSASLQYANALADIALAQGAAEPAAKQLQEFGAAYAQSAE |
| Ga0066669_123525381 | 3300018482 | Grasslands Soil | LKSASLRYANALADIALAQSAAEPAAKQLHDFGAAYAQFAELRTFLAS |
| Ga0179590_12245772 | 3300020140 | Vadose Zone Soil | LRSASLQYATALADIALEQGAAGPVGKQLQDFGAACAESAELRN |
| Ga0210407_104593213 | 3300020579 | Soil | LKSASLQYANALADIALAQGAAEPAAKQLQEFGAAFAQSAEL |
| Ga0210407_109184041 | 3300020579 | Soil | MQYANALADIAMAQGSADAVAQQLIGFGALYAESAE |
| Ga0210407_113800271 | 3300020579 | Soil | LKSASLQYANALADVALAQGAADAALKQLGDFATAFAVS |
| Ga0210403_104949471 | 3300020580 | Soil | LKSASMQYANALADIAMAQGSADAVAQQLIGFGALYAES |
| Ga0210403_114851462 | 3300020580 | Soil | LKSASLQYANALADIALAQGAAEPVSKQLADFGAAYAE |
| Ga0210399_107684331 | 3300020581 | Soil | LKSAALQYATALAEIALEQGATEPVLNQLGDFARAYA |
| Ga0210401_102996713 | 3300020583 | Soil | LKSASFQYANALADIALAQGAAEPALKQLSDFGGVYA |
| Ga0210401_103987143 | 3300020583 | Soil | LRSASLQYATALADIALEQGAAEPVKKQLEDFGAAY |
| Ga0215015_109698322 | 3300021046 | Soil | LRSASLQYATALADVALEQGAAEPVKKQLEDFGAAYD |
| Ga0210404_106401872 | 3300021088 | Soil | LRSASLQYANALADIAVAQAAAEPVLKQLNDFGATY |
| Ga0210406_103156051 | 3300021168 | Soil | LKSVSRQYATTLADVAMAQGAADTATQELAGFGALY |
| Ga0210406_108410751 | 3300021168 | Soil | LKSASLQYANALADVALAQGAADAALKQLADFEAVFAESS |
| Ga0210400_103372611 | 3300021170 | Soil | LKSVGLQYANALADIALAQSAAETVTQELTGFGALYTESGELRN |
| Ga0210400_106066191 | 3300021170 | Soil | LKSASLQYANALADIALAQGAGDPAAKQLNEFGAAYEQS |
| Ga0210400_108114842 | 3300021170 | Soil | LRSASLQYATALVDVALEQGAAEPVKKQLEDFGAAYA |
| Ga0210400_114104271 | 3300021170 | Soil | LKSASLQYANALADIAMAQGAADTVAQQLIGFGALYA |
| Ga0210405_103406171 | 3300021171 | Soil | LKSASLQYANALADIAMAQGAAEAAAQQLNGFGAL |
| Ga0210408_104652593 | 3300021178 | Soil | LKSASLQYANAMADIALAQGAAEPAAKQLHDFGVAY |
| Ga0210396_116970101 | 3300021180 | Soil | LRSASLQYATALADIALEQGAAEPVKKQLEDFGAVY |
| Ga0210393_103988431 | 3300021401 | Soil | LKSASLQYANALADVALAQGAADTAQKQLGDFAAALGVSAE |
| Ga0210397_113337391 | 3300021403 | Soil | LKSASLQYANALADVALAQGAADSALKQLGDFAAAFAESS |
| Ga0210384_106768031 | 3300021432 | Soil | LKSASLQYANALADVALAQGAADPTVKQINEFGTAYAQSAELRT |
| Ga0210384_118914082 | 3300021432 | Soil | LKSASLQYANALADVALAQGAADAALKQLGDFAAVFGVSAELRNF |
| Ga0210391_105652821 | 3300021433 | Soil | LKSASLQYANALADIALAQGAGDAALHQLNDFREAY |
| Ga0210390_105659461 | 3300021474 | Soil | LKSASLQYANALADIALAQGAAEPALKQLSDFGGVYAE |
| Ga0210392_110004791 | 3300021475 | Soil | LKSASLQYANALADIALAQGAAEPAAKQLADFGAAYAESA |
| Ga0210402_108872621 | 3300021478 | Soil | LKSASLQYANALADVALAQGAADPTVKQINEFGTAYAQSTELRT |
| Ga0210402_111755422 | 3300021478 | Soil | LKSASLQYANALADIALAQGAADPALRQLIEFREAYAESAELR |
| Ga0210402_113168601 | 3300021478 | Soil | LKSASLQYANALADIALAQGAAEPAAKQLADFGAAFAES |
| Ga0210410_107106193 | 3300021479 | Soil | LKSASLQYANALADVALAQGAADAALKQLNDVAAAFATSG |
| Ga0210409_102609461 | 3300021559 | Soil | LKSASLQYANAMADIALAQGAAEPAAKQLSEFGAAY |
| Ga0242662_101563222 | 3300022533 | Soil | LKSASLQYANALADIALAQGAVEPAVKQLADFAAAYAESA |
| Ga0224549_10321651 | 3300022840 | Soil | LKSVALQYANALADIALEQGAAEPAGRQLLEFAAAYNE |
| Ga0247661_10705862 | 3300024254 | Soil | LKSASLQYANALADVALAQGAAVPVMQQLGDFAAAYESS |
| Ga0137417_11042963 | 3300024330 | Vadose Zone Soil | LKSASLQYANTMADIALAQGAAEPAAKQLHDFGAAYEE |
| Ga0137417_13724455 | 3300024330 | Vadose Zone Soil | LKSASLQYANAMADIALAQGAAEAAAKQLHDFGAAYSESAELRTFLEARR |
| Ga0207653_100042571 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANALADVALAQGAADAAVKQLADFAAAFGVS |
| Ga0207699_101791051 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANALADVALAQGAGAGDAALRQLSDFREAYAESAELRNFLAT |
| Ga0207693_103174511 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANALADIALAQGTAAPVTEQLGDFTAAYASSAELR |
| Ga0207700_107054763 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSASLQYANAMADIALAQGAAEPAAKQLQEFGAAYGQSTELRTFLA |
| Ga0209027_12120141 | 3300026300 | Grasslands Soil | LKVASLQYAKALADIALAQGAVEPIAKQLSAFGALFT |
| Ga0209240_11105571 | 3300026304 | Grasslands Soil | LKSASLQYANALADIALAQGAAEPAAKQLENFGAA |
| Ga0209154_12845862 | 3300026317 | Soil | LKSASLQYANALADIALEQGAAEPAGKQLESFGAAY |
| Ga0209158_12474941 | 3300026333 | Soil | LKSASLQYANALADIALAQGAADPAAKQLHEIGAAYA |
| Ga0209377_10692311 | 3300026334 | Soil | LKSASLRYANALADIALAQGAAEPTSKQLHEFGAAFA |
| Ga0209808_11604873 | 3300026523 | Soil | LKSASLQYAIAMADIALAQGAAETAAKQLHDFGAAYAQ |
| Ga0179587_111022651 | 3300026557 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAAKPLVEQLIGFGALYG |
| Ga0207779_10163143 | 3300026928 | Tropical Forest Soil | LKSASLQYANALADVVLQQGAAEPTRKQLEDFEAAYAESAEL |
| Ga0207777_10145381 | 3300027330 | Tropical Forest Soil | LKSASLQYANALADVVLQQGAAEPTRKQLEDFEAAYAESAELR |
| Ga0209329_11098061 | 3300027605 | Forest Soil | LKSASLQYANALADVALAQGAAEPVTQQLIGFGALYAES |
| Ga0209388_10455533 | 3300027655 | Vadose Zone Soil | LKSASLQYANALADIALAQGAAEPTAKQLSDFGVA |
| Ga0209588_10901711 | 3300027671 | Vadose Zone Soil | LKSASLQYANAMADIALAQGAAEPAAKQLHDFGAAYEQSGEL |
| Ga0209328_102335582 | 3300027727 | Forest Soil | LKSASLQYANALADIALEQGAAQPVLQQLADFGTL |
| Ga0209248_100543733 | 3300027729 | Bog Forest Soil | LKSASLQYANALADIALAQGAAESAVKQLGDFAAAYAESAEL |
| Ga0209139_102740801 | 3300027795 | Bog Forest Soil | LKSASLQYANALADIALAQGAAESAVKQLGDFAAAYAESA |
| Ga0209656_104586151 | 3300027812 | Bog Forest Soil | LKSASLQYATALAEIALEQGATEAVLQQLSDFGRAYDESAEL |
| Ga0209701_102223273 | 3300027862 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAAEPVAKQLAGFGAL |
| Ga0209701_105803491 | 3300027862 | Vadose Zone Soil | LKSASLQYANAMADIALAQGAAEPAAKQLHEFAAAYAQS |
| Ga0209283_108620132 | 3300027875 | Vadose Zone Soil | LKSASLQYANALADVALAQGAAKPVLKQLNDFGTS |
| Ga0209067_107820321 | 3300027898 | Watersheds | LRSASLQYATALADIALEQGAAEPVKKQLEDFGAAYAESVE |
| Ga0209488_105693181 | 3300027903 | Vadose Zone Soil | LKSASLQYANALADIAMAQGVADTVAQQLIGFGALYAESAELRNFL |
| Ga0209488_110434122 | 3300027903 | Vadose Zone Soil | LKSASLQYANALADIAMAQGAAKPLVEQLIGFGALYGES |
| Ga0209006_107830562 | 3300027908 | Forest Soil | LKSASLQYANALADIALEQGAAGPVNQQLSDFTAAYSGF |
| Ga0265354_10186512 | 3300028016 | Rhizosphere | LKSASLQYANALADVALAQGAADAALKQLSDFAAAFEV |
| Ga0247682_10197521 | 3300028146 | Soil | LKSASLQYANALADVALQQGAAEPVLKQLNDFANAY |
| Ga0268264_107081573 | 3300028381 | Switchgrass Rhizosphere | LKSASLQYANALADIALAQGAAPPVMQQLGDFATAYASSSELRNFLA |
| Ga0222749_101955093 | 3300029636 | Soil | LKSASLQYANALADVALAQGAADAALKQLGDFAAA |
| Ga0265770_11430352 | 3300030878 | Soil | LKSASLQYANALADVALAQGAADAALKQLSDFAAAFEVS |
| Ga0265765_10156751 | 3300030879 | Soil | LKSASLQYANALADVALAHGAADAALKQLSDFAAAFE |
| (restricted) Ga0255311_10800342 | 3300031150 | Sandy Soil | LKSASLQYANALADIALEQGAGDAAQKQLGDFAAAYAESAELCNL |
| Ga0265320_101508501 | 3300031240 | Rhizosphere | LKSASLQYANALADVALAQGAADAALKQLGDFAAAFDSSSELRNF |
| Ga0307474_100961881 | 3300031718 | Hardwood Forest Soil | LKSASLQYANAMADIALEQGAAEPAVKQLSAFGAVYGESS |
| Ga0307468_1012148282 | 3300031740 | Hardwood Forest Soil | LKSAALQYATALAEIALEQGATEPVLNQLGDFARAYAESAEL |
| Ga0318492_100901451 | 3300031748 | Soil | LKSASLQYANALADIALEQGAGEPAAKQLESFGAAYAQSAELRT |
| Ga0307477_108299341 | 3300031753 | Hardwood Forest Soil | LKSASLQYANALADIALAQGAGDPAAKQLNEFGTAYAQ |
| Ga0318543_105031052 | 3300031777 | Soil | LKSASLQYANALADVVLEQGAAEPVRKQLAEFVRLYEE |
| Ga0318529_100238374 | 3300031792 | Soil | LKSVSLQYANALADVALEQGAAEPVRKQLAEFVAMYEE |
| Ga0318568_104169261 | 3300031819 | Soil | LKSASLQYANALADIVLEQGAAEPAMKQLADFAAAYAESAPLRNF |
| Ga0307478_101930971 | 3300031823 | Hardwood Forest Soil | LKSASLQYANALADIAMAQGAADAATQQLVGFGALFAESAELRNFL |
| Ga0307478_108491681 | 3300031823 | Hardwood Forest Soil | LKSASLQYANALADIALAQGAAEPAVKQLADFAAAYAESAELR |
| Ga0306923_119685491 | 3300031910 | Soil | LKSASLQYATALADIALEQGAADPVKKQLADFGAAYAES |
| Ga0310916_102615105 | 3300031942 | Soil | LKSASLQYANALADVALAQGAASPVLQQLGDFNAAY |
| Ga0310909_109288052 | 3300031947 | Soil | LKSVSLQYANALADVALEQGAAEPARKQLAEFVAMYE |
| Ga0310909_112658442 | 3300031947 | Soil | LKSASLQYANALADIALEQGAAEPARRQLAEFVAMYEESAE |
| Ga0306926_110610751 | 3300031954 | Soil | LRSASLQYANALADIALAQGAAGPVLQQLGDFNAAYASSGELRN |
| Ga0307479_101495361 | 3300031962 | Hardwood Forest Soil | LKSASLQYANALADIAMAQGAAEAAAQQLSGFGALYGESAELRNFL |
| Ga0307479_103645541 | 3300031962 | Hardwood Forest Soil | LKSASLQYANALADIAMAQGAAEVATQQLIGFGALL |
| Ga0307479_108416501 | 3300031962 | Hardwood Forest Soil | LKSASLQYANALADTALAQGAADAVSKQLADFGALYAESA |
| Ga0307479_118254311 | 3300031962 | Hardwood Forest Soil | LKSASLQYANALADIALAQGAGDPAAKQLNEFGTAYAQS |
| Ga0318569_102752501 | 3300032010 | Soil | LKSVSLQYANALADVALEQGAAEPARKQLAEFVAM |
| Ga0318504_103029342 | 3300032063 | Soil | LKSASLQYANALADIVLEQRAAEPVRKQLAEFVRM |
| Ga0318514_103410421 | 3300032066 | Soil | LKSASLQYANALADIALEQGAGEPAAKQLESFGAAYAQSAEL |
| Ga0318524_107346082 | 3300032067 | Soil | LKSASLQYANALADIVLEQGAAEPARKQLMDFEGAYA |
| Ga0307471_1001727971 | 3300032180 | Hardwood Forest Soil | LKSASLQYANALADIALAQGAGEPAAKQLHEFAAAY |
| Ga0307471_1001844554 | 3300032180 | Hardwood Forest Soil | LKSASLQYANALADIALAQGAAEPTAKQLSAFGAAYAQSAEL |
| Ga0307471_1010422121 | 3300032180 | Hardwood Forest Soil | LKSASLQYANALADIALAQGAAEPTGKQLSDFGAAYAQSAEL |
| Ga0307471_1022548362 | 3300032180 | Hardwood Forest Soil | LKSASLQYANALADIAMAQGAADAARQQLVGFGALYAESAELRN |
| Ga0307471_1025289141 | 3300032180 | Hardwood Forest Soil | LKSASLQYANALADVALERGEAEPVLKQLNDFGATYAG |
| Ga0307471_1043465312 | 3300032180 | Hardwood Forest Soil | LRSASLQYATALADIALEQGAADPVKKQLEDFGAAYAES |
| Ga0307472_1008629403 | 3300032205 | Hardwood Forest Soil | LRSASHQYANALADVALEQGAAGPVLAQLKDFTGA |
| Ga0335082_112187432 | 3300032782 | Soil | LRSASLQYANALADVVLPQGAAEPTRKQLADFEVAYTESAE |
| Ga0335082_117177172 | 3300032782 | Soil | LKSASLQYANALADIVLQQGAAEPTRKQLADFRAAYEESA |
| Ga0335080_112192902 | 3300032828 | Soil | LRSASLQYANALADVVLPQGAAEPTRKQLADFEVAYTESAELRNFMA |
| Ga0335081_107831241 | 3300032892 | Soil | LKSASLQYANALADIALAQGAAEPAAKQLQEFGATYAQSA |
| Ga0335084_120834742 | 3300033004 | Soil | LKSASLQYANALADIAQAQGATAPIVKQLNEFGAA |
| Ga0335073_114499031 | 3300033134 | Soil | LKSASLQYATALADIALEQGAADPVWKQLADFIGVYGE |
| Ga0310914_104970501 | 3300033289 | Soil | LKSVSLQYANALADVALEQGAAEPARKQLAEFVAMYEE |
| ⦗Top⦘ |