NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034281

Metagenome / Metatranscriptome Family F034281

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034281
Family Type Metagenome / Metatranscriptome
Number of Sequences 175
Average Sequence Length 42 residues
Representative Sequence MRADLVNYHSSRCARIRRICEDATTIRPEPSIRRNLFRLA
Number of Associated Samples 137
Number of Associated Scaffolds 175

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.43 %
% of genes near scaffold ends (potentially truncated) 80.57 %
% of genes from short scaffolds (< 2000 bps) 95.43 %
Associated GOLD sequencing projects 131
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.857 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.143 % of family members)
Environment Ontology (ENVO) Unclassified
(27.429 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(65.143 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.82%    β-sheet: 0.00%    Coil/Unstructured: 66.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 175 Family Scaffolds
PF00903Glyoxalase 19.43
PF12680SnoaL_2 5.71
PF02852Pyr_redox_dim 3.43
PF13577SnoaL_4 2.29
PF07681DoxX 1.71
PF06897DUF1269 1.71
PF03795YCII 1.14
PF07992Pyr_redox_2 1.14
PF12681Glyoxalase_2 1.14
PF08530PepX_C 1.14
PF13416SBP_bac_8 0.57
PF00210Ferritin 0.57
PF13649Methyltransf_25 0.57
PF02518HATPase_c 0.57
PF00857Isochorismatase 0.57
PF03928HbpS-like 0.57
PF13343SBP_bac_6 0.57
PF10604Polyketide_cyc2 0.57
PF00056Ldh_1_N 0.57
PF00561Abhydrolase_1 0.57
PF02668TauD 0.57
PF00378ECH_1 0.57
PF05199GMC_oxred_C 0.57
PF04480DUF559 0.57
PF13592HTH_33 0.57
PF13379NMT1_2 0.57
PF03479PCC 0.57
PF04392ABC_sub_bind 0.57
PF00196GerE 0.57
PF00072Response_reg 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 175 Family Scaffolds
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 1.71
COG4270Uncharacterized membrane proteinFunction unknown [S] 1.71
COG4803Uncharacterized membrane proteinFunction unknown [S] 1.71
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.14
COG2936Predicted acyl esteraseGeneral function prediction only [R] 1.14
COG0039Malate/lactate dehydrogenaseEnergy production and conversion [C] 0.57
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.57
COG1486Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolaseCarbohydrate transport and metabolism [G] 0.57
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.57
COG1661Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domainGeneral function prediction only [R] 0.57
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.57
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.57
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.57

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.86 %
UnclassifiedrootN/A5.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001686|C688J18823_10000634All Organisms → cellular organisms → Bacteria → Proteobacteria20517Open in IMG/M
3300004092|Ga0062389_102256436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002717Open in IMG/M
3300005436|Ga0070713_100359944All Organisms → cellular organisms → Bacteria → Proteobacteria1352Open in IMG/M
3300005538|Ga0070731_10553783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300005542|Ga0070732_11017072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002507Open in IMG/M
3300005591|Ga0070761_11015722All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005712|Ga0070764_10748136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002605Open in IMG/M
3300005921|Ga0070766_10470664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002832Open in IMG/M
3300005921|Ga0070766_11219959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002521Open in IMG/M
3300006028|Ga0070717_10829201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria841Open in IMG/M
3300006059|Ga0075017_101080028All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006086|Ga0075019_10216071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021137Open in IMG/M
3300006175|Ga0070712_100089161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2255Open in IMG/M
3300006176|Ga0070765_101200219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002716Open in IMG/M
3300006358|Ga0068871_101774031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium586Open in IMG/M
3300006893|Ga0073928_10469100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002908Open in IMG/M
3300007265|Ga0099794_10503513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002637Open in IMG/M
3300009824|Ga0116219_10635740All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300010154|Ga0127503_10277867Not Available1240Open in IMG/M
3300010343|Ga0074044_10636130All Organisms → cellular organisms → Bacteria → Proteobacteria696Open in IMG/M
3300010366|Ga0126379_10260105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1716Open in IMG/M
3300010371|Ga0134125_12508681All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300010376|Ga0126381_103952330All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → unclassified Dyella → Dyella sp. C11577Open in IMG/M
3300010379|Ga0136449_104042334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002547Open in IMG/M
3300012469|Ga0150984_114599842Not Available1101Open in IMG/M
3300012955|Ga0164298_10554111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300012957|Ga0164303_11151065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002564Open in IMG/M
3300012985|Ga0164308_11384413All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → unclassified Dyella → Dyella sp. C11642Open in IMG/M
3300012988|Ga0164306_11191732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002638Open in IMG/M
3300012989|Ga0164305_11212088All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300013306|Ga0163162_13490029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002500Open in IMG/M
3300014155|Ga0181524_10379826All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300014162|Ga0181538_10445267All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300014200|Ga0181526_10798880All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300014501|Ga0182024_10076736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5010Open in IMG/M
3300014501|Ga0182024_11613088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002735Open in IMG/M
3300014501|Ga0182024_12128345All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300014501|Ga0182024_12305686All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300014657|Ga0181522_10135201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1436Open in IMG/M
3300014968|Ga0157379_10717592Not Available939Open in IMG/M
3300015371|Ga0132258_13942463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1008Open in IMG/M
3300015372|Ga0132256_102267561All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300015373|Ga0132257_103469480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002574Open in IMG/M
3300016294|Ga0182041_10886150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002802Open in IMG/M
3300016319|Ga0182033_10813652Not Available824Open in IMG/M
3300016319|Ga0182033_11294186All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300016319|Ga0182033_11402407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002629Open in IMG/M
3300016319|Ga0182033_11890296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002543Open in IMG/M
3300016341|Ga0182035_12131952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002509Open in IMG/M
3300016371|Ga0182034_10534864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002982Open in IMG/M
3300016371|Ga0182034_11008218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002719Open in IMG/M
3300016371|Ga0182034_11405190All Organisms → cellular organisms → Bacteria → Proteobacteria610Open in IMG/M
3300016404|Ga0182037_10866795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002782Open in IMG/M
3300017822|Ga0187802_10219626All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300017822|Ga0187802_10346305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002583Open in IMG/M
3300017823|Ga0187818_10300828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002704Open in IMG/M
3300017937|Ga0187809_10156565Not Available791Open in IMG/M
3300017943|Ga0187819_10869955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002505Open in IMG/M
3300017959|Ga0187779_10358910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300017970|Ga0187783_10504607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense877Open in IMG/M
3300017970|Ga0187783_11115733All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300017970|Ga0187783_11332697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002517Open in IMG/M
3300017970|Ga0187783_11397457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002504Open in IMG/M
3300017972|Ga0187781_10773327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002696Open in IMG/M
3300017972|Ga0187781_11480913All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300017974|Ga0187777_10214269All Organisms → cellular organisms → Bacteria → Proteobacteria1300Open in IMG/M
3300017974|Ga0187777_10725828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002706Open in IMG/M
3300017974|Ga0187777_10955921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002618Open in IMG/M
3300017974|Ga0187777_10997595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002606Open in IMG/M
3300017975|Ga0187782_10346453Not Available1124Open in IMG/M
3300017975|Ga0187782_10383540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021067Open in IMG/M
3300017975|Ga0187782_11139951All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300017975|Ga0187782_11285450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002574Open in IMG/M
3300018019|Ga0187874_10143254All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300018047|Ga0187859_10040313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2499Open in IMG/M
3300018060|Ga0187765_11234031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002526Open in IMG/M
3300018085|Ga0187772_10061390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2338Open in IMG/M
3300018085|Ga0187772_10713350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002720Open in IMG/M
3300020580|Ga0210403_11093921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002619Open in IMG/M
3300020580|Ga0210403_11188192All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300020582|Ga0210395_10285969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1240Open in IMG/M
3300021171|Ga0210405_10003303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales15920Open in IMG/M
3300021178|Ga0210408_10522146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002943Open in IMG/M
3300021178|Ga0210408_11053975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales627Open in IMG/M
3300021402|Ga0210385_11154785All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300021403|Ga0210397_10030410All Organisms → cellular organisms → Bacteria → Proteobacteria3366Open in IMG/M
3300021403|Ga0210397_11102028All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300021405|Ga0210387_11459029All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300021406|Ga0210386_10414212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021162Open in IMG/M
3300021406|Ga0210386_11479153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002567Open in IMG/M
3300021407|Ga0210383_11542115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002548Open in IMG/M
3300021420|Ga0210394_10351917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1294Open in IMG/M
3300021420|Ga0210394_11600833All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → unclassified Dyella → Dyella sp. C11548Open in IMG/M
3300021475|Ga0210392_10520669All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300021475|Ga0210392_10722083Not Available742Open in IMG/M
3300021477|Ga0210398_11209068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002597Open in IMG/M
3300021477|Ga0210398_11395522All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021478|Ga0210402_11589871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria581Open in IMG/M
3300021479|Ga0210410_10802727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002826Open in IMG/M
3300021479|Ga0210410_11166078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales661Open in IMG/M
3300021479|Ga0210410_11302620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002619Open in IMG/M
3300021559|Ga0210409_11313068All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300022557|Ga0212123_10435416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae869Open in IMG/M
3300024227|Ga0228598_1100428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002584Open in IMG/M
3300025914|Ga0207671_11490293All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300025916|Ga0207663_11412888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002560Open in IMG/M
3300025927|Ga0207687_11493100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales581Open in IMG/M
3300025939|Ga0207665_11640402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002509Open in IMG/M
3300025981|Ga0207640_12135858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002508Open in IMG/M
3300026035|Ga0207703_10866311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → unclassified Dyella → Dyella sp. C11864Open in IMG/M
3300026121|Ga0207683_11566737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium608Open in IMG/M
3300026446|Ga0257178_1056010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002520Open in IMG/M
3300027172|Ga0208098_1012243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002798Open in IMG/M
3300027297|Ga0208241_1061278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002600Open in IMG/M
3300027516|Ga0207761_1048009All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300027535|Ga0209734_1046125All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300027548|Ga0209523_1069259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002726Open in IMG/M
3300027604|Ga0208324_1143590All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300027768|Ga0209772_10079525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002994Open in IMG/M
3300027783|Ga0209448_10121631All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300027812|Ga0209656_10162650All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300027812|Ga0209656_10347034All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300027854|Ga0209517_10323646All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300027867|Ga0209167_10487651All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300027879|Ga0209169_10661076All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300027884|Ga0209275_10439085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae739Open in IMG/M
3300027884|Ga0209275_10627772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002617Open in IMG/M
3300027889|Ga0209380_10733692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002565Open in IMG/M
3300027889|Ga0209380_10862529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002510Open in IMG/M
3300027895|Ga0209624_11076557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002518Open in IMG/M
3300028023|Ga0265357_1000842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2036Open in IMG/M
3300028047|Ga0209526_10765561All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300028047|Ga0209526_10914788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002532Open in IMG/M
3300028718|Ga0307307_10271134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002544Open in IMG/M
3300028775|Ga0302231_10480935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002525Open in IMG/M
3300028792|Ga0307504_10217393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002685Open in IMG/M
3300028808|Ga0302228_10467701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002557Open in IMG/M
3300028906|Ga0308309_11067742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002698Open in IMG/M
3300029636|Ga0222749_10390510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002736Open in IMG/M
3300029882|Ga0311368_10236611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021421Open in IMG/M
3300029943|Ga0311340_11211883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002607Open in IMG/M
3300030503|Ga0311370_10392580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1748Open in IMG/M
3300030503|Ga0311370_11871735All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300030629|Ga0210268_1306103All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300030659|Ga0316363_10361295All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300030706|Ga0310039_10131303All Organisms → cellular organisms → Bacteria → Proteobacteria1025Open in IMG/M
3300030707|Ga0310038_10277594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002764Open in IMG/M
3300030707|Ga0310038_10512778All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300030760|Ga0265762_1183787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002516Open in IMG/M
3300030916|Ga0075386_11780674All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031057|Ga0170834_109240900Not Available527Open in IMG/M
3300031231|Ga0170824_106676264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002838Open in IMG/M
3300031236|Ga0302324_102839808All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031545|Ga0318541_10537125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002654Open in IMG/M
3300031545|Ga0318541_10636431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002596Open in IMG/M
3300031708|Ga0310686_103158877All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031715|Ga0307476_11097411Not Available584Open in IMG/M
3300031744|Ga0306918_10910496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002685Open in IMG/M
3300031747|Ga0318502_10692335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002616Open in IMG/M
3300031754|Ga0307475_10861927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei716Open in IMG/M
3300031781|Ga0318547_10694555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002632Open in IMG/M
3300031819|Ga0318568_10896596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002549Open in IMG/M
3300031823|Ga0307478_11281760All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300031941|Ga0310912_10189870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021567Open in IMG/M
3300031945|Ga0310913_10550534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002819Open in IMG/M
3300032063|Ga0318504_10666693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002501Open in IMG/M
3300032066|Ga0318514_10530236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium627Open in IMG/M
3300032076|Ga0306924_10789483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021059Open in IMG/M
3300032174|Ga0307470_10430315All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300032174|Ga0307470_11928885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002503Open in IMG/M
3300032205|Ga0307472_100789565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales866Open in IMG/M
3300032783|Ga0335079_11951243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002567Open in IMG/M
3300032829|Ga0335070_11118886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002724Open in IMG/M
3300032893|Ga0335069_12066993All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300033829|Ga0334854_026318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021403Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland10.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.14%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.57%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.43%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.86%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.29%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.29%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.14%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.14%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.14%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.14%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.14%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.57%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.57%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.57%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.57%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026446Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-BEnvironmentalOpen in IMG/M
3300027172Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J18823_10000634143300001686SoilMHADLENYHSSRYGHTRRISEDAATILRGPSIPHNLFRLVWLPG*
Ga0062389_10225643623300004092Bog Forest SoilMRADLANYHNSRYDHTVRIGEDGTTNRRSLGIRRNLFRLA
Ga0070713_10035994453300005436Corn, Switchgrass And Miscanthus RhizosphereDVSMHADLVNYHSSRRDRIRRICEDETTICPEPNIRRNLFRLAWPPG*
Ga0070731_1055378323300005538Surface SoilMRADWVKHHSTLYDRIRRICADATTIRPEPSILRNLFRLVRPLG*
Ga0070732_1101707213300005542Surface SoilVNYHSSRCTRIRRIGEDETTIHPKPSIRRNLFRLAW
Ga0070761_1101572223300005591SoilHAGLANYRSSRCDRIRRIGEDETTIRPRLNIRRNLFRSA*
Ga0070764_1074813613300005712SoilMHADLVNCHSSRCDRIRRICEDETTIRPRLSIRRNLFRSA*
Ga0070766_1047066413300005921SoilMHADLVSCHSSRCDRIARIGEDETTIRPRLSIRRNLF
Ga0070766_1121995913300005921SoilMHADLVNYRSSRCDRIARICEDETTIRPRPSIRRNLFRSA
Ga0070717_1082920123300006028Corn, Switchgrass And Miscanthus RhizosphereMHADLVNYHNNRCDRIRHICEDGTTIRLEPNIRRNPFRLAWLRG*
Ga0075017_10108002813300006059WatershedsVSMHADLVNYHSSRCDRIGRICEDATTIRPEPSIRRNLFRLAWPLG*
Ga0075019_1021607123300006086WatershedsMHADLVNYRSSRYARIRRICGDGTTIRPEPSIRHNLFRSARLPG*
Ga0070712_10008916133300006175Corn, Switchgrass And Miscanthus RhizosphereMRADLVKYHSSRCDRIRRICEDETTIRPEPSIRRNLFRLAWPLG*
Ga0070765_10120021923300006176SoilMHADLANYHSSRCDRIRRIGADETTIRPRLSIRRNLFR
Ga0068871_10177403113300006358Miscanthus RhizosphereHSSRCDRIRHICEDETTIRQQPSIPRNPFRLAWPRG*
Ga0073928_1046910013300006893Iron-Sulfur Acid SpringMHADLANYRSSRCDRIARIGEDETTIRPRLSIRRNLFRSA*
Ga0099794_1050351313300007265Vadose Zone SoilMHADLVNYHSSRCDRIRRICEDETTICRETGIRRSLCRL
Ga0116219_1063574013300009824Peatlands SoilVSMHADLVNYHSSRCDRIRRICEDATTIRPRLSIRRNLFRLAWPPG*
Ga0127503_1027786713300010154SoilNVSMHADLVNYHSSRRDHIRRICEDETTIRPAPSIRRNLFRSA*
Ga0074044_1063613013300010343Bog Forest SoilSGDSQPRYASMHADLVNHHNSRCDRIRRICEDAATIGPKPSTRRNLVRLA*
Ga0126379_1026010513300010366Tropical Forest SoilRSVSMHADLVNCHNIRCDRIQHICEDETTIRLNPSIRRNLFRLAWLRD*
Ga0134125_1250868123300010371Terrestrial SoilDVSMHADLVNCRSSRCDHTRRICEDETTIRREPGIQRSLFRLASLPG*
Ga0126381_10395233023300010376Tropical Forest SoilNCHNNRCDRIQHICEDETTIRLNPSIRRNLFRLAWLRD*
Ga0136449_10404233413300010379Peatlands SoilMHADLENYHSSRCDRIRRICEDETTIRPRLSIRRNLFRLAWPLG*
Ga0150984_11459984233300012469Avena Fatua RhizosphereRNVSMHADLVNYRSSQYARIRRICGDGTTIRPEPSIRHNLFRSARLPG*
Ga0164298_1055411113300012955SoilLVNYRSSRYARIRRICGDGTTIRPEPSIRHNLFRSARLPG*
Ga0164303_1115106513300012957SoilMHADLVRYHNSRCDRTRRICEDATTNRQSPSTQHNLYHLAW
Ga0164308_1138441313300012985SoilRRNVSMHADLVNYRSSRYARIRRICGDGTTIRPEPSIRHNLIRSARLPG*
Ga0164306_1119173213300012988SoilMHADSVNYRSSRYARIRRICGDGTTIRPEPSIRHNL
Ga0164305_1121208823300012989SoilNYHNNRCDRIRHICEDETTIRLALSIRRNPFRLAWLRG*
Ga0163162_1349002923300013306Switchgrass RhizosphereRRDVSMRADLVNYHSSRRDRIRRICEDETTNRPALSIRRNLFRSA*
Ga0181524_1037982623300014155BogRRDVSMHADLVNYHSSRCDRIRRICEDATTIRPRLSIRRNLFRLAWPPG*
Ga0181538_1044526723300014162BogADLVNYRSSRCDRIRRICEDAATIRPEPCIRRSLFRLASPLD*
Ga0181526_1079888023300014200BogVSMHADLVNYHSSRCDRIGRICEDATTIGPKPSIRRNLFRSAWPPG*
Ga0182024_1007673653300014501PermafrostMHADLVNYHSSQCDRIGRIGEDETTIGPKPGIRRNLLRSA*
Ga0182024_1161308813300014501PermafrostMHAVVVNYRSSRCDRIERIGEDETTIRPEPSIRRNLFRSAWPPG*
Ga0182024_1212834513300014501PermafrostADLANYHSSRCDRIRRICEDVTTIRPEPSIPRNLFRLAWPLGLYHP*
Ga0182024_1230568613300014501PermafrostDLVNYHSSRCARIRRICEDAATIGPKPSIRRNLFRLA*
Ga0181522_1013520143300014657BogVHADLVNYHSSRCARIRRISEDAATIGRKPSIRHNLFRLA*
Ga0157379_1071759213300014968Switchgrass RhizosphereGSVNYHSSRCYRIRRICEDETTTRPEPSIRRNLFRLVWSLG*
Ga0132258_1394246313300015371Arabidopsis RhizosphereRRNVSMHVDLVNYRSSRYARIRRICGDGTTIRPEPSIRHNLFRSVRPPD*
Ga0132256_10226756123300015372Arabidopsis RhizosphereDLVNYRSSRCDRIRRICEDATTIGPELSIRRNLFRLA*
Ga0132257_10346948023300015373Arabidopsis RhizosphereMHADLVNCHNNRCDRIQHICEDETTIRLNPSIRRNLFRLAWLRD*
Ga0182041_1088615013300016294SoilMHADLVKCHSSRCDRIRRICEDATTIRPEPSIRHNLFR
Ga0182033_1081365213300016319SoilMHLVNYQNNRCDRIRHICEDETSIRLERSIRRDPLRLAWL
Ga0182033_1129418623300016319SoilMHADLVNYHSSRCARIRRIGEDETTIRLEPSIRRSLFRSA
Ga0182033_1140240723300016319SoilMYADLVNYHSSRCGRIRRICGDETTIRQEPSIRRNLFRLAWP
Ga0182033_1189029623300016319SoilMHADLVKNHSSRCARIRRICEDAATTRPQPSIRRNQFRLA
Ga0182035_1213195213300016341SoilMHAGSVNYHNNRCDRIRHICEDGTTIRLEPNIRRNPFRLAWLRG
Ga0182034_1053486423300016371SoilMHADLVKNHSSRCVRIQRICEDAATTRPRPSIRRNQFRLA
Ga0182034_1100821813300016371SoilMHADLVNYHSSRCARIRHICEDATTIRPEPSIRRNLFRLA
Ga0182034_1140519023300016371SoilDVSMHADLVNCHSSRRVRILRICEDATTIRPELSIRRSLFRSASLLD
Ga0182037_1086679513300016404SoilMHADLVKCHSSRCDRTRRICEDATTIRPEPSIRHNLFRWAW
Ga0187802_1021962623300017822Freshwater SedimentVKYHSSRCDRIRRICEDATTIRPEPGIRRSPFRSAWPLG
Ga0187802_1034630523300017822Freshwater SedimentMHVDLVSYHSSRCAHIRRICEGGTTIRRQLSIRHNLFRS
Ga0187818_1030082823300017823Freshwater SedimentMHADLVSYHSSRRDRIGRICEDATTIRPEPCIRRNLF
Ga0187809_1015656533300017937Freshwater SedimentADLVKYHSSRCDRIRRICEDETTTRPEPNIRRDLFRLVWSLG
Ga0187819_1086995513300017943Freshwater SedimentMHADLVNCHNNRCDRIGRICEDATTIRLKPSIRRNRFRLAWLRG
Ga0187779_1035891023300017959Tropical PeatlandANYHNSRCDRSRRICEDETTIGPKLGIQRNLLRLP
Ga0187783_1050460713300017970Tropical PeatlandQHNVSMHADLVKYRSSRCGRIRRICEDATTIRPEPGIRRSPFRSA
Ga0187783_1111573323300017970Tropical PeatlandVNYRSSRCARIRRICEDATTIRAETGIRRNLFRLAGLLG
Ga0187783_1133269713300017970Tropical PeatlandPWQRYVSTHADLVNYHSSRCDRIGRIYEDETTIRPEPSIRRNLFHLAWPLG
Ga0187783_1139745713300017970Tropical PeatlandMHVDLVNCHSSRCDRIRRNGADGTTIPPALGTRRNL
Ga0187781_1077332713300017972Tropical PeatlandMHVGLVNYHSNRCARIRRICEGETTTRPEPSIRRNLFRSAWP
Ga0187781_1148091323300017972Tropical PeatlandVSMRADLVNYHSSRCARIRRICEDATTIRPEPSIRRNLFRLVRPLG
Ga0187777_1021426933300017974Tropical PeatlandMHADLVNYRSSRYARIRRICEDATTIGPEPSIRRNLFRLAWLLG
Ga0187777_1072582823300017974Tropical PeatlandMHAGLANYHSSRYGRIRRICEDVTTIRPGPRIRRS
Ga0187777_1095592113300017974Tropical PeatlandMHADLVKYHSSRYGRIRRICEDVTTIRPGPRIRRSLFRSA
Ga0187777_1099759513300017974Tropical PeatlandMRADLVNYHSSRCARIRRICEDATTIRPEPSIRRNLFRLA
Ga0187782_1034645313300017975Tropical PeatlandMHADLVKYHNSRCDRIRRICEDATTIRLEPSIRRNLFRLA
Ga0187782_1038354013300017975Tropical PeatlandMHADSVNYRNNQCDRIRRICADETTIRPQQSIRRSPF
Ga0187782_1113995123300017975Tropical PeatlandDASTHADLAKYHSSRCDRTRRTGEDEATTRLQLSIRRNPFRWALPRG
Ga0187782_1128545013300017975Tropical PeatlandMHADLVKYRSSRYDRTRRICEDATTIRPEPSIRRNL
Ga0187874_1014325433300018019PeatlandMHADLVNYHSSRCDRIRRICEDETTIRPRLSIRRNLFHSARLPG
Ga0187859_1004031343300018047PeatlandMHADLVNYHSSRCDRIRRICEDATTIRPRLSIRRNLF
Ga0187765_1123403113300018060Tropical PeatlandMHADLVNCHSSRRVRILRICEDATTIRPGRGIRHTLFRSAWPPG
Ga0187772_1006139013300018085Tropical PeatlandYVSMHADVVNYHSSRCARIGRTCEDETTIRPEPGIRRNLFRSA
Ga0187772_1071335023300018085Tropical PeatlandMHADLVNYHNNRCDRIRHICEDATTIRLEPSIRRNPFRLAWLRG
Ga0210403_1109392113300020580SoilMHADLVKYHSSRCDRIRRICEDATTIRPEPGIRRSLFHWA
Ga0210403_1118819213300020580SoilRDVSMHADLVKYHSSRCDRIRRICEDATTIRPEPGIRRSLFRSAWPPG
Ga0210395_1028596913300020582SoilMHADLVNYRSSRCDRIARTGEDETTIRPRRSIRRNLFRSAWLPD
Ga0210405_1000330333300021171SoilMHADLANYRSSRCDRIARIGEDETTIRPRLSIRRNLFRSA
Ga0210408_1052214613300021178SoilMHADLANYHSSRCDHIRHICEDATTNRLQPSIRRNLF
Ga0210408_1105397523300021178SoilDLVNHHSSRCDHIRRICEDATTIHPEPSIRRNLFRLALPLG
Ga0210385_1115478523300021402SoilRRYGSTHADLVNYHNSRCIRIRRIGEDETTIRPKPSIRRNLFR
Ga0210397_1003041013300021403SoilVNYRSSRCDRIARICEDETTIRPKPRIRRNPFRLAQPPG
Ga0210397_1110202813300021403SoilMHADLVNYHNNRCDRIPHICEDGTTIRPQTSIRSNPSRL
Ga0210387_1145902913300021405SoilLVNYRSIRCDRIARNGEDETTIRPRPSIRRNLFRSAWLPG
Ga0210386_1041421213300021406SoilMHADLVKYHSSRCARIRHICEDAATTRRQPSIRRNPFRSAW
Ga0210386_1147915323300021406SoilMHADLVNYHSSRCDHIRRICEDATTTRPEPGIRRNPLRLA
Ga0210383_1154211523300021407SoilMHAGLANYRSSRCDRIARIGADETTIRPRRSIRRNLFRSAW
Ga0210394_1035191713300021420SoilYVSMHADLVKYHSSRCDRIRRTCEDATTMRPEPGIRRNLFRSAWPLD
Ga0210394_1160083323300021420SoilRDVSMHADLVNYHSSRCDRIRRICEDETTIRPEPSIRRNLFHLAWPLG
Ga0210392_1052066913300021475SoilMHADLVKCHSSRRDRIGRICEDATTIRPEPSIRRNLFRLAWPLG
Ga0210392_1072208313300021475SoilYVSMHADLVKYHSSRCDRIRRICEDETTTRPEPNIRRNRFRLFWSLG
Ga0210398_1120906813300021477SoilMHADLANCHSSRCDRIRRICADETTIRPRLSIRRNLCRSA
Ga0210398_1139552213300021477SoilMHADLVNYRSSRCDRIARIGEDETTIRPRRSIRRNLFRSA
Ga0210402_1158987113300021478SoilMHADLVNCRSSRCARIRPIGEDATTMRAEPSIRRNLFRLA
Ga0210410_1080272713300021479SoilMHADLVNCRSSRCDRIARIGEDETTIRPRLSIRRILFRSA
Ga0210410_1116607823300021479SoilMHADLVNHHSSRCDHIRRICEDATTIHPEPSIRRNLFRLALPLG
Ga0210410_1130262013300021479SoilMHADLVNCHSSRCDRIARIGEDETTIRPRLSIRRNLFRS
Ga0210409_1131306823300021559SoilMHADLVNCHSSRCDRIARIGEDETTIRPRLSIRRNLFRSA
Ga0212123_1043541613300022557Iron-Sulfur Acid SpringYVSMHVDLVNYHSSRCDRIQHTCEDAATIHPQPGIRRNLFRLAWPLG
Ga0228598_110042813300024227RhizosphereMHADLVNYHNNQCDRIRHICEDATAIRPEPSIRRNPFRSAWL
Ga0207671_1149029313300025914Corn RhizosphereSMHADLVKYHSSRCDRIRHICEDAATTRLQPSIRRNPFRLARLRG
Ga0207663_1141288813300025916Corn, Switchgrass And Miscanthus RhizosphereMRADLVKYHSSRCDRIRRICEDETTIRPEPSIRHTLFRLAW
Ga0207687_1149310033300025927Miscanthus RhizosphereVNCRSSRCGHTRRICEDETTIRREPGIQRSLFRLASLPG
Ga0207665_1164040213300025939Corn, Switchgrass And Miscanthus RhizosphereMHADLVNYHSSRCDHIRRICEDATTIRPEPGIQRSLF
Ga0207640_1213585813300025981Corn RhizosphereMHADLVNCRSSRCDRIRRICEDETTICLGLCIRRNLFRLARPLR
Ga0207703_1086631113300026035Switchgrass RhizosphereSTHADLVNYRSSRCDRIRRICEDETTIRPEPSTRRNLFRLAWPLG
Ga0207683_1156673713300026121Miscanthus RhizosphereSPRYASLHADWVTYHSSRCDRIRHICEDETTIRQQPSIPRNPFRLAWPRG
Ga0257178_105601013300026446SoilMHADLVNYHSSRCDRIRRICEDETTICRETGIRRS
Ga0208098_101224313300027172Forest SoilMHADLASYRSSRCDRIARIGEDETTIRPRLSIRRNLFRSAWLPG
Ga0208241_106127813300027297Forest SoilMHADLVKYHSSRRARIRHICEDAATTRPQPSIRRNPFRLA
Ga0207761_104800923300027516Tropical Forest SoilYVSMHADLVKCHSSRCDRIRRICEDATTIRPELSIRHNLSRLAWPLG
Ga0209734_104612533300027535Forest SoilDPSQRYVSMHADWVNYHNSRCDRIRRIGEDETTIRPQPSIRRNPFRLAWLRG
Ga0209523_106925923300027548Forest SoilMHADLVNYHSSRYDRIRRICEDATTIHPGPGIRRSPFRSA
Ga0208324_114359013300027604Peatlands SoilRRDVSMRADLVNYHSSRCDRIQRICEDATTIRPEPSIRRNLFRWAWPLG
Ga0209772_1007952523300027768Bog Forest SoilMHADLVNYHSSRCARIRRIYEDATTIGPKPGIRRNPFRLALLPD
Ga0209448_1012163113300027783Bog Forest SoilRRNVSIHADLVNYRSSQCDRIRRICEDETTIRPRLSTRRNLFRSAWPPS
Ga0209656_1016265023300027812Bog Forest SoilMHADLVKYHSSQCDRIRRICEDDTTIRPEPSIRRNLFRLAWPLD
Ga0209656_1034703413300027812Bog Forest SoilADSVNYHSSRCARIRRICEDATTIGPEPSIRRNLFRLA
Ga0209517_1032364633300027854Peatlands SoilDLANCRSSRCDRIRRICEDETTIRPRLSIRRNLFRLAWLPG
Ga0209167_1048765113300027867Surface SoilHADLVSYRSSRYARIRRIGEGETTIGPKPGNQRNLFRSAWRPD
Ga0209169_1066107613300027879SoilCVSLHAELVRYHSSRCDRIRRIGEDATTIRPQPSIRRNLFRLAWPLG
Ga0209275_1043908523300027884SoilMHADLVSCHSSRCDRIARIGEDETTIRPRLSIRRNLFRSA
Ga0209275_1062777213300027884SoilMHADLANYRSSRCDRIARIGEDETTSRLRLSIRRNLFRSA
Ga0209380_1073369213300027889SoilMHADLVSCHSSRCDRIARIGEDETTIRPRLSIRRNLFHSA
Ga0209380_1086252923300027889SoilMHADLVNYHSSRCDRIARIGEDETTSRPRLSIRRN
Ga0209624_1107655713300027895Forest SoilMHADLVNYHSSRCDRIRRICEDATTICPELSTRRNLFRLA
Ga0265357_100084233300028023RhizosphereMRADLASYRSSRCDRIARIGEDETTIRPRLSIRRNLFRSA
Ga0209526_1076556113300028047Forest SoilVNYHSSRRDRIRRTCEDETTIRPAPSIRRNLFRSA
Ga0209526_1091478823300028047Forest SoilMHADLVNCHSSRRDRIRRICADETTIRPRLSIRRN
Ga0307307_1027113413300028718SoilMRADLLNYHSSRCDRIRRICEDATTIRPEPSIRRNLFRLA
Ga0302231_1048093523300028775PalsaMHADLVNYHSSRCDRIRRICEGATTIHLQPSIRLNLVHLAWP
Ga0307504_1021739313300028792SoilMHADLVNYHSSRCARIRRICEDATTIGPKPGIRRNLFRL
Ga0302228_1046770113300028808PalsaMHADLVNYHSSQFARIRRIGEDAATIRPTPSIRRNLFRLAWPPG
Ga0308309_1106774223300028906SoilMHADLANYHNSRCDRIARIGADETTIRPRLSIRRNPFRS
Ga0222749_1039051023300029636SoilMHADLVNYHSSRCDRIARIGEDETTIRPRLSIRRNLFRLAWPLG
Ga0311368_1023661143300029882PalsaMHADLVNYRSSRCARIRRICEDETTIGPKPSIRRNPFRL
Ga0311340_1121188313300029943PalsaMHADLVNCHSSRCDRIRRICADATTIRPEPSIRRNLFRLARPLG
Ga0311370_1039258013300030503PalsaYVSMHADLVNYRSSRCARIRRICEDETTIGPKPSIRRNPFRLARLPG
Ga0311370_1187173513300030503PalsaMHADLVKYHNSRCDRIRRICEDATTIHPKPSIRRNRFRLA
Ga0210268_130610313300030629SoilMHADLVNYHSSRCDHIRHICEDATTTRLEPSIRRNLFRLAW
Ga0316363_1036129513300030659Peatlands SoilMHADLVNYHSSRCDRIRRICEDAATIRPEPGIRRNLFRLAWLPG
Ga0310039_1013130313300030706Peatlands SoilMHADLENYHSSRCDRIRRICEDETTIRPRLSIRRNLFRLAW
Ga0310038_1027759413300030707Peatlands SoilMHADLVKYHSSRCARIQRICEDAATTRPQPSIRRNPFRLAWLRD
Ga0310038_1051277813300030707Peatlands SoilHADLVNYHSSRCDRIRRICEDATTIRPRLSIRRNLFRLAWPLG
Ga0265762_118378713300030760SoilMHADLVNYHSSRCDRIRRICEDATTICPRPCIRRNLFRLAWP
Ga0075386_1178067413300030916SoilADLVNYHSSRCARIRRICEDGTPIRPEPSIRRNLFRLAWPLG
Ga0170834_10924090023300031057Forest SoilVSMHADLVSYHSSRCTRIRRIFEGGTTIARKPGNQRNLFRLA
Ga0170824_10667626423300031231Forest SoilMRADLVKYHSSRCDRIRRICEDETTIRPEPSIRRNLFRLAWPLG
Ga0302324_10283980813300031236PalsaSMHADLVNYHSSRCARIRRICEDATTIRPKPGIRRNPFRLAWPPG
Ga0318541_1053712523300031545SoilMHADLVNYHNNRCDRIRHMCEDETTIRLERSIRRNPFRLAWLRG
Ga0318541_1063643113300031545SoilMHADLVKCHSSRCDRIRRICEDVTTIRPEPSIRHNLFRLAWP
Ga0310686_10315887723300031708SoilVSMHADLAKYHSSRYDRIRRICVDATTIRPEPSIQRTLFRLA
Ga0307476_1109741113300031715Hardwood Forest SoilSMHADLVKYHSSRCDRIRRICEDATTIRPEPGIRRSLFHWAWPPG
Ga0306918_1091049613300031744SoilMHADLVKYHSSRCAHIRHICEDAATTRPQPSIRRNQ
Ga0318502_1069233523300031747SoilMHADLVNCHSSRRVRILRICEDATTIRPGRGIRHTLFRWARPL
Ga0307475_1086192733300031754Hardwood Forest SoilVSMHADLVKYHSSRCDRIRRICEDATTIRPEPGIRRSLFHWA
Ga0318547_1069455523300031781SoilMHADLVNCHSSRCARIRRICEDATTIRPEPSIRRNLFRLARLLG
Ga0318568_1089659613300031819SoilMHADLVKCHSSRCDRIRRICEDATTIRPEPSIRHNLFRS
Ga0307478_1128176013300031823Hardwood Forest SoilVKYHSSRCDRIRRICEDATTIRPEPGIRRSLFRSAWPPG
Ga0310912_1018987013300031941SoilMHADLVKNHSSRCARIQRICEDAATTRPQPSIRRNQFRLAWLR
Ga0310913_1055053413300031945SoilMYADLVNYHSSRCGRIRRICGDETTIRQEPSIRRNLFRLA
Ga0318504_1066669313300032063SoilYVSMHADLVKYHSSRCDRIRRICEDETTIRQEPSIRRNPFRLAWLRG
Ga0318514_1053023623300032066SoilMHADLVNYHNNRCDRIRHICEDGTTIRLEPNIRRNPFRLAWLRG
Ga0306924_1078948323300032076SoilMHADLVNYHSSRYDRIRRICEDATTIHPRPSIRRSLFRSA
Ga0307470_1043031513300032174Hardwood Forest SoilMHADLVNCHSSRCDRIARIGEDETTIRPRLSIRRNLFRSAWPMG
Ga0307470_1192888513300032174Hardwood Forest SoilMHADLVNYRSSRYARIRRICGDGTTIRPEPSIRHNLFHS
Ga0307472_10078956533300032205Hardwood Forest SoilNVSMHADLVKYHNSRCDRIRRICEDATTIRPEPGIRRNLFRSAWPLG
Ga0335079_1195124323300032783SoilMRADLVNYHSSRCARIRRICEDATTIRLKLSIRRNRFRLAWL
Ga0335070_1111888613300032829SoilMHAGSVNYRSSRCDHIVRICEDETTIRREPSIRRSLFRSVRQPG
Ga0335069_1206699313300032893SoilMHADWVNYRSSRCDRIRRICEDATTIHHEPGIRRSLFRSVWLPG
Ga0334854_026318_1263_13853300033829SoilMHADLVNYRNSLCDRIRRICEDATTIRPQPSIRRNLFRLA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.