| Basic Information | |
|---|---|
| Family ID | F034319 |
| Family Type | Metagenome |
| Number of Sequences | 175 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EIARLDLLVKKLQTELQIERQYNQALETQIRTLTYVE |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.87 % |
| % of genes near scaffold ends (potentially truncated) | 92.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.29 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF01425 | Amidase | 9.71 |
| PF01850 | PIN | 4.57 |
| PF03551 | PadR | 2.86 |
| PF01649 | Ribosomal_S20p | 2.29 |
| PF13649 | Methyltransf_25 | 1.71 |
| PF07366 | SnoaL | 1.14 |
| PF00753 | Lactamase_B | 1.14 |
| PF14235 | DUF4337 | 1.14 |
| PF14559 | TPR_19 | 1.14 |
| PF11412 | DsbC | 1.14 |
| PF13489 | Methyltransf_23 | 1.14 |
| PF02604 | PhdYeFM_antitox | 1.14 |
| PF00072 | Response_reg | 1.14 |
| PF07081 | DUF1349 | 0.57 |
| PF10604 | Polyketide_cyc2 | 0.57 |
| PF07927 | HicA_toxin | 0.57 |
| PF00202 | Aminotran_3 | 0.57 |
| PF04239 | DUF421 | 0.57 |
| PF08241 | Methyltransf_11 | 0.57 |
| PF02687 | FtsX | 0.57 |
| PF12704 | MacB_PCD | 0.57 |
| PF14534 | DUF4440 | 0.57 |
| PF04298 | Zn_peptidase_2 | 0.57 |
| PF03069 | FmdA_AmdA | 0.57 |
| PF04264 | YceI | 0.57 |
| PF01740 | STAS | 0.57 |
| PF12895 | ANAPC3 | 0.57 |
| PF07238 | PilZ | 0.57 |
| PF13620 | CarboxypepD_reg | 0.57 |
| PF11175 | DUF2961 | 0.57 |
| PF08379 | Bact_transglu_N | 0.57 |
| PF01593 | Amino_oxidase | 0.57 |
| PF06983 | 3-dmu-9_3-mt | 0.57 |
| PF07681 | DoxX | 0.57 |
| PF00578 | AhpC-TSA | 0.57 |
| PF13432 | TPR_16 | 0.57 |
| PF01882 | DUF58 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 9.71 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.86 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.86 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.86 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 2.29 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.14 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.14 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.57 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.57 |
| COG3506 | Regulation of enolase protein 1 (function unknown), concanavalin A-like superfamily | Function unknown [S] | 0.57 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.57 |
| COG2738 | Zn-dependent membrane protease YugP | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.57 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.57 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 0.57 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.57 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.57 |
| COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.57 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.00 % |
| Unclassified | root | N/A | 12.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100457669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300003219|JGI26341J46601_10132831 | Not Available | 704 | Open in IMG/M |
| 3300004092|Ga0062389_104444084 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005184|Ga0066671_10770905 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005454|Ga0066687_10007720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3982 | Open in IMG/M |
| 3300005531|Ga0070738_10373690 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 570 | Open in IMG/M |
| 3300005542|Ga0070732_10465714 | Not Available | 765 | Open in IMG/M |
| 3300005552|Ga0066701_10887003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300005556|Ga0066707_10667712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005561|Ga0066699_10209659 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300005568|Ga0066703_10580611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005575|Ga0066702_10337527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 917 | Open in IMG/M |
| 3300005950|Ga0066787_10163045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300005993|Ga0080027_10339874 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300006052|Ga0075029_100055464 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2302 | Open in IMG/M |
| 3300006162|Ga0075030_100633435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300006162|Ga0075030_101294845 | Not Available | 572 | Open in IMG/M |
| 3300006173|Ga0070716_100013487 | All Organisms → cellular organisms → Bacteria | 4165 | Open in IMG/M |
| 3300006174|Ga0075014_100516419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300006174|Ga0075014_100702501 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300006176|Ga0070765_101127997 | Not Available | 741 | Open in IMG/M |
| 3300006176|Ga0070765_102003794 | Not Available | 542 | Open in IMG/M |
| 3300006642|Ga0075521_10648923 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006794|Ga0066658_10018706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2675 | Open in IMG/M |
| 3300006796|Ga0066665_10765395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300007255|Ga0099791_10473498 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300007788|Ga0099795_10226296 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009012|Ga0066710_104362478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300009038|Ga0099829_10260856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300009038|Ga0099829_11189647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300009089|Ga0099828_10268144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1533 | Open in IMG/M |
| 3300009089|Ga0099828_11981453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300009143|Ga0099792_10630080 | Not Available | 687 | Open in IMG/M |
| 3300009176|Ga0105242_10227844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1669 | Open in IMG/M |
| 3300009623|Ga0116133_1224543 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300009631|Ga0116115_1010263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae | 2894 | Open in IMG/M |
| 3300009635|Ga0116117_1056529 | Not Available | 966 | Open in IMG/M |
| 3300009792|Ga0126374_10973425 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300010046|Ga0126384_12154422 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010159|Ga0099796_10541838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010304|Ga0134088_10367708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300010329|Ga0134111_10255914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300010335|Ga0134063_10016291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3011 | Open in IMG/M |
| 3300010343|Ga0074044_10724781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300010359|Ga0126376_10323476 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300010361|Ga0126378_11150277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300010366|Ga0126379_12907079 | Not Available | 573 | Open in IMG/M |
| 3300010376|Ga0126381_100165702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2919 | Open in IMG/M |
| 3300010398|Ga0126383_10356647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300010937|Ga0137776_1121795 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 682 | Open in IMG/M |
| 3300011120|Ga0150983_12797118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1297 | Open in IMG/M |
| 3300012189|Ga0137388_10358474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
| 3300012189|Ga0137388_10721422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300012202|Ga0137363_10083812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2382 | Open in IMG/M |
| 3300012202|Ga0137363_10373429 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126 | 1184 | Open in IMG/M |
| 3300012202|Ga0137363_10565760 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300012202|Ga0137363_11168425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300012203|Ga0137399_11373574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012206|Ga0137380_10949597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300012207|Ga0137381_10525447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300012208|Ga0137376_11070188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300012209|Ga0137379_10675760 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300012210|Ga0137378_10814147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300012211|Ga0137377_11506216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300012349|Ga0137387_10096703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2052 | Open in IMG/M |
| 3300012357|Ga0137384_11595461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300012359|Ga0137385_11635160 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012362|Ga0137361_11959637 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012363|Ga0137390_11294150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012683|Ga0137398_10349585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300012917|Ga0137395_11097107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300012918|Ga0137396_10176048 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300012918|Ga0137396_10633083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300012923|Ga0137359_10210313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1737 | Open in IMG/M |
| 3300012924|Ga0137413_10297133 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300012925|Ga0137419_10149581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1684 | Open in IMG/M |
| 3300012927|Ga0137416_10886278 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012927|Ga0137416_11012822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012929|Ga0137404_10530264 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300012929|Ga0137404_11380855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300012930|Ga0137407_11008691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300012960|Ga0164301_11518075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300012971|Ga0126369_11594179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012976|Ga0134076_10632181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300012977|Ga0134087_10836425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300014150|Ga0134081_10301916 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300015241|Ga0137418_10132886 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300016270|Ga0182036_11565930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300017927|Ga0187824_10279729 | Not Available | 586 | Open in IMG/M |
| 3300017927|Ga0187824_10302217 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300017936|Ga0187821_10227453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300017972|Ga0187781_11468812 | Not Available | 505 | Open in IMG/M |
| 3300018012|Ga0187810_10299257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300018024|Ga0187881_10006493 | All Organisms → cellular organisms → Bacteria | 8472 | Open in IMG/M |
| 3300018086|Ga0187769_10933734 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300018468|Ga0066662_10951930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300020002|Ga0193730_1101475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300020170|Ga0179594_10021273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1973 | Open in IMG/M |
| 3300020579|Ga0210407_10001473 | All Organisms → cellular organisms → Bacteria | 21970 | Open in IMG/M |
| 3300020579|Ga0210407_10471125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300020579|Ga0210407_10609720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 850 | Open in IMG/M |
| 3300020580|Ga0210403_10168607 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1793 | Open in IMG/M |
| 3300020580|Ga0210403_11018208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300020581|Ga0210399_10429632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300020581|Ga0210399_11473464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300021170|Ga0210400_10301993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
| 3300021178|Ga0210408_10148283 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300021178|Ga0210408_10413725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300021178|Ga0210408_10571328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 897 | Open in IMG/M |
| 3300021178|Ga0210408_11452534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300021181|Ga0210388_11203652 | Not Available | 643 | Open in IMG/M |
| 3300021401|Ga0210393_10233190 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300021401|Ga0210393_11606808 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021404|Ga0210389_10677953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300021407|Ga0210383_10454254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300021407|Ga0210383_10600359 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300021475|Ga0210392_10667903 | Not Available | 773 | Open in IMG/M |
| 3300021475|Ga0210392_11046257 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 611 | Open in IMG/M |
| 3300021478|Ga0210402_11936840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300021479|Ga0210410_10972583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300021479|Ga0210410_11261585 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021479|Ga0210410_11332841 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300021559|Ga0210409_11444659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300021560|Ga0126371_13869107 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300024179|Ga0247695_1005658 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300024288|Ga0179589_10479312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300025439|Ga0208323_1014820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1804 | Open in IMG/M |
| 3300025498|Ga0208819_1018184 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300025910|Ga0207684_11660371 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300025916|Ga0207663_10474664 | Not Available | 968 | Open in IMG/M |
| 3300026310|Ga0209239_1136757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300026318|Ga0209471_1012959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4322 | Open in IMG/M |
| 3300026325|Ga0209152_10031852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
| 3300026328|Ga0209802_1087833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300026528|Ga0209378_1104600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
| 3300026530|Ga0209807_1061006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1711 | Open in IMG/M |
| 3300026530|Ga0209807_1140215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300026538|Ga0209056_10240809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300026557|Ga0179587_10025998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3203 | Open in IMG/M |
| 3300026896|Ga0207730_1015861 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300027063|Ga0207762_1001065 | All Organisms → cellular organisms → Bacteria | 6221 | Open in IMG/M |
| 3300027371|Ga0209418_1049303 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027669|Ga0208981_1122709 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027846|Ga0209180_10431789 | Not Available | 744 | Open in IMG/M |
| 3300027862|Ga0209701_10002101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12980 | Open in IMG/M |
| 3300027903|Ga0209488_10341657 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027903|Ga0209488_10385524 | Not Available | 1039 | Open in IMG/M |
| 3300027908|Ga0209006_11081804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300027965|Ga0209062_1208681 | Not Available | 709 | Open in IMG/M |
| 3300028047|Ga0209526_10166201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1540 | Open in IMG/M |
| 3300028047|Ga0209526_10338847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300028906|Ga0308309_11649048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300031545|Ga0318541_10685374 | Not Available | 572 | Open in IMG/M |
| 3300031572|Ga0318515_10495380 | Not Available | 652 | Open in IMG/M |
| 3300031724|Ga0318500_10651801 | Not Available | 535 | Open in IMG/M |
| 3300031736|Ga0318501_10347077 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300031753|Ga0307477_10115926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1865 | Open in IMG/M |
| 3300031753|Ga0307477_10806810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300031896|Ga0318551_10275691 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300031897|Ga0318520_10584064 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300031959|Ga0318530_10436840 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031962|Ga0307479_11030542 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300032009|Ga0318563_10582969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300032076|Ga0306924_11989435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300032089|Ga0318525_10331997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300032094|Ga0318540_10518299 | Not Available | 575 | Open in IMG/M |
| 3300032160|Ga0311301_10607816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
| 3300032174|Ga0307470_10191026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300032205|Ga0307472_101407995 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 676 | Open in IMG/M |
| 3300032805|Ga0335078_11119294 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300033158|Ga0335077_12171828 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300033405|Ga0326727_10723364 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300033755|Ga0371489_0348503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300033828|Ga0334850_117188 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.43% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.29% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.71% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.14% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.57% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.57% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.57% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.57% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.57% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026896 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1004576691 | 3300002245 | Forest Soil | ARLELQVKKLQTELQIERQYNQALEAQIHAFTHSE* |
| JGI26341J46601_101328311 | 3300003219 | Bog Forest Soil | PAGGSGDVQKLRAEITFLDSLVKKLQAELQNERQYNQTLEAQIRTLTHGE* |
| Ga0062389_1044440842 | 3300004092 | Bog Forest Soil | QKLRAEVARLELLVKKLQTELQIERQYNQALESQIHDLTHTE* |
| Ga0066671_107709051 | 3300005184 | Soil | PSDTLKLRAEIARLELLIKKLQTELQIERQYNQALESQLHNLTHSD* |
| Ga0066687_100077201 | 3300005454 | Soil | QKLRMEIARLELLVKKLQTELQIERQYNQALETQIRAFAQIE* |
| Ga0070738_103736902 | 3300005531 | Surface Soil | SRLELLVKKLQTELQIERQYNQALEVHVRTLTGLEQS* |
| Ga0070732_104657141 | 3300005542 | Surface Soil | RTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTSTE* |
| Ga0066701_108870031 | 3300005552 | Soil | PAPTAADIHKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVG* |
| Ga0066707_106677121 | 3300005556 | Soil | APTAADIHKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0066699_102096591 | 3300005561 | Soil | NTPARPAPTAADIHKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0066703_105806112 | 3300005568 | Soil | AHLDLLVKKLQTELQIERQYNQALEAQIRALTEVG* |
| Ga0066702_103375271 | 3300005575 | Soil | ARLELLVKKLQTELQIERQYNQALETQIHTLTEIE* |
| Ga0066787_101630451 | 3300005950 | Soil | SVPSGDALKLRAEVARLELLVKKLQTELQLERQYNQSLEAQIHDLTHTE* |
| Ga0080027_103398742 | 3300005993 | Prmafrost Soil | NASPEAQKLRAEIGRLDLLVKKLQTELQIERQYNQALELHVRSLIQID* |
| Ga0075029_1000554641 | 3300006052 | Watersheds | LRVEISRLELLVKKLQTELQIERQYNQALELHVRTLTQVD* |
| Ga0075030_1006334353 | 3300006162 | Watersheds | SADIQKLRAEIARLDLQIKKLQTELQIERQYNQALEAQMSALTQIE* |
| Ga0075030_1012948451 | 3300006162 | Watersheds | ARLDLLIKKLQNELQNERQYNQSLESQIRALTNID* |
| Ga0070716_1000134874 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RAEISRLELLVKKLQTELQIERQYNQALEVHVRTLTGLDQS* |
| Ga0075014_1005164192 | 3300006174 | Watersheds | SEIARLDLLVKKLQTEMQIERQYTQALELQIQTLTRVD* |
| Ga0075014_1007025011 | 3300006174 | Watersheds | YSDVNRLRAEIAHLELLVKKLQTELQIERQYNQALELHVRTLTQME* |
| Ga0070765_1011279972 | 3300006176 | Soil | LRVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR* |
| Ga0070765_1020037941 | 3300006176 | Soil | KLRSEIARLDLLVKKLQTEMQIERQYTQALELQIQTLTRVD* |
| Ga0075521_106489232 | 3300006642 | Arctic Peat Soil | RAEIARLDLLIKKLQTELQIERQYNQALELHVRSLLQID* |
| Ga0066658_100187061 | 3300006794 | Soil | TADMQKLRVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR* |
| Ga0066665_107653952 | 3300006796 | Soil | PTAADIHKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0099791_104734982 | 3300007255 | Vadose Zone Soil | RVEISRLEILVKNLQTELQIERQYNQALELHVRTLTQVD* |
| Ga0099795_102262961 | 3300007788 | Vadose Zone Soil | KTEIARLELLIKKLQTELQIERQYNQALEQHVHNLTTME* |
| Ga0066710_1043624782 | 3300009012 | Grasslands Soil | EIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVG |
| Ga0099829_102608561 | 3300009038 | Vadose Zone Soil | VEIMRLDLLVKKLQAELQIEREYTQTLELHLRTLRES* |
| Ga0099829_111896471 | 3300009038 | Vadose Zone Soil | MQKLRAEIARLELLVKKLQTELQIERQYNQAIEAQIHALTRLE* |
| Ga0099828_102681443 | 3300009089 | Vadose Zone Soil | VQKLRVEISHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0099828_119814531 | 3300009089 | Vadose Zone Soil | MQKLRAEIARLELLVKKLQTELQIERQYNLAIEAQIHALTRLE* |
| Ga0099792_106300803 | 3300009143 | Vadose Zone Soil | RLELLIKKLQTELQIERQYNQALEQHVHNLTNTD* |
| Ga0105242_102278441 | 3300009176 | Miscanthus Rhizosphere | SRLELLIKKLQTELQIERQYNQALELHVKSLTNLE* |
| Ga0116133_12245432 | 3300009623 | Peatland | MSVEGKLRAEIAHLELLIKKLQTELQIERQYNQALELHVRTLTHTE* |
| Ga0116115_10102631 | 3300009631 | Peatland | MRLELLVKKLQTELTIERQYCQALEMQIKTLHESMGG* |
| Ga0116117_10565291 | 3300009635 | Peatland | RAEITFLDTLVKKLQTELQNERQYNQSLESQIRALTSD* |
| Ga0126374_109734252 | 3300009792 | Tropical Forest Soil | LRAEIAHLELLVKKLQTELQIERQYNQALELQVRALTQLE* |
| Ga0126384_121544221 | 3300010046 | Tropical Forest Soil | RADIARLELLVKKLQTELQIERQYNQALEAQLQNLTRSE* |
| Ga0099796_105418381 | 3300010159 | Vadose Zone Soil | ADVQKLRVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR* |
| Ga0134088_103677082 | 3300010304 | Grasslands Soil | VEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0134111_102559141 | 3300010329 | Grasslands Soil | ARLDLLVKKLQTELQIERQYNQALETQIRTLTHVE* |
| Ga0134063_100162914 | 3300010335 | Grasslands Soil | SAPTVADVQKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0074044_107247811 | 3300010343 | Bog Forest Soil | RLDLLVKKLQTEMQIERQYTQALELQIQALTRVD* |
| Ga0126376_103234763 | 3300010359 | Tropical Forest Soil | EISRLELLVKKLQTELQIERQYNQALEVHVRTLTALEQS* |
| Ga0126378_111502771 | 3300010361 | Tropical Forest Soil | TEISRLELLIKKLQTELQIERQYNQALELHVKSLTSLE* |
| Ga0126379_129070793 | 3300010366 | Tropical Forest Soil | KLKTEIARLELLVKKLQTELQIERQYNQALEQHLHNLTNAE* |
| Ga0126381_1001657026 | 3300010376 | Tropical Forest Soil | EIARLEMLVKKLQTELQIERQYNQALEAQIQTLAQME* |
| Ga0126383_103566474 | 3300010398 | Tropical Forest Soil | VEISRLELLVKKLQTELQIERQYNQALELHARTLTQVE* |
| Ga0137776_11217951 | 3300010937 | Sediment | AEISRLELLVKKLQTELQIERQYNQALEVHVRTLTGLDQS* |
| Ga0150983_127971183 | 3300011120 | Forest Soil | HKLRVEIAHLDLLVKNLQTELQIERQYNQALETQIRTLTEA* |
| Ga0137388_103584741 | 3300012189 | Vadose Zone Soil | FRAEIARLELLVKKLQTELQIERQYNQALELHVRALTEVDQ* |
| Ga0137388_107214221 | 3300012189 | Vadose Zone Soil | QKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRALTEVR* |
| Ga0137363_100838121 | 3300012202 | Vadose Zone Soil | IARLELLVKKLQTELQIERQYNQALEQHVHNLTTIE* |
| Ga0137363_103734292 | 3300012202 | Vadose Zone Soil | RVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR* |
| Ga0137363_105657601 | 3300012202 | Vadose Zone Soil | MKLKTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTTD* |
| Ga0137363_111684252 | 3300012202 | Vadose Zone Soil | DIQKLRIEIAHLDLLVKKLQTELQIERQYNQALETQIRSLTDVE* |
| Ga0137399_113735741 | 3300012203 | Vadose Zone Soil | IEIAHLDLLVKKLQTELQIERQYNQALETQIRSLTDVE* |
| Ga0137380_109495971 | 3300012206 | Vadose Zone Soil | IARLDLLVKKLQTELQIERQYNQALETQIRTLTHVE* |
| Ga0137381_105254471 | 3300012207 | Vadose Zone Soil | VEIARLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0137376_110701882 | 3300012208 | Vadose Zone Soil | AVTVRPAPTTADMQKLRVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR* |
| Ga0137379_106757604 | 3300012209 | Vadose Zone Soil | EISHLELLIKKLQTELQIERQYNQALETQIRTLTEIE* |
| Ga0137378_101831991 | 3300012210 | Vadose Zone Soil | RAEILRLELLIKKLQTELQIEREYNQTLELHIKTLRESE* |
| Ga0137378_108141472 | 3300012210 | Vadose Zone Soil | VEIAHLDLLVKKLQTELQIERQYNQALETQIRALTEV* |
| Ga0137377_115062161 | 3300012211 | Vadose Zone Soil | IAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR* |
| Ga0137387_100967031 | 3300012349 | Vadose Zone Soil | IAVTVRPAPTTADMQKLRVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR* |
| Ga0137384_115954611 | 3300012357 | Vadose Zone Soil | LRVEIARLDLLVKKLQTELQIERQYNQALETQIRTLTDV* |
| Ga0137385_116351602 | 3300012359 | Vadose Zone Soil | EIARLDLLVKKLQTELQIERQYNQALETQIRTLTYVE* |
| Ga0137361_119596372 | 3300012362 | Vadose Zone Soil | MKLKTEIARLELLIKKLQTELQIERQYNQALEQHVHNLTNTD* |
| Ga0137390_112941502 | 3300012363 | Vadose Zone Soil | QKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRALTEVS* |
| Ga0137398_103495853 | 3300012683 | Vadose Zone Soil | EIARLELLIKKLQTELQIERQYNQALEQHVHNLTATE* |
| Ga0137395_110971071 | 3300012917 | Vadose Zone Soil | HLDLLVKKLQTELQIERQYNQALETQIRSLTDLE* |
| Ga0137396_101760485 | 3300012918 | Vadose Zone Soil | ARLELLIKKLQTELQIERQYNQALEQHVHNLTTME* |
| Ga0137396_106330831 | 3300012918 | Vadose Zone Soil | ADVLKLRAEIAHLELLVKKLQTELQIERQYNQALELQIKTLTQMES* |
| Ga0137359_102103131 | 3300012923 | Vadose Zone Soil | KTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTIE* |
| Ga0137413_102971334 | 3300012924 | Vadose Zone Soil | RLELLIKKLQTELQIERQYNQALEQHVHNLTTME* |
| Ga0137419_101495814 | 3300012925 | Vadose Zone Soil | IKLKTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTIE* |
| Ga0137416_108862783 | 3300012927 | Vadose Zone Soil | SPDIIKLKTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTTD* |
| Ga0137416_110128222 | 3300012927 | Vadose Zone Soil | SADVQKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS* |
| Ga0137404_105302642 | 3300012929 | Vadose Zone Soil | EISRLEILVKKLQTELQIERQYNQALELHVRTLTQVD* |
| Ga0137404_113808551 | 3300012929 | Vadose Zone Soil | TEISRLELLIKKLQTELQIERQYNQALELHVKSLTSLD* |
| Ga0137407_110086911 | 3300012930 | Vadose Zone Soil | KLRIEIAHLDLLVKKLQTELQIERQYNQALETQIRSLTDVE* |
| Ga0164301_115180751 | 3300012960 | Soil | IARLDLLVKKLQTELQIERQYNQALESQLQNLTRSE* |
| Ga0126369_115941791 | 3300012971 | Tropical Forest Soil | LRVEIARLELLVKKLQTELQIERQYNQAIETQIRTLAGLE* |
| Ga0134076_106321811 | 3300012976 | Grasslands Soil | DVQKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRALTEVG* |
| Ga0134087_108364252 | 3300012977 | Grasslands Soil | AHLDLLVKKLQTELQIERQYNQALETQIRTLTEVG* |
| Ga0134081_103019161 | 3300014150 | Grasslands Soil | MEIARLELLVKKLQTELQIERQYNQALETQIRAFAQIE* |
| Ga0137418_101328861 | 3300015241 | Vadose Zone Soil | EIAHLDLLVKKLQTELQIERQYNQALETQIRSLTDVE* |
| Ga0182036_115659302 | 3300016270 | Soil | HKLRAEISCLELLVKKLQTELQVERQYNQALELHVRALTRVE |
| Ga0187824_102797291 | 3300017927 | Freshwater Sediment | PTALDIQKLRAEIARLDLLVKKLQTEMQIERQYTQALELQIQTLTRVD |
| Ga0187824_103022172 | 3300017927 | Freshwater Sediment | QKLRSEIARLDLLVKKLQTEMQIERQYTQALELQIQTLTRVD |
| Ga0187821_102274531 | 3300017936 | Freshwater Sediment | IAHLDLLVKKLQTELQIERQYNQALETQIRALTEVE |
| Ga0187781_114688122 | 3300017972 | Tropical Peatland | SCLELLIKKLQTELQIERQYNQALELHVRALTKND |
| Ga0187810_102992571 | 3300018012 | Freshwater Sediment | RAEIAHLELLIKKLQTELQIERQYKQALELQIKTLTEMES |
| Ga0187881_100064937 | 3300018024 | Peatland | EIAHLELLVKKLQTELQIERQYNQALELHVRTLTRTE |
| Ga0187769_109337341 | 3300018086 | Tropical Peatland | ISRLELLVKKLQTELQIERQYNQALELHVRSLNQLD |
| Ga0066662_109519303 | 3300018468 | Grasslands Soil | ADMQKLRVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR |
| Ga0193730_11014752 | 3300020002 | Soil | RVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR |
| Ga0179594_100212731 | 3300020170 | Vadose Zone Soil | DVQKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0210407_1000147323 | 3300020579 | Soil | APTASDIQKLRVEIARLDLQVKKLQTELQIERQYNQALETQIRALTEVES |
| Ga0210407_104711252 | 3300020579 | Soil | LRVEIAHLDLLVKKLQTELQIERQYNQALETQIRSLTEVS |
| Ga0210407_106097201 | 3300020579 | Soil | PDIVKLKTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTVE |
| Ga0210403_101686071 | 3300020580 | Soil | AHLELLIKKLQTELQIERQYNQALELHVRTLTQVE |
| Ga0210403_110182082 | 3300020580 | Soil | VEIAHLDLLVKKLQTELQIERQYNQALETQIRSLTEVS |
| Ga0210399_104296323 | 3300020581 | Soil | IARLDLLVKKLQTEMQIERQYTQALELQIQTLTRVD |
| Ga0210399_114734642 | 3300020581 | Soil | LRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0210400_103019934 | 3300021170 | Soil | KLKTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTTD |
| Ga0210408_101482831 | 3300021178 | Soil | EIARLELLVKKLQTELQIERQYNQALEQHVHNLTTVE |
| Ga0210408_104137251 | 3300021178 | Soil | AHLDLLIKKLQTELQIERQYNQALESQIRAFTESA |
| Ga0210408_105713281 | 3300021178 | Soil | PDIVKLKTEIARLELLVKKLQTELQIERQYNQALDQHIHNLTTTD |
| Ga0210408_114525341 | 3300021178 | Soil | TEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTVE |
| Ga0210388_112036521 | 3300021181 | Soil | EISHLQLLIKKLQTELQIERQYNQALELHVRTLTQVD |
| Ga0210393_102331903 | 3300021401 | Soil | PGATPRPAPTASDIQKLRVEIARLDLQVKKLQTELQIERQYNQALETQIRALTEVES |
| Ga0210393_116068081 | 3300021401 | Soil | IQKLRVEIARLDLQVKKLQTELQIERQYNQALETQIRALTEVES |
| Ga0210389_106779533 | 3300021404 | Soil | LRSEIARLDLLVKKLQTEMQIERQYTQALELQIQTLTRVD |
| Ga0210383_104542543 | 3300021407 | Soil | LRAEVARLELLVKKLQTELQIERQYNQALESQIHDLTHTE |
| Ga0210383_106003592 | 3300021407 | Soil | VEISRLEILVKKLQTELQIERQYNQALELHVRTLTQVD |
| Ga0210392_106679031 | 3300021475 | Soil | TFLDALVKKLQTELQNERQYNQALEAQIRALTQGD |
| Ga0210392_110462571 | 3300021475 | Soil | DVQKLRAEIAHLELLIKKLQTELQIERQYNQALELHVRTLTQVE |
| Ga0210402_119368402 | 3300021478 | Soil | AHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0210410_109725832 | 3300021479 | Soil | AHLDLLVKKLQTELQIERQYNQALESQIRAITEST |
| Ga0210410_112615851 | 3300021479 | Soil | DIVKLKTEIARLELLVKKLQTELQIERQYNQALEQHVHNLTTVD |
| Ga0210410_113328411 | 3300021479 | Soil | LRVEISRLEILVKKLQTELQIERQYNQALELHVRTLTQVD |
| Ga0210409_114446591 | 3300021559 | Soil | VQRLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRSLTEVS |
| Ga0126371_138691072 | 3300021560 | Tropical Forest Soil | RVEIARLELLVKKLQTELQIERQYNQALETQIQTLTNIE |
| Ga0247695_10056581 | 3300024179 | Soil | RLELLVKKLQTELQIERQYNQALEVHVRTLTGLDQS |
| Ga0179589_104793122 | 3300024288 | Vadose Zone Soil | IAHLDLLVKKMKTELQIERQYNQALETQFRSLTEVS |
| Ga0208323_10148201 | 3300025439 | Peatland | LELLVKKLQTELTIERQYCQALEMQIKTLHESMGG |
| Ga0208819_10181841 | 3300025498 | Peatland | ELRLRAEIAHLELLVKKLQTELQIERQYNQALELHVRTLTRTE |
| Ga0207684_116603712 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TEISRLELLIKKLQTELQIERQYNQALELHVKSLTSID |
| Ga0207663_104746642 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AEIARLELLIKKLQTELQIERQYNQALESQLHNLTHSD |
| Ga0209239_11367572 | 3300026310 | Grasslands Soil | VEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0209471_10129591 | 3300026318 | Soil | APTAADIQKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTQVS |
| Ga0209152_100318523 | 3300026325 | Soil | EIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR |
| Ga0209802_10878333 | 3300026328 | Soil | RVEIARLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0209378_11046001 | 3300026528 | Soil | RPAPTAADIHKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVG |
| Ga0209807_10610063 | 3300026530 | Soil | TVADVQKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0209807_11402153 | 3300026530 | Soil | AHLDLLVKKLQTELQIERQYNQALETQIRTLTEVG |
| Ga0209056_102408093 | 3300026538 | Soil | EIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0179587_100259981 | 3300026557 | Vadose Zone Soil | PADVQKLRVEIAHLDLLVKKLQTELQIERQYNQALETQIRTLTEVS |
| Ga0207730_10158611 | 3300026896 | Tropical Forest Soil | IARLDLLIKKLQTELQIERQYNQALELHVRTLLQVD |
| Ga0207762_10010651 | 3300027063 | Tropical Forest Soil | KLKAEIAHLELLIKKLQTELQIERQYNQALELQVRALTQIE |
| Ga0209418_10493033 | 3300027371 | Forest Soil | IAHLELLIKKLQTELQIERQYNQALELHVRTLTQVE |
| Ga0208981_11227092 | 3300027669 | Forest Soil | EVARLELLVKKVQTELQLEREYNQALEKQIHTLINAH |
| Ga0209180_104317891 | 3300027846 | Vadose Zone Soil | VEIMRLDLLVKKLQAELQIEREYTQTLELHLRTLRES |
| Ga0209701_1000210113 | 3300027862 | Vadose Zone Soil | MRLELLVKKLQTELSIEKQYCASLELHIRTLQEVK |
| Ga0209488_103416571 | 3300027903 | Vadose Zone Soil | IARLELLIKKLQTELQIERQYNQALEQHVHNLTTME |
| Ga0209488_103855244 | 3300027903 | Vadose Zone Soil | IARLELLIKKLQTELQIERQYNQALEQHVHNLTNTD |
| Ga0209006_110818042 | 3300027908 | Forest Soil | TKLRAEIARLELQVKKLQTELQIERQYNQALEAQLHAFTHSE |
| Ga0209062_12086812 | 3300027965 | Surface Soil | SRLELLVKKLQTELQIERQYNQALEVHVRTLTGLEQS |
| Ga0209526_101662013 | 3300028047 | Forest Soil | IKLKTEIARLELLVKKLQTELQIERQYNQALDQHVHNLTTTD |
| Ga0209526_103388473 | 3300028047 | Forest Soil | RIEIAHLDLLVKKLQTELQIERQYNQALESQIRALTDVE |
| Ga0308309_116490481 | 3300028906 | Soil | ADVQKLRVEIAHLDLLVKKLQAELQIERQYNQALETQIRTLTEVR |
| Ga0318541_106853742 | 3300031545 | Soil | IAHLELLVKKLQTELQIERQYNQALELHVRTLNQVE |
| Ga0318515_104953802 | 3300031572 | Soil | EIARLELLVKKLQTELQIERQYNQALELHVRTLNQVE |
| Ga0318500_106518011 | 3300031724 | Soil | EIAHLELLVKKLQTELQIERQYNQALELHVRTLTQVE |
| Ga0318501_103470772 | 3300031736 | Soil | LKTEISRLELLIKKLQTELQIERQYNQALELHVKSLTALD |
| Ga0307477_101159264 | 3300031753 | Hardwood Forest Soil | KLRVEIAHLDLLIKKLQTELQIERQYNQALETQIRALTEVE |
| Ga0307477_108068101 | 3300031753 | Hardwood Forest Soil | RVEIAHLELLIKKLQTELQIERQYNQALETQIRSLTEVS |
| Ga0318551_102756911 | 3300031896 | Soil | EISRLELLIKKLQTELQIERQYNQALELHVKALTSVD |
| Ga0318520_105840641 | 3300031897 | Soil | EIARLDLLVKKLQTELQIERQYNQALESQIRAITESV |
| Ga0318530_104368402 | 3300031959 | Soil | HKLRAEIAHLELLVKKLQTELQIERQYNQALELHVRTLTRVE |
| Ga0307479_110305422 | 3300031962 | Hardwood Forest Soil | QAPAAPELQKLRVEMARLEMLIKKLQTELQIERQYNQALETQIQALTQIASS |
| Ga0318563_105829692 | 3300032009 | Soil | ISRLELLIKKLQTELQIERQYNQALELHIKSLTTLE |
| Ga0306924_119894352 | 3300032076 | Soil | AEIAHLELLVKKLQTELQIERQYNQALELHVRTLTRVE |
| Ga0318525_103319972 | 3300032089 | Soil | KTEISRLELLIKKLQTELQIERQYNQALELHIKSLTTLE |
| Ga0318540_105182991 | 3300032094 | Soil | AHLELLVKKLQTELQIERQYNQALELHVRTLNQVE |
| Ga0311301_106078161 | 3300032160 | Peatlands Soil | DMQKLRLEIAHLDLLVKKLQTELQIERQYNQALETQIRALTEPE |
| Ga0307470_101910263 | 3300032174 | Hardwood Forest Soil | KLRVEISRLEILVKKLQTELQIERQYNQALELHVRTLTQVD |
| Ga0307472_1014079951 | 3300032205 | Hardwood Forest Soil | AEIAHLELLIKKLQTELQIERQYNQALELHVRTLTQVE |
| Ga0335078_111192941 | 3300032805 | Soil | SRLELLVKKLQTELQIERQYNQALELQVRTLTQIE |
| Ga0335077_121718282 | 3300033158 | Soil | KLRTEISCLELLIKKLQTELQIERQYNQALELHVRTLTQVD |
| Ga0326727_107233641 | 3300033405 | Peat Soil | DIHKLRAEISVLELLVKKLQTELQIERQYNQALELHVRTLTKLE |
| Ga0371489_0348503_583_696 | 3300033755 | Peat Soil | EISHLELLIKKLQTELQIERQYNQALELQVRALTQVD |
| Ga0334850_117188_2_118 | 3300033828 | Soil | AEIAFLDTLIKKLQSELQNERQYNQALESQIRNLTHDD |
| ⦗Top⦘ |