| Basic Information | |
|---|---|
| Family ID | F034322 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKQPLSAEVQDVTGI |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.43 % |
| % of genes near scaffold ends (potentially truncated) | 99.43 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF00781 | DAGK_cat | 1.71 |
| PF13620 | CarboxypepD_reg | 1.71 |
| PF00535 | Glycos_transf_2 | 0.57 |
| PF08448 | PAS_4 | 0.57 |
| PF00239 | Resolvase | 0.57 |
| PF00293 | NUDIX | 0.57 |
| PF00589 | Phage_integrase | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 3.43 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.57 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105086827 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300000955|JGI1027J12803_102846466 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300001131|JGI12631J13338_1021493 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300001686|C688J18823_10126767 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300001867|JGI12627J18819_10300487 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300003219|JGI26341J46601_10051216 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300004080|Ga0062385_10058813 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300004080|Ga0062385_10084626 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300004152|Ga0062386_100885933 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300004799|Ga0058863_10908171 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300005167|Ga0066672_10747236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300005180|Ga0066685_10003675 | All Organisms → cellular organisms → Bacteria | 7519 | Open in IMG/M |
| 3300005181|Ga0066678_10188313 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300005332|Ga0066388_102272031 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300005332|Ga0066388_102350764 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300005434|Ga0070709_10634903 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300005437|Ga0070710_10371459 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005533|Ga0070734_10223446 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300005552|Ga0066701_10208871 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300005557|Ga0066704_10039146 | All Organisms → cellular organisms → Bacteria | 2943 | Open in IMG/M |
| 3300005559|Ga0066700_10843434 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005569|Ga0066705_10612662 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005575|Ga0066702_10233043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300005591|Ga0070761_10107258 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300005602|Ga0070762_10309812 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300006086|Ga0075019_10158297 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300006172|Ga0075018_10649986 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006173|Ga0070716_100419752 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300006176|Ga0070765_102266505 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006755|Ga0079222_10995799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300006796|Ga0066665_10415895 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300006796|Ga0066665_11469318 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006800|Ga0066660_10916890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300009038|Ga0099829_11754589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300009089|Ga0099828_10449898 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300009090|Ga0099827_10730537 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300009792|Ga0126374_11487439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300010046|Ga0126384_10247204 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300010048|Ga0126373_10139383 | All Organisms → cellular organisms → Bacteria | 2292 | Open in IMG/M |
| 3300010048|Ga0126373_11729433 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010323|Ga0134086_10390245 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010358|Ga0126370_11320763 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300010359|Ga0126376_11375926 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300010360|Ga0126372_12111448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300010360|Ga0126372_12360196 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010361|Ga0126378_12613150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300010366|Ga0126379_11080031 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010366|Ga0126379_12158041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300010376|Ga0126381_102379183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300010376|Ga0126381_104836683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010396|Ga0134126_10197633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2407 | Open in IMG/M |
| 3300010398|Ga0126383_10584035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300011120|Ga0150983_13049586 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300011120|Ga0150983_13107322 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300011120|Ga0150983_16077089 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300011269|Ga0137392_11055825 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300011270|Ga0137391_10476768 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300011270|Ga0137391_10625121 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300011270|Ga0137391_11057875 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300011271|Ga0137393_10215793 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300012189|Ga0137388_11447711 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300012202|Ga0137363_11725152 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012203|Ga0137399_10480804 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300012203|Ga0137399_10507649 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300012203|Ga0137399_10909347 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012206|Ga0137380_10947930 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012212|Ga0150985_119489134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300012349|Ga0137387_11047828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300012361|Ga0137360_10095022 | All Organisms → cellular organisms → Bacteria | 2267 | Open in IMG/M |
| 3300012361|Ga0137360_10701070 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300012385|Ga0134023_1226455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012582|Ga0137358_10352130 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300012683|Ga0137398_10934938 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012918|Ga0137396_10132259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1806 | Open in IMG/M |
| 3300012918|Ga0137396_10738310 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012922|Ga0137394_10550940 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300012925|Ga0137419_10721917 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300012957|Ga0164303_10230975 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300016294|Ga0182041_10215825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1538 | Open in IMG/M |
| 3300016319|Ga0182033_11434464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300016445|Ga0182038_11736226 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300018433|Ga0066667_10339479 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300019789|Ga0137408_1034696 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300019877|Ga0193722_1146984 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300020170|Ga0179594_10051663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
| 3300020170|Ga0179594_10090878 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300020199|Ga0179592_10001904 | All Organisms → cellular organisms → Bacteria | 8557 | Open in IMG/M |
| 3300020579|Ga0210407_10973062 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300020579|Ga0210407_11284043 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300020580|Ga0210403_10459270 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300020580|Ga0210403_10780769 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300020581|Ga0210399_10401413 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300020582|Ga0210395_10337776 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300020583|Ga0210401_10233644 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300020583|Ga0210401_10948826 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300021046|Ga0215015_10639827 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300021168|Ga0210406_11358018 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300021170|Ga0210400_10647669 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300021171|Ga0210405_10434420 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300021181|Ga0210388_10439281 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300021402|Ga0210385_10836589 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300021403|Ga0210397_10271673 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300021405|Ga0210387_10150350 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300021405|Ga0210387_11396477 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300021406|Ga0210386_10233798 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300021432|Ga0210384_10231256 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300021433|Ga0210391_10494672 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300021475|Ga0210392_10072272 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300021475|Ga0210392_11438580 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021477|Ga0210398_10337157 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300021479|Ga0210410_10004382 | All Organisms → cellular organisms → Bacteria | 12382 | Open in IMG/M |
| 3300021560|Ga0126371_13684762 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300022507|Ga0222729_1023705 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300022508|Ga0222728_1093037 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300022533|Ga0242662_10283147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300022721|Ga0242666_1135093 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300022724|Ga0242665_10107489 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300024186|Ga0247688_1015892 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300026277|Ga0209350_1155846 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026490|Ga0257153_1075926 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300026494|Ga0257159_1028102 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300026551|Ga0209648_10186551 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300026557|Ga0179587_10592033 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300027297|Ga0208241_1006896 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300027528|Ga0208985_1042867 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300027605|Ga0209329_1018466 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300027605|Ga0209329_1037092 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300027698|Ga0209446_1100784 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027737|Ga0209038_10041936 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300027765|Ga0209073_10510067 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027787|Ga0209074_10471167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300027795|Ga0209139_10000361 | All Organisms → cellular organisms → Bacteria | 15433 | Open in IMG/M |
| 3300027829|Ga0209773_10315713 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300027862|Ga0209701_10106126 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300027875|Ga0209283_10406807 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300027875|Ga0209283_10913819 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027889|Ga0209380_10199282 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300027889|Ga0209380_10446732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300027895|Ga0209624_10473121 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300027908|Ga0209006_10175686 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300027910|Ga0209583_10153269 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300028047|Ga0209526_10543346 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300028906|Ga0308309_11068850 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300030503|Ga0311370_10161121 | All Organisms → cellular organisms → Bacteria | 3076 | Open in IMG/M |
| 3300030730|Ga0307482_1179482 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300030743|Ga0265461_13221515 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030800|Ga0074032_10846939 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300030842|Ga0075404_11160632 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300030885|Ga0265743_101007 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300031022|Ga0138301_1038561 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300031057|Ga0170834_112997233 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300031122|Ga0170822_11753989 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031231|Ga0170824_106039623 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300031231|Ga0170824_111487589 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031231|Ga0170824_116025335 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031231|Ga0170824_128285612 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031590|Ga0307483_1015126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300031720|Ga0307469_10452288 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300031720|Ga0307469_11416552 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031753|Ga0307477_10513582 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300031754|Ga0307475_10907960 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300031769|Ga0318526_10376046 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031823|Ga0307478_10125452 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300031823|Ga0307478_11460916 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300031823|Ga0307478_11650578 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031945|Ga0310913_10304085 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300031954|Ga0306926_12011459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300031962|Ga0307479_10023063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5891 | Open in IMG/M |
| 3300031962|Ga0307479_10440662 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300032035|Ga0310911_10712359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300032043|Ga0318556_10752161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300032121|Ga0316040_117260 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300032770|Ga0335085_11424481 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300032782|Ga0335082_11574464 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300033475|Ga0310811_11245419 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.29% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.43% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.29% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.57% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030800 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1050868271 | 3300000364 | Soil | MMAGFILACSIVFLLQFFISYCRSLIAASVREPLSQ |
| JGI1027J12803_1028464661 | 3300000955 | Soil | MMAALILVFSLVVMLQFFISYCRSLIAASAKEPLPQEVQEV |
| JGI12631J13338_10214932 | 3300001131 | Forest Soil | MIAAIILGCSIIFFLQFFVPYCRSLITASSNHVLSPEVQDVTGLTTPASGEDF |
| C688J18823_101267674 | 3300001686 | Soil | MMAAFFLACSLVFLLQFFVWYCRSLISASVSHPLSVEVRDV |
| JGI12627J18819_103004871 | 3300001867 | Forest Soil | MMAAVILVCSLVLMLQFFISYCRSLIAASAKEPLPLEVQEVTGISR |
| JGI26341J46601_100512163 | 3300003219 | Bog Forest Soil | MMAGIILVCSVTFLLQFFVSYCRSLIAASAKEPLSLEVQDVTGITKTA |
| Ga0062385_100588131 | 3300004080 | Bog Forest Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIKNA |
| Ga0062385_100846264 | 3300004080 | Bog Forest Soil | MMPAFIFICSVTLLLQFFVSYCRSLIAASARQPLSREVQDVTGIQKA |
| Ga0062386_1008859331 | 3300004152 | Bog Forest Soil | MMAAAILLFSLAALLQFFASYCRSLIAASSKQALSPEVKDVTGFTKGACGDDFA |
| Ga0058863_109081713 | 3300004799 | Host-Associated | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKQPLSAEVQDVTGIK |
| Ga0066672_107472362 | 3300005167 | Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSSKQPLSPEVQDVTGIQ |
| Ga0066685_1000367510 | 3300005180 | Soil | MMAAIILACSVVLLLQFFVSYCRSLIAVSSKQVLSPEVKDVTGIQRLASG |
| Ga0066678_101883131 | 3300005181 | Soil | MMAVFILACSIIFLLQFFISYCRSLIASSVREPISQEVQE |
| Ga0066388_1022720313 | 3300005332 | Tropical Forest Soil | MMASIIFVCSLVFLLQFFVSYCRSLIAASAKQALSPEVQDVTG |
| Ga0066388_1023507641 | 3300005332 | Tropical Forest Soil | MMAAFIFVVSAVIFLQFFVFYCRSLIAVSSKQALSPEVQDVTGIQRTAS |
| Ga0070709_106349032 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAAVIFVFSVAALMQFFVSYCRSLIAASARRALSSDVQDVIGIR |
| Ga0070710_103714591 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAAIILVCSLILMLQFFVSYCRSLIAACATEQLPLEVQEVTGIS |
| Ga0070734_102234461 | 3300005533 | Surface Soil | MIAALVLACSILFFLQFFVPYCRSLIAASSSHVLSPEVQDVTGLTS |
| Ga0066701_102088713 | 3300005552 | Soil | MMAVFILACSIIFLLQFFISYCRSLIASSVREPISQEVQEV |
| Ga0066704_100391466 | 3300005557 | Soil | MMAGIILACSIVLLLQFFVSYCRSLIAVSSKQVLSPEVKDVTGIQRTASG |
| Ga0066700_108434342 | 3300005559 | Soil | MMAVVILVCSLILMLQFFVSYCRSLIAASAKEPLPLEVQEVTGISRS |
| Ga0066705_106126622 | 3300005569 | Soil | MMAAVILVCSLVLMLQFFVSYCRSLIAASAKEQLPLEVQE |
| Ga0066702_102330433 | 3300005575 | Soil | MMAAIILVCSAVFFLQFFVWYCRSIIAVSAKQPLSPEVQDV |
| Ga0070761_101072583 | 3300005591 | Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTG |
| Ga0070762_103098121 | 3300005602 | Soil | MMAAIILVCSVVFLLQFFVSYSRSLIAASIKHPLSAEVQDVTGIKT |
| Ga0075019_101582973 | 3300006086 | Watersheds | MTATIILVCSVVILAQFFVSYCRSLLASSAKKSLSPEVQEV |
| Ga0075018_106499861 | 3300006172 | Watersheds | MIAALFLVASIVLLLQFFVSYCRSLIAASVKHELSAEVRDVTGLSASTS |
| Ga0070716_1004197523 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAAFFLACSLVFLLQFFVWYCRSLISASVNHPLS |
| Ga0070765_1022665051 | 3300006176 | Soil | MMAAFIFACSVVLLLQFFISYCRSLIAASARQSLSREV |
| Ga0079222_109957992 | 3300006755 | Agricultural Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSAKQALSPEVQEVTGIQ |
| Ga0066665_104158951 | 3300006796 | Soil | MMAGVIFVFSAAALLQFFISYCRSLIAASSKQVLSAEVKDVTGILRTASGDDFK |
| Ga0066665_114693181 | 3300006796 | Soil | MMAVVILVCSLILMLQFFVSYCRSLIAASAKEPLPLEVQEVTGISR |
| Ga0066660_109168902 | 3300006800 | Soil | MMAAFIFLVSAVIFLQFFVFYCRSLIAVSSKQPLSPEV |
| Ga0099829_117545891 | 3300009038 | Vadose Zone Soil | MMAAFILVCSIVTLLQFFVWYCRSLIAASAKQALSPEVRDVTGIARAASG |
| Ga0099828_104498983 | 3300009089 | Vadose Zone Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSCKQALSPEVQDVTGIQR |
| Ga0099827_107305371 | 3300009090 | Vadose Zone Soil | MMAVVILVCSLILMLQFFVSYCRSLIAASAKEPLPLEV |
| Ga0126374_114874391 | 3300009792 | Tropical Forest Soil | MMAAFILVVSLVIFLQFFVFYCRSLIAVSSKQALSPEVQDVTGIQRTASGEDFNR |
| Ga0126384_102472041 | 3300010046 | Tropical Forest Soil | MIAALILACSIVFLLQFFVSYCRSLIAASARHALSPEAQDV |
| Ga0126373_101393834 | 3300010048 | Tropical Forest Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSSKQVLSPEVQEV |
| Ga0126373_117294331 | 3300010048 | Tropical Forest Soil | MIAGIIFACSVVFLLQFFVSYCRSLIAASSKQVLSPEVRDVTGI |
| Ga0134086_103902451 | 3300010323 | Grasslands Soil | MMAVVILVCSLILMLQFFVSYCRSLIAASAKEPLPLEVQE |
| Ga0126370_113207632 | 3300010358 | Tropical Forest Soil | MIAGIIFACSVVFLLQFFVSYCRSLIAASSKQVLSPEVRDVTGIAASASG |
| Ga0126376_113759262 | 3300010359 | Tropical Forest Soil | MMAAFIFVVSAVIFLQFFVFYCRSLIAVSSKQALSPEVQDVTGIQRTASGEDFT* |
| Ga0126372_121114481 | 3300010360 | Tropical Forest Soil | MMAAFILVVSAVIFLQFFVFYCRSLIAVSSKQALSPEV |
| Ga0126372_123601961 | 3300010360 | Tropical Forest Soil | MIAALIFACSIVFLLQFFVSYCRSLIAASAKHALS |
| Ga0126378_126131501 | 3300010361 | Tropical Forest Soil | MMAAFIFVVSIVIFLQFFVFYCRSLIAVSSKQVLSPEVQEV |
| Ga0126379_110800311 | 3300010366 | Tropical Forest Soil | MMAAFILVVSLVIFLQFFVFYCRSLIAVSSKQALS |
| Ga0126379_121580412 | 3300010366 | Tropical Forest Soil | MMAAFIFVVSVIIFLQFFVFYCRSLIAVSVKQPLSPEVQEVTGIQRAASGDDF |
| Ga0126381_1023791832 | 3300010376 | Tropical Forest Soil | MMAAFIFVVSMVIFLQFFVFYCRSLIAVSAKQALSPEVQEV |
| Ga0126381_1048366832 | 3300010376 | Tropical Forest Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSSKQALSPEVQEVTGIQK |
| Ga0134126_101976331 | 3300010396 | Terrestrial Soil | MMAAIILVFSVVFLLQFFVSYCRSVIAASVKHPLSAE |
| Ga0126383_105840353 | 3300010398 | Tropical Forest Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSSKQALSPEVQEVTGI |
| Ga0150983_130495862 | 3300011120 | Forest Soil | HGGVAMIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPEVRDVTGISTRPRVTILPA |
| Ga0150983_131073221 | 3300011120 | Forest Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIRNAAT |
| Ga0150983_160770893 | 3300011120 | Forest Soil | MMAAIILVCSVVFLLQFFVSYSRSLIAASIKHPLSAEVQDVT |
| Ga0137392_110558252 | 3300011269 | Vadose Zone Soil | MMAGIILVCSVVLFLQFFVFYCRSLIAASAKQALSPEVKDVTGIQRAA |
| Ga0137391_104767683 | 3300011270 | Vadose Zone Soil | MMAAIILVCSAVLFLQFFVFYCRSLIAVSSKQVLSPEVQDVTGISR |
| Ga0137391_106251211 | 3300011270 | Vadose Zone Soil | MMAAIIFVCSVILLLQFFVSYCRSLIAASSNQALSP |
| Ga0137391_110578752 | 3300011270 | Vadose Zone Soil | MMAGIILACSVVLLLQFFVSYCRSLIAVSSKQVLSAEVKDV |
| Ga0137393_102157934 | 3300011271 | Vadose Zone Soil | MMAGIILACSVVLLLQFFVSYCRSLIAVSSKQVLSAEVKDVTGIQRLASG |
| Ga0137388_114477111 | 3300012189 | Vadose Zone Soil | MMPAIILVVSLAALLQFFVSYCRSLIAATVKQPLSPEVQDV |
| Ga0137363_117251522 | 3300012202 | Vadose Zone Soil | MMAAFIFVCSVVTLLQFFVWYCRSLIAASAKEALSPEVRDVTGI |
| Ga0137399_104808043 | 3300012203 | Vadose Zone Soil | MMAGIILACSVVLLLQFFVSYCRSLIAVSSKQVLSAEVKDVTGIQR |
| Ga0137399_105076491 | 3300012203 | Vadose Zone Soil | MMAGIILACSVVLLLQFFVSYCRSLIAASSRRTLSPEVQDVTGIQRTASGEDYKRVM |
| Ga0137399_109093472 | 3300012203 | Vadose Zone Soil | MMAAFILVCSVVTLLQFFVWYCRSLIAASAKEALSPEVRDVTGI |
| Ga0137380_109479302 | 3300012206 | Vadose Zone Soil | MMAAIIFVCSAVLFLQFFVFYCRSLIAVSSKQVLSPEVQDVTGISR |
| Ga0150985_1194891341 | 3300012212 | Avena Fatua Rhizosphere | MMAAFFLACSLVFLLQFFVWYCRSLISASVSHPLSV |
| Ga0137387_110478281 | 3300012349 | Vadose Zone Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSSKQPLSPEVQDVTGIQRAA |
| Ga0137360_100950221 | 3300012361 | Vadose Zone Soil | MMAAIILVCSAAFFLQFFVPYCRSLIASSAEHMLSAEVQDVTGIRTQAAGDDFAR |
| Ga0137360_107010701 | 3300012361 | Vadose Zone Soil | MMAVVILVCSLILMLQFFVSYCRSLIAASAREPLPLEVQEVTGISRS |
| Ga0134023_12264551 | 3300012385 | Grasslands Soil | MMAAFIFVVSLVIFLQFFVFYCRSLIAVSSKQALSPEVQEVT |
| Ga0137358_103521301 | 3300012582 | Vadose Zone Soil | MMAVVILVCSLILMLQFFVSYCRSLIAASAKEPLPREVQEVMGISRSPSADDFSR |
| Ga0137398_109349381 | 3300012683 | Vadose Zone Soil | LFISLTILLQFFVSYCRSLIAASTREALSQEVQEVTGISRT |
| Ga0137396_101322594 | 3300012918 | Vadose Zone Soil | MMAGIILACSVVLLLQFFVSYCRSLIAASSRRTLSPEVQDVT |
| Ga0137396_107383101 | 3300012918 | Vadose Zone Soil | MMPAIILVVSLAALLQFFVSYCRSIIAASVKHPLSPEVR |
| Ga0137394_105509403 | 3300012922 | Vadose Zone Soil | MMAAFILVCSVVTLLQFFVWYCRSLIAASAKEALSPEVRDVTGIA |
| Ga0137419_107219172 | 3300012925 | Vadose Zone Soil | MMAAVILVCSVVLMLQFFISYCRSLIAACAKEPLPIEVQEVTG |
| Ga0164303_102309753 | 3300012957 | Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVT |
| Ga0182041_102158251 | 3300016294 | Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSAKQPLSPEVQEVTG |
| Ga0182033_114344642 | 3300016319 | Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSAKQPLSPEVQEVTGIQRA |
| Ga0182038_117362262 | 3300016445 | Soil | MIAGIIFACSLVFLLQFFVSYCRSLIAASSKQVLSAEVRDVTGIATAASGD |
| Ga0066667_103394791 | 3300018433 | Grasslands Soil | MMAVVILVCSLILMLQFFVSYCRSLIAASAKEPLPLEVQEVTGIS |
| Ga0137408_10346961 | 3300019789 | Vadose Zone Soil | MMAGIILACSIVLLLQFFVSYCRSLIAVSSKQVLSPEVKDVTGIQR |
| Ga0193722_11469842 | 3300019877 | Soil | MMAAVILICSVVLMLQFFISYCRSLIAACAKEPLPIEVQEVTGIVRTA |
| Ga0179594_100516633 | 3300020170 | Vadose Zone Soil | MMAAFIFVCSIVTLLQFFVWYCRSLIAASAKEALSPEVRDVTGIARAASGEDFTR |
| Ga0179594_100908781 | 3300020170 | Vadose Zone Soil | MMAAFILVCSVVTLLQFFVWYCRSLIAASAKEALSPE |
| Ga0179592_1000190412 | 3300020199 | Vadose Zone Soil | MMAGIILACSVVLLLQFFVSYCRSLIAVSSKQVLSAEVKDVTGIQRL |
| Ga0210407_109730621 | 3300020579 | Soil | MMAGFILVCSVVLLLQFFVSYCRSLIAASAKQSLSPEVRDVAGI |
| Ga0210407_112840431 | 3300020579 | Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPEVQDVTGIRTQAA |
| Ga0210403_104592703 | 3300020580 | Soil | MMAAIILVCSLVFLLQFFVSYCRSLIAASIKHPLSAEVQDV |
| Ga0210403_107807692 | 3300020580 | Soil | MMAAGILLLSLAALLQFFTSYCRSLIAASSKQPLSPEVKDVTGLVKGASGED |
| Ga0210399_104014131 | 3300020581 | Soil | MMATGILLFSLAALLQFFSSYCRSLIAASSKQPLSPEVKDVTGLTKGASGDDFA |
| Ga0210395_103377762 | 3300020582 | Soil | MIAAIVLCCSIVFFLQFFVPYCRSLIAASSNHVLSP |
| Ga0210401_102336441 | 3300020583 | Soil | MMAAIILVCSVVFLLQFFVSYSRSLIAASIKHPLSAE |
| Ga0210401_109488261 | 3300020583 | Soil | MMAAFILVCSVVLLLQFFVSYCRSLIAASAKQMLSPEVQ |
| Ga0215015_106398273 | 3300021046 | Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSCKQGLSPEVQ |
| Ga0210406_113580181 | 3300021168 | Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPEVRDVTGISTLAVGEDFPRV |
| Ga0210400_106476691 | 3300021170 | Soil | MIAGIILVCSIVFLLQFFVSYCRSLIAASSKQALSP |
| Ga0210405_104344201 | 3300021171 | Soil | MMAAIILVCSIVFLLQFFVSYCRSLIAASIKHPLS |
| Ga0210388_104392811 | 3300021181 | Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPE |
| Ga0210385_108365891 | 3300021402 | Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPEVRDVTGISTQAAGDD |
| Ga0210397_102716731 | 3300021403 | Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPEVRDVTGISTQA |
| Ga0210387_101503505 | 3300021405 | Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPEVRDVTGISTQAAGDDF |
| Ga0210387_113964772 | 3300021405 | Soil | MMPAFIFVCSVTLLLQFFVSYCRSIIAASARQPLSREVQDVTGIQKAASGE |
| Ga0210386_102337983 | 3300021406 | Soil | MIAAIVLCCSIVFFLQFFVPYCRSLIAASSNHVLSPEVQDVTGLTTPASGED |
| Ga0210384_102312561 | 3300021432 | Soil | MIAGIILACSVVFLLQFFVSYCRSLIAASSKQALSPEVRDVTGIASSAT |
| Ga0210391_104946721 | 3300021433 | Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHVLSPEVRDVTGIST |
| Ga0210392_100722721 | 3300021475 | Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDV |
| Ga0210392_114385802 | 3300021475 | Soil | MIAALILGCSLIFFLQFFVPYCRSLIAASTNHVLSPEVQD |
| Ga0210398_103371571 | 3300021477 | Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQ |
| Ga0210410_100043821 | 3300021479 | Soil | MMAFGILLLSLAALLQFFSSYCRSLIAASSKQPLSPEVKDVTGLTKGASGDDFAR |
| Ga0126371_136847622 | 3300021560 | Tropical Forest Soil | MIAALVLGCSIVFFLQFFVPYCRSVIAASSNHVLSPEVQDVT |
| Ga0222729_10237052 | 3300022507 | Soil | MMAGFILVCSVVLLLQFFVSYCRSLIAASAKQSLSPEVRDV |
| Ga0222728_10930372 | 3300022508 | Soil | MIAAIILVCSIVFLLQFFVSYCRSLIAASSKQALSPEVRDV |
| Ga0242662_102831471 | 3300022533 | Soil | MMAAIILAISVATLLQFFVSYCRSLIAASAKHALSAEVQ |
| Ga0242666_11350931 | 3300022721 | Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIKSSAT |
| Ga0242665_101074891 | 3300022724 | Soil | MMAAIILVCSIVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIKNSATGD |
| Ga0247688_10158923 | 3300024186 | Soil | MMAAFILACSIIFLLQFFISYCRSLIASSVREPIS |
| Ga0209350_11558462 | 3300026277 | Grasslands Soil | MMAVFILACSIIFLLQFFISYCRSLIASSVREPISQE |
| Ga0257153_10759262 | 3300026490 | Soil | MMAAVILVCSVVLMLQFFISYCRSLIAACAKEALPIEVQEVTGIVRTA |
| Ga0257159_10281022 | 3300026494 | Soil | MMAAIIFVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIR |
| Ga0209648_101865514 | 3300026551 | Grasslands Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSCKQALSPEVQDVTGIQKAAS |
| Ga0179587_105920331 | 3300026557 | Vadose Zone Soil | MMAAFILVCSVVTLLQFFVWYCRSLIAASAKEALSPEVRDVTGIARAASGED |
| Ga0208241_10068961 | 3300027297 | Forest Soil | MMAGIILVCSVVLFLQFFVFYCRSLIAVSSKQALSPE |
| Ga0208985_10428671 | 3300027528 | Forest Soil | MMAAIILVCSLAFFLQFFVPYCRSVIASSAGHVLSPEVRDV |
| Ga0209329_10184663 | 3300027605 | Forest Soil | MMAALIFIFSFAALMQFFVSYCRSLIAASARRALSADVQD |
| Ga0209329_10370923 | 3300027605 | Forest Soil | MMAAIILVCSVAFFLQFFVPYCRSLIASSASHVLSPEVRDVT |
| Ga0209446_11007842 | 3300027698 | Bog Forest Soil | MMPAFIFVCSITLLLQFFVSYCRSLIAASARQPLSREV |
| Ga0209038_100419361 | 3300027737 | Bog Forest Soil | MMAVGILLLSLAALLQFFASYCRSLIAASSKQALSPEVKDVTGLTKGASGEDFARV |
| Ga0209073_105100672 | 3300027765 | Agricultural Soil | MMAAIIFVVSVVIFLQFFVFYCRSLIAVSSKQALSPEVQEVTGIQKT |
| Ga0209074_104711671 | 3300027787 | Agricultural Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSAKQALSPEVQE |
| Ga0209139_100003611 | 3300027795 | Bog Forest Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGITNSATGDDF |
| Ga0209773_103157132 | 3300027829 | Bog Forest Soil | MMAALILSCSVVFLLQFFVSYCRSLIAASAKQALSPEVQDVT |
| Ga0209701_101061261 | 3300027862 | Vadose Zone Soil | MMPAIILVVSLAALLQFFVSYCRSLIAATVKQPLSPEVQ |
| Ga0209283_104068071 | 3300027875 | Vadose Zone Soil | MMAAVILICSVVLMLQFFISYCRSLIAACAKEPLPIEVQEV |
| Ga0209283_109138192 | 3300027875 | Vadose Zone Soil | MMAAIILVCSAVLFLQFFVFYCRSLIAVSSKQVLSPGAG |
| Ga0209380_101992821 | 3300027889 | Soil | MIAAIILVCSVAFFLQFFVPYCRSVIASSAGHVLSEEVQDVTGISKQ |
| Ga0209380_104467321 | 3300027889 | Soil | MMATIIFVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIKNS |
| Ga0209624_104731211 | 3300027895 | Forest Soil | MIAAIVLGCSIIFFLQFFVPYCRSLIAASSNHVLSPEVQDVTGLTSPAS |
| Ga0209006_101756861 | 3300027908 | Forest Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGI |
| Ga0209583_101532691 | 3300027910 | Watersheds | MMAAFILVCSIVTLLQFFVWYCRSLIAASAKEALSPEV |
| Ga0209526_105433461 | 3300028047 | Forest Soil | MMAAIIFVFSVAALMQFFVSYCRSLIAASARKALSSDVQDVI |
| Ga0308309_110688501 | 3300028906 | Soil | MIASIILVCSVVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIKSSATGEDF |
| Ga0311370_101611211 | 3300030503 | Palsa | MMAGIIFVCSVVFLLQFFVSYCRSLIAASAKQTLSLEV |
| Ga0307482_11794822 | 3300030730 | Hardwood Forest Soil | MMAGIILACSVVLLLQFFVSYCRSLIAASSRQTLSPEVQDVTGIQRTASGEDYT |
| Ga0265461_132215151 | 3300030743 | Soil | MMAAIILVCSIVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIKNSATG |
| Ga0074032_108469391 | 3300030800 | Soil | MAAIILVCSVVFLLQFFVSYSRSLIAASIKHPLSAEVQ |
| Ga0075404_111606321 | 3300030842 | Soil | MMAAVILVCSVVLMLQFFISYCRSLIAACAREPLPIEVQEVTGIVRTASAEDFSRV |
| Ga0265743_1010071 | 3300030885 | Soil | MMAAIILVCSIVFLLQFFVSYCRSLIAASIKHPLSAEVQDV |
| Ga0138301_10385611 | 3300031022 | Soil | MMAAIIFIFSVAALMQFFVSYCRSLIAASARKALSSDVQDVIGIRRSANS |
| Ga0170834_1129972332 | 3300031057 | Forest Soil | MIAAIVMCCSIVFFLQFFVPYCRSVIAASIGHVLSPEVQDVTGLT |
| Ga0170822_117539891 | 3300031122 | Forest Soil | MMAAVILVCSLVLMLQFFISYCRSLIAASAKEPLPIEVQEVTGISR |
| Ga0170824_1060396233 | 3300031231 | Forest Soil | MMAAVILVCSLVLMLQFFISYCRSLIAASAKEPLPIEVQEVTGISRTASPE |
| Ga0170824_1114875892 | 3300031231 | Forest Soil | MMAAIILVCSLVFLLQFFVSYCRSLIAASAKHPLSAEVQDV |
| Ga0170824_1160253352 | 3300031231 | Forest Soil | MMAAVILVCSLVLMLQFFVSYCRSLIAASAKEPLPLEVQEVTGISRTASPE |
| Ga0170824_1282856122 | 3300031231 | Forest Soil | MIAAIVLCCSIVFFLQFFVPYCRSVIAASIGHVLSPEVQDVT |
| Ga0307483_10151262 | 3300031590 | Hardwood Forest Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSAKQPLSPEVQEVTGIQRAAS |
| Ga0307469_104522881 | 3300031720 | Hardwood Forest Soil | MMAAFILICSVVTLLQFFVWYCRSLIAASAKEALSPEVRDF |
| Ga0307469_114165522 | 3300031720 | Hardwood Forest Soil | MMAAIILVCSVVLFLQFFVFYCRSLIAASSRQALSAEVKDVTGIQRTARGE |
| Ga0307477_105135822 | 3300031753 | Hardwood Forest Soil | MMAVFILVLSVAALLQFFVSYCRSLLAASMRHVLSAEVQD |
| Ga0307475_109079602 | 3300031754 | Hardwood Forest Soil | MMAAIIFIFSVAALMQFFVSYCRSLIAASARKALSSDVQDVIGIRRS |
| Ga0318526_103760461 | 3300031769 | Soil | MIATIILACSLVFLLQFFVSYCRSLIAASVKQTLSAEVQDVTGIS |
| Ga0307478_101254521 | 3300031823 | Hardwood Forest Soil | MMAGIILVCSVVLFLQFFVFYCRSLIAVSSKQALSPEVKDVT |
| Ga0307478_114609162 | 3300031823 | Hardwood Forest Soil | MMAAVILVCSLVLMLQFFISYCRSLIAATAKEPLPIEVQEVTGISRTASPDDFSRV |
| Ga0307478_116505782 | 3300031823 | Hardwood Forest Soil | MIAAIILVCSVAFFLQFFVPYCRSLIASSAAHILSPEVQDVTGIGTQPAGDD |
| Ga0310913_103040851 | 3300031945 | Soil | MMAAVILVCSLILMLQFFVSYCRSLIGASSKEQLPLEVQEVTGISRAASP |
| Ga0306926_120114591 | 3300031954 | Soil | MMAAFIFVVSMVIFLQFFVFYCRSLIAVSSKQALSPEVQEVTGIQRTAS |
| Ga0307479_100230631 | 3300031962 | Hardwood Forest Soil | MMAAIILVCSVAFFLQFFVPYCRSLIASTASHVLS |
| Ga0307479_104406621 | 3300031962 | Hardwood Forest Soil | MMAAVILLCSLVLMLQFFISYCRSLIAATAKEPLPIEVQEVTGI |
| Ga0310911_107123591 | 3300032035 | Soil | MMAAFIFVVSMVIFLQFFVFYCRSLIAVSSKQALSPEVQEVTGIQRTASGEDFN |
| Ga0318556_107521612 | 3300032043 | Soil | MMAAFIFVVSVVIFLQFFVFYCRSLIAVSAKQPLSPEVQEVTGIQ |
| Ga0316040_1172602 | 3300032121 | Soil | MMAAIILVCSIVFLLQFFVSYCRSLIAASIKHPLSAEVQDVTGIKNSATGDDFA |
| Ga0335085_114244812 | 3300032770 | Soil | MMAAIILTCSVIFLTQFFVSYCRSLIAASAKETLSEEVQEVTGISRNPSADDF |
| Ga0335082_115744641 | 3300032782 | Soil | MMAAIILTCSVIFLTQFFVSYCRSLIAASAKETLSEE |
| Ga0310811_112454191 | 3300033475 | Soil | MMAAIILVCSVVFLLQFFVSYCRSLIAASIKQPLSAEVQDVTGI |
| ⦗Top⦘ |