| Basic Information | |
|---|---|
| Family ID | F034314 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 44 residues |
| Representative Sequence | ALTNADQTVVYLLVLHCTSSCYSNDQTEINDVMSSFTIRSS |
| Number of Associated Samples | 159 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.14 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.714 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 21.14 |
| PF01434 | Peptidase_M41 | 2.86 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 2.86 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.71 % |
| Unclassified | root | N/A | 34.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573002|GZIGXIF02IFJVG | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 509 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100931165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
| 3300003350|JGI26347J50199_1048766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300004103|Ga0058903_1032934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300004139|Ga0058897_10028480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 812 | Open in IMG/M |
| 3300005529|Ga0070741_10051000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5020 | Open in IMG/M |
| 3300005529|Ga0070741_11319877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 603 | Open in IMG/M |
| 3300005602|Ga0070762_10087162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 1785 | Open in IMG/M |
| 3300005610|Ga0070763_10927468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300005617|Ga0068859_100954733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 940 | Open in IMG/M |
| 3300005993|Ga0080027_10229257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
| 3300006028|Ga0070717_11362772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 644 | Open in IMG/M |
| 3300006031|Ga0066651_10374743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300006052|Ga0075029_100565486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 756 | Open in IMG/M |
| 3300006052|Ga0075029_100606318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 732 | Open in IMG/M |
| 3300006162|Ga0075030_100654303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 832 | Open in IMG/M |
| 3300006173|Ga0070716_100177744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1395 | Open in IMG/M |
| 3300006176|Ga0070765_100829809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 874 | Open in IMG/M |
| 3300006354|Ga0075021_10984135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300007788|Ga0099795_10142170 | Not Available | 977 | Open in IMG/M |
| 3300009038|Ga0099829_10689108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 849 | Open in IMG/M |
| 3300009092|Ga0105250_10450026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 578 | Open in IMG/M |
| 3300009520|Ga0116214_1098444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1075 | Open in IMG/M |
| 3300009520|Ga0116214_1213980 | Not Available | 727 | Open in IMG/M |
| 3300009672|Ga0116215_1462464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 549 | Open in IMG/M |
| 3300009700|Ga0116217_10944313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 528 | Open in IMG/M |
| 3300009824|Ga0116219_10311492 | Not Available | 886 | Open in IMG/M |
| 3300010113|Ga0127444_1006179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 523 | Open in IMG/M |
| 3300010132|Ga0127455_1109585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300010154|Ga0127503_10629896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1296 | Open in IMG/M |
| 3300010339|Ga0074046_10683484 | Not Available | 604 | Open in IMG/M |
| 3300010343|Ga0074044_10663865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 680 | Open in IMG/M |
| 3300010343|Ga0074044_10937370 | Not Available | 566 | Open in IMG/M |
| 3300010379|Ga0136449_101564343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 1004 | Open in IMG/M |
| 3300010859|Ga0126352_1161633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300010877|Ga0126356_11211305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300011120|Ga0150983_12645555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300012357|Ga0137384_10690293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 829 | Open in IMG/M |
| 3300012359|Ga0137385_10084261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2823 | Open in IMG/M |
| 3300012390|Ga0134054_1296436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 544 | Open in IMG/M |
| 3300012500|Ga0157314_1004893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300012930|Ga0137407_10254912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1591 | Open in IMG/M |
| 3300012960|Ga0164301_11898008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300012971|Ga0126369_13494959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 515 | Open in IMG/M |
| 3300012987|Ga0164307_10235082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1270 | Open in IMG/M |
| 3300012989|Ga0164305_11166238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 666 | Open in IMG/M |
| 3300013307|Ga0157372_12203747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 633 | Open in IMG/M |
| 3300015372|Ga0132256_101354851 | Not Available | 824 | Open in IMG/M |
| 3300016294|Ga0182041_10888750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 800 | Open in IMG/M |
| 3300016341|Ga0182035_11105707 | Not Available | 705 | Open in IMG/M |
| 3300016341|Ga0182035_12183498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 502 | Open in IMG/M |
| 3300016357|Ga0182032_11691573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 552 | Open in IMG/M |
| 3300016404|Ga0182037_12041553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300017942|Ga0187808_10230441 | Not Available | 827 | Open in IMG/M |
| 3300017946|Ga0187879_10354103 | Not Available | 814 | Open in IMG/M |
| 3300017959|Ga0187779_11037613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 570 | Open in IMG/M |
| 3300017970|Ga0187783_10452528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300017970|Ga0187783_10551867 | Not Available | 834 | Open in IMG/M |
| 3300017973|Ga0187780_10184181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1454 | Open in IMG/M |
| 3300018006|Ga0187804_10171193 | Not Available | 921 | Open in IMG/M |
| 3300018007|Ga0187805_10178560 | Not Available | 968 | Open in IMG/M |
| 3300018046|Ga0187851_10438497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
| 3300018058|Ga0187766_10420756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 887 | Open in IMG/M |
| 3300018060|Ga0187765_10290260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 977 | Open in IMG/M |
| 3300018086|Ga0187769_11299833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 550 | Open in IMG/M |
| 3300019260|Ga0181506_1367018 | Not Available | 824 | Open in IMG/M |
| 3300020081|Ga0206354_10795651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300020082|Ga0206353_11793146 | Not Available | 670 | Open in IMG/M |
| 3300020140|Ga0179590_1091973 | Not Available | 813 | Open in IMG/M |
| 3300020580|Ga0210403_10202757 | Not Available | 1628 | Open in IMG/M |
| 3300021178|Ga0210408_10094992 | Not Available | 2341 | Open in IMG/M |
| 3300021178|Ga0210408_11390889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 529 | Open in IMG/M |
| 3300021384|Ga0213876_10488732 | Not Available | 655 | Open in IMG/M |
| 3300021402|Ga0210385_10444623 | Not Available | 978 | Open in IMG/M |
| 3300021402|Ga0210385_11352434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 545 | Open in IMG/M |
| 3300021402|Ga0210385_11397110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300021432|Ga0210384_10940632 | Not Available | 765 | Open in IMG/M |
| 3300021475|Ga0210392_11367060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 530 | Open in IMG/M |
| 3300021478|Ga0210402_11936843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300021560|Ga0126371_10714349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1150 | Open in IMG/M |
| 3300022499|Ga0242641_1038901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 546 | Open in IMG/M |
| 3300022508|Ga0222728_1124158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 508 | Open in IMG/M |
| 3300022522|Ga0242659_1008590 | Not Available | 1378 | Open in IMG/M |
| 3300022527|Ga0242664_1021572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
| 3300022528|Ga0242669_1118184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 530 | Open in IMG/M |
| 3300022531|Ga0242660_1116807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 669 | Open in IMG/M |
| 3300022532|Ga0242655_10130270 | Not Available | 720 | Open in IMG/M |
| 3300022533|Ga0242662_10088372 | Not Available | 866 | Open in IMG/M |
| 3300022709|Ga0222756_1011359 | Not Available | 1028 | Open in IMG/M |
| 3300022712|Ga0242653_1107433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 517 | Open in IMG/M |
| 3300022713|Ga0242677_1025278 | Not Available | 763 | Open in IMG/M |
| 3300022714|Ga0242671_1103260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300022717|Ga0242661_1023904 | Not Available | 1008 | Open in IMG/M |
| 3300022718|Ga0242675_1033715 | Not Available | 791 | Open in IMG/M |
| 3300022718|Ga0242675_1055264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 675 | Open in IMG/M |
| 3300022721|Ga0242666_1162005 | Not Available | 553 | Open in IMG/M |
| 3300024187|Ga0247672_1100031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300026041|Ga0207639_10918917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300026214|Ga0209838_1011938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300026999|Ga0207949_1029083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300027064|Ga0208724_1006408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1091 | Open in IMG/M |
| 3300027567|Ga0209115_1124036 | Not Available | 583 | Open in IMG/M |
| 3300027604|Ga0208324_1191009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 546 | Open in IMG/M |
| 3300027641|Ga0208827_1102975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
| 3300027795|Ga0209139_10095834 | Not Available | 1045 | Open in IMG/M |
| 3300027867|Ga0209167_10506753 | Not Available | 661 | Open in IMG/M |
| 3300027879|Ga0209169_10274716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
| 3300027889|Ga0209380_10369776 | Not Available | 842 | Open in IMG/M |
| 3300027898|Ga0209067_10248036 | Not Available | 968 | Open in IMG/M |
| 3300027908|Ga0209006_10139842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2129 | Open in IMG/M |
| 3300028806|Ga0302221_10300973 | Not Available | 699 | Open in IMG/M |
| 3300028811|Ga0307292_10152157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 935 | Open in IMG/M |
| 3300028906|Ga0308309_10249831 | Not Available | 1484 | Open in IMG/M |
| 3300029701|Ga0222748_1014600 | Not Available | 1073 | Open in IMG/M |
| 3300029701|Ga0222748_1046839 | Not Available | 730 | Open in IMG/M |
| 3300029882|Ga0311368_11067115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300029944|Ga0311352_11322167 | Not Available | 544 | Open in IMG/M |
| 3300029999|Ga0311339_10214440 | Not Available | 2159 | Open in IMG/M |
| 3300030399|Ga0311353_10930073 | Not Available | 733 | Open in IMG/M |
| 3300030528|Ga0210277_10628775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300030528|Ga0210277_10837752 | Not Available | 835 | Open in IMG/M |
| 3300030535|Ga0210285_1037001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300030545|Ga0210271_10839661 | Not Available | 692 | Open in IMG/M |
| 3300030548|Ga0210252_10527718 | Not Available | 564 | Open in IMG/M |
| 3300030573|Ga0210272_1004246 | Not Available | 1293 | Open in IMG/M |
| 3300030575|Ga0210288_1088232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300030578|Ga0210275_10101603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300030595|Ga0210276_10822597 | Not Available | 549 | Open in IMG/M |
| 3300030596|Ga0210278_1208547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 512 | Open in IMG/M |
| 3300030602|Ga0210254_11307873 | Not Available | 672 | Open in IMG/M |
| 3300030603|Ga0210253_10460226 | Not Available | 765 | Open in IMG/M |
| 3300030624|Ga0210251_11266429 | Not Available | 686 | Open in IMG/M |
| 3300030626|Ga0210291_11241017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1071 | Open in IMG/M |
| 3300030627|Ga0210269_10174407 | Not Available | 679 | Open in IMG/M |
| 3300030632|Ga0210250_11144852 | Not Available | 798 | Open in IMG/M |
| 3300030739|Ga0302311_10564776 | Not Available | 771 | Open in IMG/M |
| 3300030740|Ga0265460_10714883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300030855|Ga0075374_11344198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300030950|Ga0074034_11151785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300030973|Ga0075395_11457320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
| 3300031446|Ga0170820_14669596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300031680|Ga0318574_10350709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300031708|Ga0310686_104517965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 547 | Open in IMG/M |
| 3300031744|Ga0306918_11404468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 535 | Open in IMG/M |
| 3300031751|Ga0318494_10892384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300031753|Ga0307477_10722496 | Not Available | 665 | Open in IMG/M |
| 3300031769|Ga0318526_10348453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 606 | Open in IMG/M |
| 3300031770|Ga0318521_10274959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 988 | Open in IMG/M |
| 3300031771|Ga0318546_10527369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300031781|Ga0318547_10633923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 663 | Open in IMG/M |
| 3300031819|Ga0318568_10635380 | Not Available | 664 | Open in IMG/M |
| 3300031866|Ga0316049_122073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 521 | Open in IMG/M |
| 3300031897|Ga0318520_10486854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 760 | Open in IMG/M |
| 3300031942|Ga0310916_11037620 | Not Available | 683 | Open in IMG/M |
| 3300031942|Ga0310916_11349708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300031959|Ga0318530_10474656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 519 | Open in IMG/M |
| 3300031962|Ga0307479_11142683 | Not Available | 744 | Open in IMG/M |
| 3300032008|Ga0318562_10394524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 804 | Open in IMG/M |
| 3300032008|Ga0318562_10753882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300032009|Ga0318563_10611330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 587 | Open in IMG/M |
| 3300032025|Ga0318507_10041914 | Not Available | 1765 | Open in IMG/M |
| 3300032054|Ga0318570_10267978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300032059|Ga0318533_11116796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 577 | Open in IMG/M |
| 3300032063|Ga0318504_10238712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300032063|Ga0318504_10344753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis | 707 | Open in IMG/M |
| 3300032076|Ga0306924_11000871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
| 3300032090|Ga0318518_10311310 | Not Available | 808 | Open in IMG/M |
| 3300032180|Ga0307471_102311415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
| 3300032770|Ga0335085_10358585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1706 | Open in IMG/M |
| 3300032892|Ga0335081_11383733 | Not Available | 788 | Open in IMG/M |
| 3300032896|Ga0335075_10868894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 832 | Open in IMG/M |
| 3300033158|Ga0335077_10299307 | Not Available | 1761 | Open in IMG/M |
| 3300033290|Ga0318519_10190369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1166 | Open in IMG/M |
| 3300033290|Ga0318519_10571458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300034199|Ga0370514_081191 | Not Available | 823 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.43% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.43% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.43% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.29% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.71% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.14% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.57% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.57% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030535 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030573 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030575 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030595 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030603 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030624 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030627 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030632 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030950 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE1_04621560 | 2189573002 | Grass Soil | ADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSL |
| JGIcombinedJ26739_1009311652 | 3300002245 | Forest Soil | DQTTVYLLVLHCEASCYSTDQTEINDVMSSFTIRSPS* |
| JGI26347J50199_10487661 | 3300003350 | Bog Forest Soil | NAEDTVIYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS* |
| Ga0058903_10329341 | 3300004103 | Forest Soil | DEIALTNAEDTVVYFMVLHCTTSCYSTDQTAINDVMSSFTIRSSS* |
| Ga0058897_100284802 | 3300004139 | Forest Soil | TNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSQ* |
| Ga0070741_100510006 | 3300005529 | Surface Soil | VSDTFDQVALTNADQTVIYLLLLHCTNSCYSSDQSEINDVMSSFTIRSS* |
| Ga0070741_113198772 | 3300005529 | Surface Soil | TFDEIALTNAEQTIVYLLVLHCTTDCYSRDQSEINDVMSSFTIRSP* |
| Ga0070762_100871621 | 3300005602 | Soil | FDEIALTNAEDTLVYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS* |
| Ga0070763_109274682 | 3300005610 | Soil | NADQTEVYLLVLHCTTACYSQDQTQINDVMTSFTIRSS* |
| Ga0068859_1009547331 | 3300005617 | Switchgrass Rhizosphere | QTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL* |
| Ga0080027_102292572 | 3300005993 | Prmafrost Soil | EVALTNADQTVVYLLVTHCTSSCYSKDLSQINDVMSSFTIRSS* |
| Ga0070717_113627721 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GIADTFDQVALTNADQTVFYLLLLHCTSSCYSSDQSEINDVMSSFTIRSQ* |
| Ga0066651_103747432 | 3300006031 | Soil | TVVYLLVLHCTTKCYSSDQTEINDVMSSFTIRSL* |
| Ga0075029_1005654862 | 3300006052 | Watersheds | NADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0075029_1006063182 | 3300006052 | Watersheds | FDEIALTNAEDTVVYFLVLHCTTSCYSNDQTAINDVMSSFTIRSSS* |
| Ga0075030_1006543031 | 3300006162 | Watersheds | LTNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSQ* |
| Ga0070716_1001777441 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VALTNANQTVVYLLVLHCTTSCYSTDQTEINDVMSSFTIRSS* |
| Ga0070765_1008298092 | 3300006176 | Soil | DEVALTNADQTVVYLLVLHCTTSCYSTDQTEINDVMSSFTIRSS* |
| Ga0075021_109841352 | 3300006354 | Watersheds | DEVALTNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0099795_101421701 | 3300007788 | Vadose Zone Soil | NAEDTVVYFMVLHCTTSCYSSDQTQINDVMSSFTIRST* |
| Ga0099829_106891081 | 3300009038 | Vadose Zone Soil | YSYAGRTDTFDQIALTNADQTTVYLLVLDCTSSCYSNDQTDINNVMSSFTIRSS* |
| Ga0105250_104500261 | 3300009092 | Switchgrass Rhizosphere | LTNADQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL* |
| Ga0116214_10984441 | 3300009520 | Peatlands Soil | TFDEVALTNADQTEVYLLVIHCTTACFSTDQAEINDVMTSFTIGSP* |
| Ga0116214_12139801 | 3300009520 | Peatlands Soil | TNADQTVVYLLVLHCTSSCYSHDQTEINDVMSSFTIRSP* |
| Ga0116215_14624641 | 3300009672 | Peatlands Soil | TVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0116217_109443132 | 3300009700 | Peatlands Soil | TNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0116219_103114922 | 3300009824 | Peatlands Soil | GPDNITDTFDEVALTNADQTDIYLLVLHCTASCYSNDQTEINDVM* |
| Ga0127444_10061792 | 3300010113 | Grasslands Soil | FDQVALTNADQTVFYLLLLHCTSKCYSSDQSEINDVMSSFTIRSS* |
| Ga0127455_11095851 | 3300010132 | Grasslands Soil | FDEVALTNADQTVVYLLVLHCTSKCYSNDQTEINDVMSSFTIRSL* |
| Ga0127503_106298961 | 3300010154 | Soil | DTFDEVALTNASSTFVYLLVLHCTSSCYSSDMTEINDVMSSFTIRSS* |
| Ga0074046_106834841 | 3300010339 | Bog Forest Soil | LTNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0074044_106638652 | 3300010343 | Bog Forest Soil | DQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0074044_109373702 | 3300010343 | Bog Forest Soil | EVALTNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0136449_1015643431 | 3300010379 | Peatlands Soil | LTNADQIVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP* |
| Ga0126352_11616332 | 3300010859 | Boreal Forest Soil | ADTFDEVALTNADQTEVYLLVLHCTTACYSQDQTQINDVMSSFTIRSS* |
| Ga0126356_112113051 | 3300010877 | Boreal Forest Soil | TFQGGQTDTFDEIALTNAEDTLVYFMVLHCTTSCYSSDQTQINDVMSSFTIRSSS* |
| Ga0150983_126455551 | 3300011120 | Forest Soil | FTGGVTDTFDEVALTNADQTIVYLLVLHCTSSCYSNDQTEINDVMSSFTIRSS* |
| Ga0137384_106902931 | 3300012357 | Vadose Zone Soil | NADQTVVYLLVLDCTTSCYGNDQTDINNVMSSFTIRSS* |
| Ga0137385_100842611 | 3300012359 | Vadose Zone Soil | DTFDEVALTNADQTVVYLLVLHCTDSCYSTDQTEINDVMSSFTIRSQ* |
| Ga0134054_12964362 | 3300012390 | Grasslands Soil | VALTNADQTVVYLLVLHCTTSCYSSDQSEINDVMSSFTIRSS* |
| Ga0157314_10048931 | 3300012500 | Arabidopsis Rhizosphere | TGTVTDTFDEVALTNADQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL* |
| Ga0137407_102549121 | 3300012930 | Vadose Zone Soil | GNVTDTFDEVALTNADQTVVYLLVLHCTAKCYSNDQTEINDVMSSFTIRSL* |
| Ga0164301_118980081 | 3300012960 | Soil | NVTDTFDEVALTNADQTVVYLLVLHCTASCYSNDQTEINDVMSSFTIRST* |
| Ga0126369_134949592 | 3300012971 | Tropical Forest Soil | DEIALTNAEQTIVYFMVLHCTTSCYTADQTAINDVMSSFTIRSSS* |
| Ga0164307_102350821 | 3300012987 | Soil | YTFTGNVTDTFDEVALTNADQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL* |
| Ga0164305_111662381 | 3300012989 | Soil | DQTIVYLLVLHCTSSCYSNDQTEINDVMSSFTIRSS* |
| Ga0157372_122037471 | 3300013307 | Corn Rhizosphere | DQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL* |
| Ga0132256_1013548511 | 3300015372 | Arabidopsis Rhizosphere | NADQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL* |
| Ga0182041_108887501 | 3300016294 | Soil | DEIALTNAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0182035_111057071 | 3300016341 | Soil | ALTNADQTVVYLLVLHCTSSCYSNDQTEINDVMSSFTIRSS |
| Ga0182035_121834982 | 3300016341 | Soil | LTNAEQTIVYFMVLHCTTSCYTADQTAINDVMSSFTIRSSS |
| Ga0182032_116915731 | 3300016357 | Soil | ALTNAEQTVVYFLVLHCTSSCYSSDQTAINDVMSSFTIRSSS |
| Ga0182037_120415532 | 3300016404 | Soil | DYTLNGSQTDTFDEIALTNAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0187808_102304411 | 3300017942 | Freshwater Sediment | LTNADQTEVYLLVIHCTTACYSNDQAEINDVMTSFTIGSP |
| Ga0187879_103541031 | 3300017946 | Peatland | PDQTEVYFLVLHCTSSCYSSDKTEIDDVMSSFTIRSP |
| Ga0187779_110376131 | 3300017959 | Tropical Peatland | DEVALTNADQTVVYLLVLHCTTSCYSNDQSEINDVMSSFTIGSP |
| Ga0187783_104525281 | 3300017970 | Tropical Peatland | FDEIALTNADQTVVYFLVLHCTTSCYDNDQTQINQVMSSFTVRSSS |
| Ga0187783_105518671 | 3300017970 | Tropical Peatland | NADQTVVYLLALHCTTSCYNNDQTEINDVMSSFTVRSP |
| Ga0187780_101841812 | 3300017973 | Tropical Peatland | DEIALTNAEQTVVYFMVLHCTQSCYNADQTEINDVMSSFTVRSSS |
| Ga0187804_101711931 | 3300018006 | Freshwater Sediment | EVALTNADQTEVYLLVLHCTSTCYSNDQTEINDVMSSFTVRSSS |
| Ga0187805_101785602 | 3300018007 | Freshwater Sediment | ALTNADQTEVYLLVIHCTTACYSTDQAEINDVMTSFTIGSP |
| Ga0187851_104384971 | 3300018046 | Peatland | NGVTDTFDEIALTNPDQTEVYFLVLHCTSSCYSSDQTEINDVMSSFTIRSP |
| Ga0187766_104207561 | 3300018058 | Tropical Peatland | TNADQTEVYLLVLHCTSTCYSNNQTEINDVMSSFTIRSSS |
| Ga0187765_102902601 | 3300018060 | Tropical Peatland | DMDALTNTDQTVVYLLVIHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0187769_112998331 | 3300018086 | Tropical Peatland | IALTNADQTIVYFIVLHCTVSCYDSNQTEINDVMSSFTIRSP |
| Ga0181506_13670181 | 3300019260 | Peatland | LTNAEDTTVYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS |
| Ga0206354_107956512 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDTFDEVALTNADQTVVYLLVLHCTSSCYSNNQTEINDVMSSFTIRST |
| Ga0206353_117931462 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | QTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL |
| Ga0179590_10919732 | 3300020140 | Vadose Zone Soil | EVALTNADQTVVYLLVLHCTTSCYSSDQTEINDVMSSFTIRST |
| Ga0210403_102027571 | 3300020580 | Soil | NADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRST |
| Ga0210408_100949922 | 3300021178 | Soil | TNADQTVVYLLVLHCTTSCYSTDQTEINDVMSSFTIRSQ |
| Ga0210408_113908892 | 3300021178 | Soil | QSIVYLLVLHCTSSCYNSDQNVINDVMSSFTIRSPG |
| Ga0213876_104887322 | 3300021384 | Plant Roots | ALTNADQTVVYLLVLHCTSSCYSNDQTQINDVMSSFTIRSS |
| Ga0210385_104446231 | 3300021402 | Soil | QTSVYLLVLHCTTSCYSRDQTQINDVMSSFTIRSQQ |
| Ga0210385_113524341 | 3300021402 | Soil | TNAEDTVVYFMVLHCTTSCYSSDQTQINDVMSSFTIRSSS |
| Ga0210385_113971102 | 3300021402 | Soil | QADTFDEIVLTNADQTEVYMLVLHCTTACYSQDQTQINDVMTSFTIRSS |
| Ga0210384_109406321 | 3300021432 | Soil | GPTDTFDEIALTNAEQTVIYFLVLHCTSSCYSSDQTAINDVMSSFTIRSSS |
| Ga0210392_113670601 | 3300021475 | Soil | DTVVYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS |
| Ga0210402_119368432 | 3300021478 | Soil | TFEGGPTDTFDEIALTNAEDTVVYFMVLHCTTSCYSTDQTAINDVMSSFTIRSSS |
| Ga0126371_107143491 | 3300021560 | Tropical Forest Soil | TFDEVALTNADQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0242641_10389011 | 3300022499 | Soil | KQADTFDEIVLTNADQTEVYLLVLHCTTACYSQDQTQINDVMTSFTIRSS |
| Ga0222728_11241582 | 3300022508 | Soil | DTFDEIALTNAEDTLVYFMVLHCTTSCYSTDQPAINDVMSSFTIRSTS |
| Ga0242659_10085902 | 3300022522 | Soil | FDEIALTNAEDTVVYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS |
| Ga0242664_10215721 | 3300022527 | Soil | NITDTFDEVALTNADQTVVYLLVLHCTASCYSNDQTEINDVMSSFTIRST |
| Ga0242669_11181841 | 3300022528 | Soil | LTNAEDTVVYFMVLHCTTSCYSSDQKQINDVMSSFTIRSSS |
| Ga0242660_11168072 | 3300022531 | Soil | DEVALTNANQTVVYLLVLHCTTNCYSTDQTQIDDVMSSFTIRSS |
| Ga0242655_101302702 | 3300022532 | Soil | NAEDTVVYFMVLHCTTSCYSSNQTQINDVMSSFTIRSSS |
| Ga0242662_100883721 | 3300022533 | Soil | NADQTVVYLLLLHCTTSCYSSDQSEINDVMSSFTIRSS |
| Ga0222756_10113591 | 3300022709 | Soil | QTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP |
| Ga0242653_11074331 | 3300022712 | Soil | AEQTVVYFRSPDCTESGYSSDQTAINDVMSSFTIRSSS |
| Ga0242677_10252781 | 3300022713 | Soil | LTNAEDTVVYFMVLHCTTSCYSSNQTQINDVMSSFTIRSSS |
| Ga0242671_11032602 | 3300022714 | Soil | PTDTFDEIALTNAEDTVVYFMVLHCTTSCYSSDQTQINDVMSSFTIRSSS |
| Ga0242661_10239041 | 3300022717 | Soil | EVALTNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSPS |
| Ga0242675_10337152 | 3300022718 | Soil | DEIALTNAEDTTVYFMVLHCTTSCYSTDQTQINDVMSSFTIRSSS |
| Ga0242675_10552642 | 3300022718 | Soil | DTFDEIALTNAEQTVVYFLVLHCTVSCYSSDQTAINDVMSSFTIRSSS |
| Ga0242666_11620052 | 3300022721 | Soil | DQTDIYLIVVHCKASCYSSEKTQINDVMSSFTIRSS |
| Ga0247672_11000312 | 3300024187 | Soil | TFDEVALTNADQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL |
| Ga0207639_109189171 | 3300026041 | Corn Rhizosphere | FDEVALTNADQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL |
| Ga0209838_10119381 | 3300026214 | Soil | KGVTDTFDEIALTNPDQTKVYFLVLHCTSSCYSSDKTEINDVMSSFTIRSP |
| Ga0207949_10290832 | 3300026999 | Forest Soil | YAGMADTFDVVALTNADVTKLYLLVLHCTTTCYSNDQTAINDVMSSFTIGSP |
| Ga0208724_10064082 | 3300027064 | Forest Soil | DYTLQGATDTFDEIALTNAEDTVVYFMVLHCTASCYSTDQTEINDVMSSFTIRSSS |
| Ga0209115_11240361 | 3300027567 | Forest Soil | QTDIYLIVVHCKASCYSSEKTQINDVMSSFTIRSS |
| Ga0208324_11910091 | 3300027604 | Peatlands Soil | NADQTVVYLLVLHCTASCYSNDQTEINDVMSSFTIRSP |
| Ga0208827_11029752 | 3300027641 | Peatlands Soil | DPGVASDTFDEVALTNADQTEVYLLVIHCTTACFSTDQAEINDVMTSFTIGSP |
| Ga0209139_100958341 | 3300027795 | Bog Forest Soil | NAEDTVIYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS |
| Ga0209167_105067532 | 3300027867 | Surface Soil | DQTVVYLLVLHCTTGCYSADQSQINDVMTSFTIRSS |
| Ga0209169_102747161 | 3300027879 | Soil | TFDEIALTNADQTDIYLIVVHCKASCYSSEKTQINDVMSSFTIRSS |
| Ga0209380_103697761 | 3300027889 | Soil | DEIALTNPDQTEVYFLVLHCTSSCYSSDQTEINDVMSSFTIRSP |
| Ga0209067_102480362 | 3300027898 | Watersheds | LTNADQTVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSP |
| Ga0209006_101398421 | 3300027908 | Forest Soil | TFDEIALTNAEDTVVYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS |
| Ga0302221_103009732 | 3300028806 | Palsa | TTVYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS |
| Ga0307292_101521572 | 3300028811 | Soil | NVTDTFDEVALTNADQTVVYLLVLHCTTKCYSNDQTEINDVMSSFTIRSL |
| Ga0308309_102498311 | 3300028906 | Soil | IALTNADQTDIYLIVVHCKASCYSSEKTQINDVMSSFTIRSS |
| Ga0222748_10146002 | 3300029701 | Soil | ADQTSVYLLVLHCTTTCYSHDQTQINDVMSSFTIRSQQ |
| Ga0222748_10468392 | 3300029701 | Soil | ADQTVVYLLVLHCTTACYSQDQTQINDVMTSFTIRSS |
| Ga0311368_110671151 | 3300029882 | Palsa | NGVTDTFDEIALTNPDQTVVYFLVLHCTSSCYSSDQTEINDVMSSFTIRSP |
| Ga0311352_113221672 | 3300029944 | Palsa | EDTSVYFMVLHCTTSCYSADQTEINDVMSSFTIRSSS |
| Ga0311339_102144401 | 3300029999 | Palsa | NAEDTTVYFMVLHCTTSCYSTDQTEINDVMSSFTIRSSS |
| Ga0311353_109300732 | 3300030399 | Palsa | EIALTNRAQSTVYLLVLHCTTSCYSSDQTQINDVMSSFTIRSP |
| Ga0210277_106287751 | 3300030528 | Soil | TDTFDEIALTNAEDTVIYFMVLHCTTSCYSSNQTQINDVMSSFTIRSSS |
| Ga0210277_108377522 | 3300030528 | Soil | ADQTEVYMLVLHCTTACYSQDQTQINDVMTSFTIRSS |
| Ga0210285_10370012 | 3300030535 | Soil | FDEIALTNPDQTEVYFLVLHCTSSCYSSDQTEINDVMSSFTIRSP |
| Ga0210271_108396611 | 3300030545 | Soil | TNPDQTEVYFLVLHCTSSCYSSDQTEINDVMSSFTIRSP |
| Ga0210252_105277181 | 3300030548 | Soil | TAEDTVVYFMVLHCTTSCYSTDQTQINDVMSSFTIRSS |
| Ga0210272_10042462 | 3300030573 | Soil | LTNAEDTVVYFMVLHCTTSCYSSNQKQINDVMSSFTIRSSS |
| Ga0210288_10882321 | 3300030575 | Soil | QSGGPTDTFDEIALTNAEDTVIYFMVLHCTTSCYSSDQTQINDVMSSFTIRSSS |
| Ga0210275_101016032 | 3300030578 | Soil | FDYTDGKQADTFDEIVLTNADQTEVYLLVLHCTTACYSQDQTQINDVMTSFTIRSS |
| Ga0210276_108225971 | 3300030595 | Soil | TVVYLLVLHCTTSCYSNDQTEINDVMSSFTIRSPQ |
| Ga0210278_12085472 | 3300030596 | Soil | DQTEVYLLVLHCTTACYSQDQTQINDVMSSFTIRSS |
| Ga0210254_113078731 | 3300030602 | Soil | QTQVYFLVLHCTSSCYSSDKTEINDVMSSFTIRSP |
| Ga0210253_104602262 | 3300030603 | Soil | DTVVYFMVLHCTTSCYSTDQTAINDVMSSFTIRSSS |
| Ga0210251_112664291 | 3300030624 | Soil | TNAEDTTVYFMMLHCTTSCYSADQTEINDVMSSFTIRSSS |
| Ga0210291_112410171 | 3300030626 | Soil | YTDPGVATDTFDEIALTNADQTEVYLLVIHCTTACYSNDQAEINDVMTSFTIGSP |
| Ga0210269_101744072 | 3300030627 | Soil | YTGGITDTFDEVALTNADQTVVYLLVLHSTTRCYSNDQTEINDVMSSFTIRSS |
| Ga0210250_111448522 | 3300030632 | Soil | PDQTEVYFLVLHCTSSCYSSDQTEINDVMSSFTIRSP |
| Ga0302311_105647762 | 3300030739 | Palsa | QTEVYFLVLHCTSSCYSSDQTEINDVMSSFTIRSP |
| Ga0265460_107148832 | 3300030740 | Soil | GSTDTFDEVALTNAGQTVVYLLVLHCTASCYSNDQTEINDVMSSFTIRSPQ |
| Ga0075374_113441981 | 3300030855 | Soil | TYTGGTTDTFDEIALTNADQTVVYLLVLHCTSSCYSNEQTEINDVMSSFTIRSP |
| Ga0074034_111517852 | 3300030950 | Soil | GGITDTFDEIALTNADQTVVYLLVLHCETSCYSHAQTEINDVMSSFTIRSSS |
| Ga0075395_114573202 | 3300030973 | Soil | FTGGVTDTFDEVALTNRSSTVVYLLVLHCTSSCYSSDKTEINDVMSSFTIRSS |
| Ga0170820_146695961 | 3300031446 | Forest Soil | TDTFDEVALTNASSTFVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0318574_103507091 | 3300031680 | Soil | LNGGQTDTFDEIALTNAEQTIVYFMVLHCTTSCYTADQTAINDVMSSFTIRSSS |
| Ga0310686_1045179651 | 3300031708 | Soil | QTEVYLLVIHCTTSCYSNYQTEINDVMSSFTVRSSS |
| Ga0306918_114044681 | 3300031744 | Soil | DTFDEIALTNAEQTVVYFLVLHCTESCYSSDQTAINDVMSSFTIRSSS |
| Ga0318494_108923842 | 3300031751 | Soil | DTFDEVALTNADQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0307477_107224961 | 3300031753 | Hardwood Forest Soil | TNAEDTVVYFMVLHCTNSCYSTDQTEINDVMSSFTIRSSS |
| Ga0318526_103484531 | 3300031769 | Soil | ADQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0318521_102749592 | 3300031770 | Soil | DQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0318546_105273691 | 3300031771 | Soil | AFTGGITDTFDEVALTNADQTVVYLLVLHCTSSCYSGDQTEINDVMSSFTIRSS |
| Ga0318547_106339231 | 3300031781 | Soil | NAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0318568_106353801 | 3300031819 | Soil | DQTVVYLLVLHCTSSCYSNDQTEINDVMSSFTIRSS |
| Ga0316049_1220731 | 3300031866 | Soil | DEIALTNAEDTVVYFLVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0318520_104868541 | 3300031897 | Soil | IALTNAVQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0310916_110376201 | 3300031942 | Soil | ALTNADQTVVYLLVLHCTSSCYSGDQTEINDVMSSFTIRSS |
| Ga0310916_113497081 | 3300031942 | Soil | YTLNGSQTDTFDEIALTNAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0318530_104746562 | 3300031959 | Soil | NGSQTDTFDEIALTNAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0307479_111426832 | 3300031962 | Hardwood Forest Soil | AEDTVVYFMVLHCTNSCYSTDQTEINDVMSSFTIRSSS |
| Ga0318562_103945242 | 3300032008 | Soil | LNGSQTDTFDEIALTNAEQTIVYFMVLHCTTSCYTADQTAINDVMSSFTIRSSS |
| Ga0318562_107538822 | 3300032008 | Soil | FDEVALTNADQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0318563_106113301 | 3300032009 | Soil | TDTFDEIALTNAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0318507_100419141 | 3300032025 | Soil | QTVVYLLVIHCTTSCYSNQQTDINDVMSSFTVRSP |
| Ga0318570_102679781 | 3300032054 | Soil | YTLNGSQTDTFDEIALTNAVQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0318533_111167961 | 3300032059 | Soil | DEVALTNADQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0318504_102387122 | 3300032063 | Soil | GTTDTFDEVALTNADQTVVYLLVLHCTSSCYSNDQTEINDVMSSFTIRSS |
| Ga0318504_103447532 | 3300032063 | Soil | TNAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0306924_110008712 | 3300032076 | Soil | SFTGGITDTFDEVALTNADQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0318518_103113101 | 3300032090 | Soil | TNADQTVVYLLVLHCTSSCYSSDQTEINDVMSSFTIRSS |
| Ga0307471_1023114152 | 3300032180 | Hardwood Forest Soil | YTFNGNVTDTFDEVALTNADQTVVYLLVLHCTAKCYSNDQTEINDVMSSFTIRSL |
| Ga0335085_103585852 | 3300032770 | Soil | NYTYTRGVTDTFDEVALTNADQTVVYLLVLHCTSSCYSNDQTEINDVMSSFTIRSS |
| Ga0335081_113837332 | 3300032892 | Soil | ADQTVVYLLVLHCTTKCYSSEQTEINDVMSSFTIRSL |
| Ga0335075_108688942 | 3300032896 | Soil | DTFDEVALTNAVQTEVYLLVLHCTSTCYQNDQTEINDVMSSFTIRSSS |
| Ga0335077_102993072 | 3300033158 | Soil | LTNADQTDIYLLVLHCKSSCYSSEKTQINDVMSSFTIRSS |
| Ga0318519_101903691 | 3300033290 | Soil | TLNGSQTDTFDEIALTNAEQTIVYFMVLHCTTSCYSNDQTAINDVMSSFTIRSSS |
| Ga0318519_105714582 | 3300033290 | Soil | TDTFDEVALTNADQTVVYLLVLHCTSSCYSGDQTEINDVMSSFTIRSS |
| Ga0370514_081191_2_112 | 3300034199 | Untreated Peat Soil | DQTEVYFLVLHCTSSCYSSDKTEINDVMSSFTIRSP |
| ⦗Top⦘ |