Basic Information | |
---|---|
Family ID | F034330 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 175 |
Average Sequence Length | 44 residues |
Representative Sequence | VRAVETLTLLLAATVLFMWVIFAHPTPDERARLHDSMGPSTGIAWR |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 175 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 76.00 % |
% of genes near scaffold ends (potentially truncated) | 32.00 % |
% of genes from short scaffolds (< 2000 bps) | 78.86 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (65.143 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.571 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.571 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.714 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 175 Family Scaffolds |
---|---|---|
PF16363 | GDP_Man_Dehyd | 4.00 |
PF00196 | GerE | 2.29 |
PF04392 | ABC_sub_bind | 2.29 |
PF00072 | Response_reg | 1.71 |
PF01068 | DNA_ligase_A_M | 1.71 |
PF07366 | SnoaL | 1.71 |
PF00005 | ABC_tran | 1.14 |
PF07589 | PEP-CTERM | 1.14 |
PF01527 | HTH_Tnp_1 | 1.14 |
PF13541 | ChlI | 0.57 |
PF03033 | Glyco_transf_28 | 0.57 |
PF04909 | Amidohydro_2 | 0.57 |
PF08402 | TOBE_2 | 0.57 |
PF00691 | OmpA | 0.57 |
PF06723 | MreB_Mbl | 0.57 |
PF08352 | oligo_HPY | 0.57 |
PF09347 | DUF1989 | 0.57 |
PF01266 | DAO | 0.57 |
PF03928 | HbpS-like | 0.57 |
PF01370 | Epimerase | 0.57 |
PF02653 | BPD_transp_2 | 0.57 |
PF01844 | HNH | 0.57 |
PF13495 | Phage_int_SAM_4 | 0.57 |
PF03102 | NeuB | 0.57 |
PF03354 | TerL_ATPase | 0.57 |
PF00664 | ABC_membrane | 0.57 |
PF00528 | BPD_transp_1 | 0.57 |
PF00565 | SNase | 0.57 |
PF00211 | Guanylate_cyc | 0.57 |
PF01717 | Meth_synt_2 | 0.57 |
PF01842 | ACT | 0.57 |
PF02615 | Ldh_2 | 0.57 |
PF05969 | PSII_Ycf12 | 0.57 |
PF00892 | EamA | 0.57 |
PF01569 | PAP2 | 0.57 |
PF13727 | CoA_binding_3 | 0.57 |
PF13408 | Zn_ribbon_recom | 0.57 |
COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.29 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.71 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.71 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.57 |
COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.57 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.57 |
COG2089 | Sialic acid synthase SpsE, contains C-terminal SAF domain | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.57 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 65.14 % |
All Organisms | root | All Organisms | 34.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000891|JGI10214J12806_10806287 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300001661|JGI12053J15887_10506491 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300003995|Ga0055438_10016062 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300004058|Ga0055498_10147793 | Not Available | 511 | Open in IMG/M |
3300004114|Ga0062593_103059325 | Not Available | 535 | Open in IMG/M |
3300004463|Ga0063356_100300640 | Not Available | 1989 | Open in IMG/M |
3300004463|Ga0063356_101246291 | Not Available | 1084 | Open in IMG/M |
3300005093|Ga0062594_101909413 | Not Available | 630 | Open in IMG/M |
3300005445|Ga0070708_100005938 | All Organisms → cellular organisms → Bacteria | 9709 | Open in IMG/M |
3300005467|Ga0070706_100679342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 955 | Open in IMG/M |
3300005471|Ga0070698_100370786 | Not Available | 1364 | Open in IMG/M |
3300005549|Ga0070704_100010344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 5675 | Open in IMG/M |
3300005843|Ga0068860_101033806 | Not Available | 840 | Open in IMG/M |
3300005876|Ga0075300_1059215 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300006041|Ga0075023_100065105 | Not Available | 1181 | Open in IMG/M |
3300006172|Ga0075018_10000759 | All Organisms → cellular organisms → Bacteria | 10218 | Open in IMG/M |
3300006845|Ga0075421_102361437 | Not Available | 557 | Open in IMG/M |
3300006852|Ga0075433_10001377 | All Organisms → cellular organisms → Bacteria | 17867 | Open in IMG/M |
3300006854|Ga0075425_102127653 | Not Available | 626 | Open in IMG/M |
3300007265|Ga0099794_10165921 | Not Available | 1124 | Open in IMG/M |
3300009038|Ga0099829_10028549 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 3948 | Open in IMG/M |
3300009038|Ga0099829_10543789 | Not Available | 965 | Open in IMG/M |
3300009053|Ga0105095_10078122 | Not Available | 1787 | Open in IMG/M |
3300009087|Ga0105107_10495594 | Not Available | 851 | Open in IMG/M |
3300009087|Ga0105107_10861539 | Not Available | 630 | Open in IMG/M |
3300009088|Ga0099830_10075448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum | 2457 | Open in IMG/M |
3300009088|Ga0099830_10155990 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Candidatus Troglogloeales → Candidatus Manganitrophaceae → Candidatus Manganitrophus → Candidatus Manganitrophus noduliformans | 1759 | Open in IMG/M |
3300009090|Ga0099827_10841189 | Not Available | 794 | Open in IMG/M |
3300009166|Ga0105100_10288694 | Not Available | 984 | Open in IMG/M |
3300009166|Ga0105100_10608308 | Not Available | 670 | Open in IMG/M |
3300009174|Ga0105241_10853351 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300009553|Ga0105249_10201070 | Not Available | 1950 | Open in IMG/M |
3300009553|Ga0105249_10685359 | Not Available | 1084 | Open in IMG/M |
3300010397|Ga0134124_10082711 | Not Available | 2763 | Open in IMG/M |
3300010400|Ga0134122_12498888 | Not Available | 566 | Open in IMG/M |
3300011270|Ga0137391_10503514 | Not Available | 1025 | Open in IMG/M |
3300011271|Ga0137393_10470723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales | 1078 | Open in IMG/M |
3300012096|Ga0137389_11215981 | Not Available | 645 | Open in IMG/M |
3300012189|Ga0137388_10059037 | All Organisms → cellular organisms → Bacteria | 3148 | Open in IMG/M |
3300012203|Ga0137399_10320444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1284 | Open in IMG/M |
3300012203|Ga0137399_10369958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
3300012203|Ga0137399_11075175 | Not Available | 677 | Open in IMG/M |
3300012205|Ga0137362_10129170 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
3300012225|Ga0137434_1003158 | Not Available | 1513 | Open in IMG/M |
3300012225|Ga0137434_1072366 | Not Available | 545 | Open in IMG/M |
3300012361|Ga0137360_11847272 | Not Available | 510 | Open in IMG/M |
3300012363|Ga0137390_10499796 | Not Available | 1190 | Open in IMG/M |
3300012363|Ga0137390_10904681 | Not Available | 837 | Open in IMG/M |
3300012685|Ga0137397_10225540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
3300012685|Ga0137397_10272042 | Not Available | 1262 | Open in IMG/M |
3300012922|Ga0137394_10008909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7803 | Open in IMG/M |
3300012922|Ga0137394_10010581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 7212 | Open in IMG/M |
3300012922|Ga0137394_10365532 | Not Available | 1231 | Open in IMG/M |
3300012923|Ga0137359_11695086 | Not Available | 519 | Open in IMG/M |
3300012925|Ga0137419_10128198 | Not Available | 1802 | Open in IMG/M |
3300012927|Ga0137416_10409457 | Not Available | 1151 | Open in IMG/M |
3300012927|Ga0137416_10609739 | Not Available | 952 | Open in IMG/M |
3300012927|Ga0137416_11134982 | Not Available | 702 | Open in IMG/M |
3300012929|Ga0137404_10952215 | Not Available | 784 | Open in IMG/M |
3300015170|Ga0120098_1009490 | Not Available | 1042 | Open in IMG/M |
3300015245|Ga0137409_10126007 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
3300015259|Ga0180085_1101325 | Not Available | 849 | Open in IMG/M |
3300018000|Ga0184604_10000287 | All Organisms → cellular organisms → Bacteria | 5025 | Open in IMG/M |
3300018028|Ga0184608_10524952 | Not Available | 505 | Open in IMG/M |
3300018052|Ga0184638_1083611 | Not Available | 1170 | Open in IMG/M |
3300018052|Ga0184638_1113479 | Not Available | 992 | Open in IMG/M |
3300018056|Ga0184623_10420718 | Not Available | 584 | Open in IMG/M |
3300018056|Ga0184623_10520227 | Not Available | 505 | Open in IMG/M |
3300018061|Ga0184619_10068591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1563 | Open in IMG/M |
3300018061|Ga0184619_10329093 | Not Available | 698 | Open in IMG/M |
3300018061|Ga0184619_10492130 | Not Available | 542 | Open in IMG/M |
3300018063|Ga0184637_10007261 | All Organisms → cellular organisms → Bacteria | 6710 | Open in IMG/M |
3300018063|Ga0184637_10095234 | Not Available | 1831 | Open in IMG/M |
3300018070|Ga0184631_10275415 | Not Available | 697 | Open in IMG/M |
3300018071|Ga0184618_10423797 | Not Available | 562 | Open in IMG/M |
3300018075|Ga0184632_10072981 | Not Available | 1495 | Open in IMG/M |
3300018075|Ga0184632_10437122 | Not Available | 544 | Open in IMG/M |
3300018076|Ga0184609_10011679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 3294 | Open in IMG/M |
3300018076|Ga0184609_10073820 | Not Available | 1498 | Open in IMG/M |
3300018079|Ga0184627_10426774 | Not Available | 689 | Open in IMG/M |
3300018084|Ga0184629_10022409 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
3300018084|Ga0184629_10488431 | Not Available | 642 | Open in IMG/M |
3300018422|Ga0190265_10201138 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
3300018422|Ga0190265_10648223 | Not Available | 1176 | Open in IMG/M |
3300018422|Ga0190265_11446472 | Not Available | 801 | Open in IMG/M |
3300018422|Ga0190265_12094169 | Not Available | 670 | Open in IMG/M |
3300018422|Ga0190265_13500856 | Not Available | 523 | Open in IMG/M |
3300018429|Ga0190272_10052110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 2376 | Open in IMG/M |
3300018429|Ga0190272_10881580 | Not Available | 837 | Open in IMG/M |
3300018429|Ga0190272_11557669 | Not Available | 675 | Open in IMG/M |
3300019360|Ga0187894_10364690 | Not Available | 650 | Open in IMG/M |
3300019377|Ga0190264_10895385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
3300019377|Ga0190264_11596721 | Not Available | 573 | Open in IMG/M |
3300019458|Ga0187892_10003359 | All Organisms → cellular organisms → Bacteria | 29460 | Open in IMG/M |
3300019881|Ga0193707_1092486 | Not Available | 913 | Open in IMG/M |
3300019883|Ga0193725_1095077 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300019883|Ga0193725_1148802 | Not Available | 506 | Open in IMG/M |
3300019889|Ga0193743_1074850 | Not Available | 1353 | Open in IMG/M |
3300020170|Ga0179594_10180476 | Not Available | 788 | Open in IMG/M |
3300021073|Ga0210378_10002496 | All Organisms → cellular organisms → Bacteria | 9279 | Open in IMG/M |
3300021073|Ga0210378_10036012 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
3300021073|Ga0210378_10403448 | Not Available | 507 | Open in IMG/M |
3300021080|Ga0210382_10220668 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300021080|Ga0210382_10277127 | Not Available | 736 | Open in IMG/M |
3300021081|Ga0210379_10059098 | Not Available | 1542 | Open in IMG/M |
3300021081|Ga0210379_10221369 | Not Available | 818 | Open in IMG/M |
3300021088|Ga0210404_10004878 | All Organisms → cellular organisms → Bacteria | 5395 | Open in IMG/M |
3300021178|Ga0210408_11096552 | Not Available | 612 | Open in IMG/M |
3300021344|Ga0193719_10047757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1854 | Open in IMG/M |
3300021432|Ga0210384_10095565 | All Organisms → cellular organisms → Bacteria | 2667 | Open in IMG/M |
3300021432|Ga0210384_10122044 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2337 | Open in IMG/M |
3300022534|Ga0224452_1031228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1537 | Open in IMG/M |
3300022534|Ga0224452_1049753 | Not Available | 1243 | Open in IMG/M |
3300022534|Ga0224452_1191982 | Not Available | 628 | Open in IMG/M |
3300022694|Ga0222623_10062727 | Not Available | 1435 | Open in IMG/M |
3300022694|Ga0222623_10173033 | Not Available | 840 | Open in IMG/M |
3300022694|Ga0222623_10293125 | Not Available | 625 | Open in IMG/M |
3300022694|Ga0222623_10426178 | Not Available | 503 | Open in IMG/M |
3300024330|Ga0137417_1239462 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300025324|Ga0209640_10000879 | All Organisms → cellular organisms → Bacteria | 24352 | Open in IMG/M |
3300025324|Ga0209640_10079407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2835 | Open in IMG/M |
3300025324|Ga0209640_10550135 | Not Available | 936 | Open in IMG/M |
3300025549|Ga0210094_1025692 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300025910|Ga0207684_10079458 | Not Available | 2790 | Open in IMG/M |
3300025910|Ga0207684_11655728 | Not Available | 517 | Open in IMG/M |
3300025912|Ga0207707_11160360 | Not Available | 627 | Open in IMG/M |
3300025917|Ga0207660_10178490 | Not Available | 1648 | Open in IMG/M |
3300025923|Ga0207681_10421612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1081 | Open in IMG/M |
3300025961|Ga0207712_10214090 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
3300026041|Ga0207639_11697014 | Not Available | 592 | Open in IMG/M |
3300026075|Ga0207708_11022597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
3300026285|Ga0209438_1206776 | Not Available | 525 | Open in IMG/M |
3300026320|Ga0209131_1369167 | Not Available | 534 | Open in IMG/M |
3300026358|Ga0257166_1033365 | Not Available | 708 | Open in IMG/M |
3300026499|Ga0257181_1097434 | Not Available | 518 | Open in IMG/M |
3300026535|Ga0256867_10116280 | Not Available | 1021 | Open in IMG/M |
3300026535|Ga0256867_10226746 | Not Available | 677 | Open in IMG/M |
3300026551|Ga0209648_10112482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Ferribacterium → Ferribacterium limneticum | 2212 | Open in IMG/M |
3300027650|Ga0256866_1047452 | Not Available | 1136 | Open in IMG/M |
3300027655|Ga0209388_1174060 | Not Available | 603 | Open in IMG/M |
3300027731|Ga0209592_1347319 | Not Available | 502 | Open in IMG/M |
3300027815|Ga0209726_10246096 | Not Available | 907 | Open in IMG/M |
3300027894|Ga0209068_10001935 | All Organisms → cellular organisms → Bacteria | 10220 | Open in IMG/M |
3300027894|Ga0209068_10047751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2165 | Open in IMG/M |
3300027915|Ga0209069_10078495 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300028047|Ga0209526_10047696 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
3300028380|Ga0268265_11365915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
3300028536|Ga0137415_10107117 | Not Available | 2644 | Open in IMG/M |
3300028536|Ga0137415_11024444 | Not Available | 637 | Open in IMG/M |
3300028716|Ga0307311_10234483 | Not Available | 543 | Open in IMG/M |
3300028792|Ga0307504_10094467 | Not Available | 941 | Open in IMG/M |
3300028792|Ga0307504_10271439 | Not Available | 628 | Open in IMG/M |
3300028796|Ga0307287_10296889 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300028803|Ga0307281_10006611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3175 | Open in IMG/M |
3300028803|Ga0307281_10007766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2959 | Open in IMG/M |
3300028803|Ga0307281_10243662 | Not Available | 658 | Open in IMG/M |
3300028807|Ga0307305_10512695 | Not Available | 537 | Open in IMG/M |
3300028819|Ga0307296_10252830 | Not Available | 959 | Open in IMG/M |
3300028824|Ga0307310_10363999 | Not Available | 713 | Open in IMG/M |
3300030006|Ga0299907_10980840 | Not Available | 622 | Open in IMG/M |
3300030619|Ga0268386_10005315 | All Organisms → cellular organisms → Bacteria | 9582 | Open in IMG/M |
3300030619|Ga0268386_10076820 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2606 | Open in IMG/M |
3300030619|Ga0268386_10082365 | Not Available | 2507 | Open in IMG/M |
3300030619|Ga0268386_10312234 | Not Available | 1133 | Open in IMG/M |
3300030619|Ga0268386_10623267 | Not Available | 716 | Open in IMG/M |
3300030619|Ga0268386_10876856 | Not Available | 565 | Open in IMG/M |
3300031093|Ga0308197_10323749 | Not Available | 577 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10016013 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1926 | Open in IMG/M |
3300031229|Ga0299913_10020286 | All Organisms → cellular organisms → Bacteria | 6133 | Open in IMG/M |
(restricted) 3300031237|Ga0255334_1018304 | Not Available | 851 | Open in IMG/M |
3300031720|Ga0307469_10256063 | Not Available | 1412 | Open in IMG/M |
3300032180|Ga0307471_100485644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1381 | Open in IMG/M |
3300033513|Ga0316628_104112302 | Not Available | 519 | Open in IMG/M |
3300033811|Ga0364924_182746 | Not Available | 503 | Open in IMG/M |
3300034257|Ga0370495_0025657 | Not Available | 1758 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.43% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 11.43% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.43% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.86% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.71% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.14% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.14% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.14% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.14% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.57% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.57% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.57% |
Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.57% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.57% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.57% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031237 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_108062874 | 3300000891 | Soil | VRVVETLTLLLVATALFMWVILAHPTPDEQGRLYDSMGPSTGIAWR* |
JGI12053J15887_105064913 | 3300001661 | Forest Soil | VRAVETLTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR* |
Ga0055438_100160623 | 3300003995 | Natural And Restored Wetlands | MRVVETLTLLLVATVLFMWVIFAHPTPDERARLHDSMGASTGIAWR* |
Ga0055498_101477932 | 3300004058 | Natural And Restored Wetlands | MRVVETLTLLLVATVLFMWVVLAHPTPDERARLHDSMGQSTGIAWR* |
Ga0062593_1030593252 | 3300004114 | Soil | MRAVETLTLLLAGTVLFMWVILAHPTPDERARLYDSMGSSTGVAWR* |
Ga0063356_1003006404 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPPLRRGMTGLLMRLVEALALLLVATVLFMWVILAHPTPDERARLHDSMGQSTGMAWR* |
Ga0063356_1012462912 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR* |
Ga0062594_1019094131 | 3300005093 | Soil | MRLVEALALLLVATVLFMWVILAHPTPDERARLHDSMGQSTGMAWR* |
Ga0070708_1000059389 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSVEPVTLVLIATVLFMWVVLGHSPPDERARLQDSMGQSTGIAWR* |
Ga0070706_1006793422 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLLLVTTVLFMWVIFAPPTPDERARLHDSMGASTGIAWR* |
Ga0070698_1003707861 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGVETVTLVLIATVLFMWVVLGHSTPDERARLQDSMGQSTGIAWR* |
Ga0070704_1000103446 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLLLVATALFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR* |
Ga0068860_1010338061 | 3300005843 | Switchgrass Rhizosphere | VRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR* |
Ga0075300_10592151 | 3300005876 | Rice Paddy Soil | AVTGPLMRVVETLTLFLAAIVLFMWVIFAHPTSDERARLYDSMGQSTGIAWR* |
Ga0075023_1000651053 | 3300006041 | Watersheds | MRGVETLMLVLIATVLFMWVVLGHSTPDERARLHDSIGDSTGIAWR* |
Ga0075018_100007598 | 3300006172 | Watersheds | MRGVETLMLVLIATVLFMWVVLGHSTSDERARLHDSMGDSTGIAWR* |
Ga0075421_1023614371 | 3300006845 | Populus Rhizosphere | MRVVETVTLLLVATVLFMWVVLAHPTPDERARLYDSMGQSTGIAWR* |
Ga0075433_1000137722 | 3300006852 | Populus Rhizosphere | MRGVETLMLVLIATVLFMWVVLGHSTPDERARLYDSMGDSTGIAWR* |
Ga0075425_1021276531 | 3300006854 | Populus Rhizosphere | MRAIETLTVVLAAIVLFMWAILAHSTPDGRARLHDSMGSST |
Ga0099794_101659214 | 3300007265 | Vadose Zone Soil | TLLLAATVLFMWAILAHPTPEERARLHDSMGPSTGIAWR* |
Ga0099829_100285492 | 3300009038 | Vadose Zone Soil | MLLLAATVLFMWVIFAHPTPDERARLHDSMGASTGIAWR* |
Ga0099829_105437893 | 3300009038 | Vadose Zone Soil | MRAVETLTLLLAATVLFMWAIFAHPTPDERARLHDSMGPSTGIAWR* |
Ga0105095_100781222 | 3300009053 | Freshwater Sediment | MRLVETLALLLAATVLFIWVILAHPTADERARLHDSMGQSTGIAWR* |
Ga0105107_104955944 | 3300009087 | Freshwater Sediment | MRLVETLTLLLAATVLFMWVILAHPTADERARLHDSLGQSTGIAWR* |
Ga0105107_108615392 | 3300009087 | Freshwater Sediment | MRVVETLTLLLAATVLFMWVIFAHPTPDERARLHDSMGSSTGIAWR* |
Ga0099830_100754483 | 3300009088 | Vadose Zone Soil | VRVVETLTLLLVATVLFMWVIFAPPTPDERARLHDSMGASTGIAWR* |
Ga0099830_101559905 | 3300009088 | Vadose Zone Soil | MRATETLAVVLAAIVLFMWAVLAHSTPDERARLHDSMGPSTGIAWR* |
Ga0099827_108411892 | 3300009090 | Vadose Zone Soil | VRAVETLTLLLAATVLFMWVIFAHPTPDERARLHDSMGPSTGIAWR* |
Ga0105100_102886943 | 3300009166 | Freshwater Sediment | TLLLAATVLFMWVIFAHPTPDERARLHDSMGSSTGIAWR* |
Ga0105100_106083082 | 3300009166 | Freshwater Sediment | MRLVETLALLLAATVLFIWVILAHPTADERARLHDS |
Ga0105241_108533512 | 3300009174 | Corn Rhizosphere | MRAVETLTLLLAATVLFMWVILAHPTPDERARLYDSMGSSTGVAWR* |
Ga0105249_102010703 | 3300009553 | Switchgrass Rhizosphere | TLLLAGTVLFMWVILAHPTPDERARLYDSMGSSTGVAWR* |
Ga0105249_106853591 | 3300009553 | Switchgrass Rhizosphere | SIVRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR* |
Ga0134124_100827114 | 3300010397 | Terrestrial Soil | VETLTLLLAGTVLFMWVILAHPTPDERARLYDSMGSSTGVAWR* |
Ga0134122_124988881 | 3300010400 | Terrestrial Soil | MRLVETLALLLAATVLFMWVILAHPTPDERARLHDSMGQSTGIAWR* |
Ga0137391_105035142 | 3300011270 | Vadose Zone Soil | MRGVETLTLVLIATVLFMWVILGHSTPDERARLQDSMGQSTGIAWR* |
Ga0137393_104707232 | 3300011271 | Vadose Zone Soil | ETLTLLLVATVLFMWVIFAHPTPDERARLHDSMGTSTGIAWR* |
Ga0137389_112159812 | 3300012096 | Vadose Zone Soil | ETLTLLLAATVLFMWAILAHPTPDERARLHDSMGQSTGIAWR* |
Ga0137388_100590378 | 3300012189 | Vadose Zone Soil | VRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGMAWR* |
Ga0137399_103204441 | 3300012203 | Vadose Zone Soil | ETLTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR* |
Ga0137399_103699583 | 3300012203 | Vadose Zone Soil | VRAVETLTLLLAATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR* |
Ga0137399_110751753 | 3300012203 | Vadose Zone Soil | VRVVETLTLLLVATVLFMWVIFAHPTPDERGRLYDSMGPSTGIAWR* |
Ga0137362_101291702 | 3300012205 | Vadose Zone Soil | MRGAETLTLVLIATVLFMWVVLGHSTPDERARLQDSMGQSTGIAWR* |
Ga0137434_10031583 | 3300012225 | Soil | VRAVETLTLLLAAIVLFMWAILAHPTPEERARLHDSLGPSTGIAWR* |
Ga0137434_10723662 | 3300012225 | Soil | MRVVETLTLVLAAAVLFMWVILAHPTPDERSRVYDSMGQSTGVAWR* |
Ga0137360_118472721 | 3300012361 | Vadose Zone Soil | RWRAGLREGAMRGVETLTLVLIATVLFMWVVLGHSTPDERARLQDSMGQSTGIAWR* |
Ga0137390_104997964 | 3300012363 | Vadose Zone Soil | LTLLLVATVLFMWVIFAHPTPDERGRLYDSMGPSTGIAW |
Ga0137390_109046812 | 3300012363 | Vadose Zone Soil | MRAAETLTLLLIGTVIFMWAVLAHSTPQEQARLHDAMGQSTGIAWR* |
Ga0137397_102255402 | 3300012685 | Vadose Zone Soil | VRVLETLTVLLVATVLFMWVILAHPTPDERARLHDSMGATTGIAWR* |
Ga0137397_102720421 | 3300012685 | Vadose Zone Soil | LTLLLAATVLFMWVIFAHPTPDERTRVYDSMGQSTGI |
Ga0137394_100089092 | 3300012922 | Vadose Zone Soil | VRVLETLTFLLVATVLFMWVILAHPTPDERARLHDSMGATTGIAWR* |
Ga0137394_100105815 | 3300012922 | Vadose Zone Soil | LTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR* |
Ga0137394_103655323 | 3300012922 | Vadose Zone Soil | MRVVETLTLLLAATALFMWVTFAHPTPDERTRVYDSMGQSTGIAWR* |
Ga0137359_116950861 | 3300012923 | Vadose Zone Soil | RGSIVRAVETLTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR* |
Ga0137419_101281984 | 3300012925 | Vadose Zone Soil | LLIATLLFMWVTFSHQTPDPRARLHDSMGASTGIAWR* |
Ga0137416_104094572 | 3300012927 | Vadose Zone Soil | MRVVETLTLLLAATSLFMWVIFAHPTPDERTRVYDSMGQSTGIAWR* |
Ga0137416_106097392 | 3300012927 | Vadose Zone Soil | VRAVETLTLLLIAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR* |
Ga0137416_111349821 | 3300012927 | Vadose Zone Soil | MRGVETLTLVLIATVLFTWVVLGHSTPDERARLQDSMGQSTGIAWR* |
Ga0137404_109522152 | 3300012929 | Vadose Zone Soil | VRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYHSMGPSTGIEWR* |
Ga0120098_10094902 | 3300015170 | Fossill | MRVVETLTLLLAATVLFMWVIFAHPTPDERARLHDSMGASTGIAWR* |
Ga0137409_101260072 | 3300015245 | Vadose Zone Soil | MRVVETLTLLLAATALFMWVIFAHPTPAERTRVYDSMGQSTGIAWR* |
Ga0180085_11013251 | 3300015259 | Soil | LLLAATVLFMWAIFAHPTPEERARLHDSMGQSTGIAWR* |
Ga0184604_100002873 | 3300018000 | Groundwater Sediment | LTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR |
Ga0184608_105249521 | 3300018028 | Groundwater Sediment | VRAVETLTLLLAATVLFMWVIFAHPTPDERTRVYDSMGQST |
Ga0184638_10836113 | 3300018052 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAIFAHPTPEERSRLHDSMGQSTGIAWR |
Ga0184638_11134792 | 3300018052 | Groundwater Sediment | LTLLLVATVLFMWVIFAHPTPDERARLHDSMGPSTGIAWR |
Ga0184623_104207182 | 3300018056 | Groundwater Sediment | VTLLLAATVLFMWAIFAHPTPEERSRLHDSMGQSTGIAWR |
Ga0184623_105202271 | 3300018056 | Groundwater Sediment | MRAVETLTLLLAATVLFMWAIFAHPTPDERARLHDSMGQSTGIAWR |
Ga0184619_100685911 | 3300018061 | Groundwater Sediment | LTLLLVAMVLFMWVIFAHPTSDEQSRLYDSMGPSTGIAWR |
Ga0184619_103290932 | 3300018061 | Groundwater Sediment | VRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR |
Ga0184619_104921302 | 3300018061 | Groundwater Sediment | MRAVETLTLLLAATVLFMWVILAHPTPDEQARVYDSMGQSTGIAWR |
Ga0184637_100072617 | 3300018063 | Groundwater Sediment | MRVAETLTVLVAAIVLFMWAVFAHSTPDERARLHDSMGPSTGIAWR |
Ga0184637_100952344 | 3300018063 | Groundwater Sediment | VRAVETVTLLLAATVLFMWAIFAHPTPEERSRLHDSMGQSTGIAWR |
Ga0184631_102754152 | 3300018070 | Groundwater Sediment | LALLLAATVLFMWAIFAHPTPEERARLHDSMGASTGIAWR |
Ga0184618_104237971 | 3300018071 | Groundwater Sediment | MRVVETLTLLLAATALFMWVIFAHPTPDERTRVYDSMGQSTGIAWR |
Ga0184632_100729811 | 3300018075 | Groundwater Sediment | MSHRGARGRRSIVRAIEMLMLVLAAIVVFMWVILAHPTPDEQARVYDSMGQSTGIAWR |
Ga0184632_104371222 | 3300018075 | Groundwater Sediment | LLAATVLFMWVILAHPTPEERARLHDSMGASTRIAWR |
Ga0184609_100116797 | 3300018076 | Groundwater Sediment | MLLLAATVLFMWVIFAHPTPDEQARVYDSMGKSTGIAWR |
Ga0184609_100738205 | 3300018076 | Groundwater Sediment | LLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR |
Ga0184627_104267741 | 3300018079 | Groundwater Sediment | MRAVETLTLLLAATVLFMWAIFAHPTPEERSRLHDSMGQSTGIAWR |
Ga0184629_100224096 | 3300018084 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAILAHPTPEERARLHDSMGPSTGIAWR |
Ga0184629_104884311 | 3300018084 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAILAHPTPEERSRLQDSMGQSTGIAWR |
Ga0190265_102011384 | 3300018422 | Soil | MRLVETLALLLAATVLFMWVILAHPTPDERARLHDAMGQSTGIAWR |
Ga0190265_106482232 | 3300018422 | Soil | MLLLAATVLFMWVILAHPTPDERARLHDAMGQSTGIAWR |
Ga0190265_114464722 | 3300018422 | Soil | LTLLLAATVLFMWVILAHPTADEQARLQDSMGQSTGVAWR |
Ga0190265_120941692 | 3300018422 | Soil | IVRVVEALTLLLVATVLFMWVIFAHPTQEERARPHDSMGQSTGIMWR |
Ga0190265_135008562 | 3300018422 | Soil | VTLLLAATVLFMWAIFAHPTPEERARLHDSMGASTGIAWR |
Ga0190272_100521104 | 3300018429 | Soil | MRAVETLTLLLAATVLFMWAIFAHPTPDEQARVYDSMGQSTGVAWR |
Ga0190272_108815801 | 3300018429 | Soil | VRAVETLTLLLAATVLFMWAIFAHPTPDEQGRLYDSMGPSTGIAWR |
Ga0190272_115576691 | 3300018429 | Soil | MRAVEVLTLLLAATVLFMWVILAHPTPDEQARVYDSMGQSTGIAWR |
Ga0187894_103646902 | 3300019360 | Microbial Mat On Rocks | MRLVETLALLLAATVLFMWVILAHPTQDERARLHDSMGQSTGIAWR |
Ga0190264_108953852 | 3300019377 | Soil | MRFVETVTLLLMVTVLFMWVIFAHPTPDERARLHDSMGASTGIAWR |
Ga0190264_115967212 | 3300019377 | Soil | MLLAATVLFMWVILAHPTPDERARLHDAMGQSTGIAWR |
Ga0187892_1000335915 | 3300019458 | Bio-Ooze | MRAAETLTVLLAAIVLFMWAILAHSTPDERARLHDSMGPSTGIAWR |
Ga0193707_10924861 | 3300019881 | Soil | AVWRGSIVRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR |
Ga0193725_10950771 | 3300019883 | Soil | LTLLLVAMVLFMWVIFAHPTPDEQSRRYDSMGPSTGIAWR |
Ga0193725_11488022 | 3300019883 | Soil | RAVETLTVLLAATVLFMWAILAHPTPEERARLHDSMGPSTGIAWR |
Ga0193743_10748502 | 3300019889 | Soil | VRAVETLTLLLVATVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR |
Ga0179594_101804763 | 3300020170 | Vadose Zone Soil | MRVIETLTLLLAATALFMWVIFAHPTPDERTRVYDSM |
Ga0210378_1000249615 | 3300021073 | Groundwater Sediment | VRVVETLMLLLAATVLFMWVIFAHPTPDEQARVYDSMGKSTGIAWR |
Ga0210378_100360121 | 3300021073 | Groundwater Sediment | MRAVETLTLLLVVTVLFMWAIFAHPTPDERARLHDSMGQSTGIAWR |
Ga0210378_104034482 | 3300021073 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAILAHPTPEERARLHDSMGASTGIAWR |
Ga0210382_102206681 | 3300021080 | Groundwater Sediment | LTLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGIAWR |
Ga0210382_102771272 | 3300021080 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAIFAHPTPDEQGRLYDSMGQSTGIAWR |
Ga0210379_100590984 | 3300021081 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAIFAHPTPEERARLHDSMGQSTGIAWR |
Ga0210379_102213693 | 3300021081 | Groundwater Sediment | LARSTLAVWRGSIVRAVETLTLLLAATVLFMWAILAHPTPEERARLHDSMGPSTGIAWR |
Ga0210404_100048787 | 3300021088 | Soil | MRGVETLTLVLIATVLFMWVVLGHSTPDERARLQDSMGQSTGIAWR |
Ga0210408_110965521 | 3300021178 | Soil | LLMATVLFMRVIFAPPTPDGRTRLHDSMGASTGIGWR |
Ga0193719_100477572 | 3300021344 | Soil | VRAVETLTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR |
Ga0210384_100955652 | 3300021432 | Soil | MRGVETLMLVLIVTVLFMWVVLGHSTPDEQARLYDSMGDSTGIAWR |
Ga0210384_101220444 | 3300021432 | Soil | MRGVETLMLVLIATVLFMWVVLGHSTPDERARLYDSMGDSTGIAWR |
Ga0224452_10312282 | 3300022534 | Groundwater Sediment | LTLLLAATVLFMWVIFAHPTPDERARLHDSMGSSTGIAWR |
Ga0224452_10497533 | 3300022534 | Groundwater Sediment | VRAVETLTLLLAATVLFMWVILAHPTPEERARLHDSMGASTGIAWR |
Ga0224452_11919822 | 3300022534 | Groundwater Sediment | TLLLAATVLFMWAIFAHPTPDERARVYDSMGKSTGIAWR |
Ga0222623_100627271 | 3300022694 | Groundwater Sediment | GSIMRAVETLTLLLAATVLFMWAIFAHPTPEERSRLQDSMGQSTGIAWR |
Ga0222623_101730331 | 3300022694 | Groundwater Sediment | IVRAVETLTLLLAATVLFMWAILAHPTPEERARLHDSMGQSTGIAWR |
Ga0222623_102931251 | 3300022694 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAILAHPTPEERARLHDSMGPSTGIA |
Ga0222623_104261781 | 3300022694 | Groundwater Sediment | VRAVETLTLLLAATVLFMWAIFAHPTPEERSRLHDSMGQSTGI |
Ga0137417_12394621 | 3300024330 | Vadose Zone Soil | AFWRGSIVRAVEKLTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR |
Ga0209640_1000087919 | 3300025324 | Soil | MRAAETLTLLLAATVLFMWAVFAHPTPDERARLYDSMGSSTGIAWR |
Ga0209640_100794074 | 3300025324 | Soil | MRVVETLTLLLAATVVFMWVIFAHPTPDERARLHDSMGASTGIAWR |
Ga0209640_105501352 | 3300025324 | Soil | VRAVEALMLLLAATVLFMWAIFAHPTPDERARLHDSMGQSTGIAWR |
Ga0210094_10256921 | 3300025549 | Natural And Restored Wetlands | VQRVVETLTLLLVATVLFMWVIFAHPTPDERARLHDSMGASTGIAWR |
Ga0207684_100794584 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAAETVTVVLTAIVLFMWAVLAHSTPDERARLHDSMGSSTGIAWR |
Ga0207684_116557281 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GHRGTWHAGQREGAMRSVETLTLVLIATVLFMWVVLGHSTPEERARLQDSMGQSTGIAWR |
Ga0207707_111603601 | 3300025912 | Corn Rhizosphere | MRAVETLTLLLAATVLFMWVILAHPTPDERARLYDSMGSSTGVAWR |
Ga0207660_101784903 | 3300025917 | Corn Rhizosphere | MRLVEALALLLVATVLFMWVILAHPTPDERARLHDSMGQSTGMAWR |
Ga0207681_104216121 | 3300025923 | Switchgrass Rhizosphere | MRAVETLTLLLAGTVLFMWVILAHPTPDERARLYDSMGSSTGVAWR |
Ga0207712_102140901 | 3300025961 | Switchgrass Rhizosphere | GIALLLAGTVLFMWVILAHPTPDERARLYDSMGSSTGVAWR |
Ga0207639_116970141 | 3300026041 | Corn Rhizosphere | LLAGTVLFMWVILAHPTPDERARLYDSMGSSTGVAWR |
Ga0207708_110225971 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAVETLTLLLAGTVLFMWVILAHPTPDERARLYDSMGS |
Ga0209438_12067761 | 3300026285 | Grasslands Soil | VRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYDS |
Ga0209131_13691671 | 3300026320 | Grasslands Soil | VRVLETLTVLLVATVLFMWVILAHPTPDERTRLHDSMG |
Ga0257166_10333651 | 3300026358 | Soil | VRAVETLTLLLVATVLFMWVIFAHPTPDEQGRLYDSMGPSTGMAWR |
Ga0257181_10974342 | 3300026499 | Soil | LTLVLAATVLFMWVIFAHPTPEERARLHDSMGPSTGIAWR |
Ga0256867_101162802 | 3300026535 | Soil | MRLVETLALLLAATVLFMWAIFAHPTPEERSRLYDSMGSSTGIAWR |
Ga0256867_102267463 | 3300026535 | Soil | VETLTLLLAATVLFMWAIFAHPTPEERSRLYDSMGSSTGIAWR |
Ga0209648_101124821 | 3300026551 | Grasslands Soil | VRVVETLPLLLVATVLFMWVIFAPPTPDERARLHDSMGASTGIAWR |
Ga0256866_10474522 | 3300027650 | Soil | MRLVETLTLLLAATVLFMWAIFAHPTPEERSRLYDSMGSSTGIAWR |
Ga0209388_11740602 | 3300027655 | Vadose Zone Soil | VRVVETLTLLLVATVLFMWVIFAPPTPDERARLHDSMGAS |
Ga0209592_13473191 | 3300027731 | Freshwater Sediment | MRLVETLALLLAATVLFIWVILAHPTADERARLHDSMGQSTGIAWR |
Ga0209726_102460963 | 3300027815 | Groundwater | MRAVETLTLMLVATVLFMWVIFAHPTPDEQARLHDSMGQSTGIAWR |
Ga0209068_100019359 | 3300027894 | Watersheds | MRGVETLMLVLIATVLFMWVVLGHSTPDERARLHDSMGDSTGIAWR |
Ga0209068_100477515 | 3300027894 | Watersheds | REGAMRGVETLMLVLIATVLFMWVVLGHSTPDERARLHDSIGDSTGIAWR |
Ga0209069_100784954 | 3300027915 | Watersheds | TLMLVLIATVLFMWVVLGHSTPDERARLHDSIGDSTGIAWR |
Ga0209526_100476962 | 3300028047 | Forest Soil | MRGVETLMLVLIATVLFMWVVLGHSTSDERARLHDSMGQSTGIAWR |
Ga0268265_113659152 | 3300028380 | Switchgrass Rhizosphere | VRVVETLTLLLVATALFMWVILAHPTPDEQGRLYDSMGPSTGIAWR |
Ga0137415_101071172 | 3300028536 | Vadose Zone Soil | VRVVETLTLLLVATVLFMWVIFAHPTPDERGRLYDSMGPSTGIAWR |
Ga0137415_110244441 | 3300028536 | Vadose Zone Soil | MRGVETSTLVLIATVLFTWVVLGHSTPDERARLQDSMGQSTGIAWR |
Ga0307311_102344832 | 3300028716 | Soil | LVATVLFMWVIFAHPTPDEQGRLYDSMGSSTGIAWR |
Ga0307504_100944671 | 3300028792 | Soil | MRAVETLTLLLAATVLFMWAIFAHPTPEERARLYDSMGVSTGIAWR |
Ga0307504_102714392 | 3300028792 | Soil | MRGGVETLMLVLIATVLFMWVVLGHSTPDERARLHDSMGQSTGIAWR |
Ga0307287_102968893 | 3300028796 | Soil | WRGSIVRAVETLTLLLVAMVLFMWVIFAHPTPDEQSRLYDSMGPSTGIAWR |
Ga0307281_100066111 | 3300028803 | Soil | LLLAATVLFMWVIFAHPTPEERSRLHDSMGQSTGIAWR |
Ga0307281_100077663 | 3300028803 | Soil | VRAVETLTLLLAATVLFMWAIFAHPTPEERARLHDSMGASTGIAWR |
Ga0307281_102436621 | 3300028803 | Soil | VRAVETLTLLLAATVLFMWAILAHPTPEERARLHDSMGPSTGIAW |
Ga0307305_105126951 | 3300028807 | Soil | MRAVETLTLLLAATVLFMWVILAHPTPDEQARVYDSMGQ |
Ga0307296_102528303 | 3300028819 | Soil | VRAVETLTLLLVATVLFMWVIFAHPTPDERARLHDSMGASTGIAWR |
Ga0307310_103639993 | 3300028824 | Soil | LTLLLAATVLFMWAILAHPTPEERARLHDSMGQSTGIAWR |
Ga0299907_109808401 | 3300030006 | Soil | PCGAGWRGPLMRLVETLALLLAATVLFIWVILAHPTADERARLHDSMGQSTGIAWR |
Ga0268386_1000531515 | 3300030619 | Soil | MRAVETLTLLLAATVLFMWVIFAHPTPDEQARVYDSMGQSTGIAWR |
Ga0268386_100768201 | 3300030619 | Soil | MRAVETLTLLLAATVLFMWVIFAHPTPDEQARVYDSMGQSTG |
Ga0268386_100823653 | 3300030619 | Soil | MRVVETLTLLLAATVLFMWAIFAHPTPDERARLYDSMGQSTGIAWR |
Ga0268386_103122345 | 3300030619 | Soil | RLGETLALLLAATVLFMWAIFAHPTPEERSRLYDSMGSSTGIAWR |
Ga0268386_106232671 | 3300030619 | Soil | RCRPCGAGWRGPLMRLVETLALLLAATVLFIWVILAHPTADERARLHDSMGQSTGIAWR |
Ga0268386_108768561 | 3300030619 | Soil | MRAVETLTLVLAATVLFMWVIFAHPTPDEQARVYDSMGQSTGIAWR |
Ga0308197_103237491 | 3300031093 | Soil | VRAVETLTLLLVATVLFMWVIFAHPTPDERGRLYDSMGPSTGIAWR |
(restricted) Ga0255310_100160131 | 3300031197 | Sandy Soil | MRVVETLTLLLVATVLFMWVIFAHPTPGERARLHDSMGS |
Ga0299913_100202868 | 3300031229 | Soil | MRLVETLALLLAATVLFIWVILARPTADERARLHDSMG |
(restricted) Ga0255334_10183042 | 3300031237 | Sandy Soil | MRVVETLTLLLAATVLFMWVIFAHPTPDERARLHDSMGSSTGIAWR |
Ga0307469_102560634 | 3300031720 | Hardwood Forest Soil | MRLVETLALLLAATVLFMWVILAHPTPDERARLHDSMGQSTGIAWR |
Ga0307471_1004856441 | 3300032180 | Hardwood Forest Soil | MRGVETLTLVLIATVLFMWVVLGHSTPEERARLQDSMGQSTGIAWR |
Ga0316628_1041123021 | 3300033513 | Soil | MRVVETLTLLLVAAVLFMWVIFAHPTSDERARLYDSMGQSTGIAWR |
Ga0364924_182746_101_241 | 3300033811 | Sediment | MRAVETLALLLAATVLFMWAILAHPTPEERARLHDSMGPSTGIAWR |
Ga0370495_0025657_748_888 | 3300034257 | Untreated Peat Soil | MRAVETLTLVLVATVLFMWVVLAHPTPDEQARVYDSMGQSTGIAWR |
⦗Top⦘ |