Basic Information | |
---|---|
Family ID | F034261 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 175 |
Average Sequence Length | 46 residues |
Representative Sequence | MLDHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRGVLIAEFLRGTW |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 175 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 24.00 % |
% of genes near scaffold ends (potentially truncated) | 49.14 % |
% of genes from short scaffolds (< 2000 bps) | 76.57 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.857 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.143 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.05% β-sheet: 7.89% Coil/Unstructured: 71.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 175 Family Scaffolds |
---|---|---|
PF08534 | Redoxin | 30.29 |
PF03952 | Enolase_N | 28.00 |
PF00578 | AhpC-TSA | 18.29 |
PF06415 | iPGM_N | 2.29 |
PF03065 | Glyco_hydro_57 | 2.29 |
PF05163 | DinB | 1.14 |
PF01676 | Metalloenzyme | 1.14 |
PF01061 | ABC2_membrane | 0.57 |
PF01435 | Peptidase_M48 | 0.57 |
PF02628 | COX15-CtaA | 0.57 |
PF09832 | DUF2059 | 0.57 |
PF14492 | EFG_III | 0.57 |
PF00378 | ECH_1 | 0.57 |
PF13628 | DUF4142 | 0.57 |
PF07638 | Sigma70_ECF | 0.57 |
COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
---|---|---|---|
COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 28.00 |
COG0696 | Phosphoglycerate mutase (BPG-independent), AlkP superfamily | Carbohydrate transport and metabolism [G] | 2.29 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.14 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.57 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.86 % |
Unclassified | root | N/A | 13.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000579|AP72_2010_repI_A01DRAFT_1064146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300000789|JGI1027J11758_12189972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300000955|JGI1027J12803_101163135 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300001867|JGI12627J18819_10003489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5848 | Open in IMG/M |
3300001867|JGI12627J18819_10016970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2941 | Open in IMG/M |
3300001977|JGI24746J21847_1042738 | Not Available | 632 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100346454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
3300004153|Ga0063455_100244074 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300004633|Ga0066395_10833041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300004633|Ga0066395_10975345 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Coraliomargarita → Coraliomargarita akajimensis | 516 | Open in IMG/M |
3300005167|Ga0066672_10406295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
3300005176|Ga0066679_10409853 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005332|Ga0066388_100023711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5498 | Open in IMG/M |
3300005332|Ga0066388_100064684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3915 | Open in IMG/M |
3300005332|Ga0066388_105408469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
3300005340|Ga0070689_100441808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
3300005356|Ga0070674_100351851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1190 | Open in IMG/M |
3300005434|Ga0070709_10236830 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300005434|Ga0070709_10953625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300005435|Ga0070714_100618360 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300005435|Ga0070714_100819994 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300005436|Ga0070713_100124674 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
3300005436|Ga0070713_100398611 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300005436|Ga0070713_100545145 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300005439|Ga0070711_101061703 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005529|Ga0070741_10006473 | All Organisms → cellular organisms → Bacteria | 25103 | Open in IMG/M |
3300005538|Ga0070731_10030735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3638 | Open in IMG/M |
3300005538|Ga0070731_10577621 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300005542|Ga0070732_10629786 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005543|Ga0070672_100002640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 11462 | Open in IMG/M |
3300005554|Ga0066661_10494723 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300005557|Ga0066704_10228617 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
3300005569|Ga0066705_10324476 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300005577|Ga0068857_100002750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 14452 | Open in IMG/M |
3300005602|Ga0070762_11201692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300005764|Ga0066903_100055066 | All Organisms → cellular organisms → Bacteria | 4897 | Open in IMG/M |
3300005764|Ga0066903_100422514 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
3300005842|Ga0068858_100357262 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300005921|Ga0070766_10135173 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
3300005993|Ga0080027_10350142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300006028|Ga0070717_11836588 | Not Available | 547 | Open in IMG/M |
3300006041|Ga0075023_100242893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300006041|Ga0075023_100545500 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006059|Ga0075017_100851667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 706 | Open in IMG/M |
3300006059|Ga0075017_100967249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300006059|Ga0075017_101489025 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300006102|Ga0075015_100736247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300006102|Ga0075015_101018888 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006176|Ga0070765_100038112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3820 | Open in IMG/M |
3300006237|Ga0097621_100215955 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
3300006358|Ga0068871_102183003 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300006852|Ga0075433_10047247 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
3300006854|Ga0075425_100698356 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300006854|Ga0075425_101116503 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300007076|Ga0075435_101601837 | Not Available | 571 | Open in IMG/M |
3300009174|Ga0105241_10434484 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300009174|Ga0105241_11983132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300009176|Ga0105242_11609665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300009545|Ga0105237_10599357 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300009545|Ga0105237_10786323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300010043|Ga0126380_10012185 | All Organisms → cellular organisms → Bacteria | 3900 | Open in IMG/M |
3300010048|Ga0126373_10047556 | All Organisms → cellular organisms → Bacteria | 3800 | Open in IMG/M |
3300010360|Ga0126372_10048241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 2858 | Open in IMG/M |
3300010366|Ga0126379_10798377 | Not Available | 1043 | Open in IMG/M |
3300010375|Ga0105239_11721597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300010376|Ga0126381_104901221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300010397|Ga0134124_10988685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300010399|Ga0134127_11418141 | Not Available | 766 | Open in IMG/M |
3300010937|Ga0137776_1584551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7455 | Open in IMG/M |
3300011444|Ga0137463_1061094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
3300012189|Ga0137388_11330538 | Not Available | 658 | Open in IMG/M |
3300012200|Ga0137382_10006659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5855 | Open in IMG/M |
3300012200|Ga0137382_10023014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3610 | Open in IMG/M |
3300012202|Ga0137363_10171902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1719 | Open in IMG/M |
3300012203|Ga0137399_11053830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300012208|Ga0137376_10140083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2076 | Open in IMG/M |
3300012209|Ga0137379_10556337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
3300012360|Ga0137375_10135740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2430 | Open in IMG/M |
3300012685|Ga0137397_10135818 | Not Available | 1817 | Open in IMG/M |
3300012925|Ga0137419_10728705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300012929|Ga0137404_10682312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
3300012944|Ga0137410_11252690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300012971|Ga0126369_12776604 | Not Available | 573 | Open in IMG/M |
3300015241|Ga0137418_10581193 | Not Available | 882 | Open in IMG/M |
3300015245|Ga0137409_10835151 | Not Available | 756 | Open in IMG/M |
3300015371|Ga0132258_11073368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 2035 | Open in IMG/M |
3300016422|Ga0182039_10294425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
3300017927|Ga0187824_10047027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
3300017927|Ga0187824_10106828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300017927|Ga0187824_10238277 | Not Available | 628 | Open in IMG/M |
3300017930|Ga0187825_10046004 | Not Available | 1477 | Open in IMG/M |
3300017959|Ga0187779_11221916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300017966|Ga0187776_10810709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300017994|Ga0187822_10054030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
3300018064|Ga0187773_10838603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300019877|Ga0193722_1007773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2708 | Open in IMG/M |
3300019879|Ga0193723_1128898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300020002|Ga0193730_1134329 | Not Available | 668 | Open in IMG/M |
3300020170|Ga0179594_10154861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
3300020580|Ga0210403_11284505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300020581|Ga0210399_10550143 | Not Available | 957 | Open in IMG/M |
3300020583|Ga0210401_10000010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 241595 | Open in IMG/M |
3300020583|Ga0210401_10087603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2928 | Open in IMG/M |
3300021088|Ga0210404_10063018 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300021088|Ga0210404_10594285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300021181|Ga0210388_10018361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5636 | Open in IMG/M |
3300021344|Ga0193719_10184615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
3300021377|Ga0213874_10258393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300021404|Ga0210389_10563293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
3300021406|Ga0210386_10010177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7402 | Open in IMG/M |
3300021406|Ga0210386_10015019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6046 | Open in IMG/M |
3300021406|Ga0210386_10805885 | Not Available | 807 | Open in IMG/M |
3300021407|Ga0210383_11044978 | Not Available | 691 | Open in IMG/M |
3300021432|Ga0210384_11018516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300021475|Ga0210392_10147301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
3300021559|Ga0210409_11537365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300021560|Ga0126371_10025525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5492 | Open in IMG/M |
3300021560|Ga0126371_10056748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3763 | Open in IMG/M |
3300021560|Ga0126371_10967989 | Not Available | 993 | Open in IMG/M |
3300022504|Ga0242642_1096955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300022523|Ga0242663_1032332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
3300022527|Ga0242664_1121882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300024123|Ga0228600_1008797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
3300025321|Ga0207656_10074869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1511 | Open in IMG/M |
3300025911|Ga0207654_10260976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300025928|Ga0207700_10104626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2265 | Open in IMG/M |
3300025929|Ga0207664_10185072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1790 | Open in IMG/M |
3300025936|Ga0207670_11125776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300025936|Ga0207670_11565248 | Not Available | 561 | Open in IMG/M |
3300025937|Ga0207669_10303176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
3300025986|Ga0207658_10142539 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
3300026116|Ga0207674_10060150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3843 | Open in IMG/M |
3300026118|Ga0207675_100218327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1836 | Open in IMG/M |
3300026281|Ga0209863_10194078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300026318|Ga0209471_1168634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300026335|Ga0209804_1105782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1290 | Open in IMG/M |
3300026371|Ga0257179_1040557 | Not Available | 590 | Open in IMG/M |
3300026548|Ga0209161_10561035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300027061|Ga0209729_1028154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300027071|Ga0209214_1027106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300027161|Ga0208368_106073 | Not Available | 645 | Open in IMG/M |
3300027548|Ga0209523_1010683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1691 | Open in IMG/M |
3300027562|Ga0209735_1070272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300027610|Ga0209528_1033762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300027703|Ga0207862_1128950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300027706|Ga0209581_1000004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1127213 | Open in IMG/M |
3300027842|Ga0209580_10662440 | Not Available | 516 | Open in IMG/M |
3300027862|Ga0209701_10317343 | Not Available | 890 | Open in IMG/M |
3300027869|Ga0209579_10629526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300027875|Ga0209283_10202865 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300027911|Ga0209698_10714049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300027911|Ga0209698_10862665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300028017|Ga0265356_1003857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1859 | Open in IMG/M |
3300029636|Ga0222749_10124665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
3300031679|Ga0318561_10808683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300031718|Ga0307474_10814456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300031719|Ga0306917_10012529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4945 | Open in IMG/M |
3300031720|Ga0307469_10014794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4010 | Open in IMG/M |
3300031720|Ga0307469_12286099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300031740|Ga0307468_100263374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
3300031740|Ga0307468_100349308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
3300031753|Ga0307477_10241391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1252 | Open in IMG/M |
3300031780|Ga0318508_1060490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
3300031820|Ga0307473_10079173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1678 | Open in IMG/M |
3300031820|Ga0307473_11524792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300031833|Ga0310917_10064930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2275 | Open in IMG/M |
3300031962|Ga0307479_10010353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8659 | Open in IMG/M |
3300032035|Ga0310911_10018632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3303 | Open in IMG/M |
3300032041|Ga0318549_10208427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
3300032174|Ga0307470_10586757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300032180|Ga0307471_100132095 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
3300032770|Ga0335085_10006491 | All Organisms → cellular organisms → Bacteria | 18410 | Open in IMG/M |
3300032829|Ga0335070_10084805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3359 | Open in IMG/M |
3300032893|Ga0335069_11495515 | Not Available | 727 | Open in IMG/M |
3300033004|Ga0335084_10776569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.71% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.14% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.57% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.43% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.29% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.29% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.29% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.14% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.57% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.57% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.57% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.57% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Host-Associated | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A01DRAFT_10641461 | 3300000579 | Forest Soil | MLDHTETLQVGQRAPEFALEAANRPGVLTLSGFLRRGTLVAEFL |
JGI1027J11758_121899722 | 3300000789 | Soil | MLDRTDTLQVGSRAPEFALEAANREGVITLSGFLQRGNLILEFLRGTR* |
JGI1027J12803_1011631353 | 3300000955 | Soil | VCYQMLDHTETLGVGARAPEFSLEAANRDGILTLSGFLRRGVLIAEFLRGTW* |
JGI12627J18819_100034895 | 3300001867 | Forest Soil | MLDHTETLKVGARAPEFSLDAANRDGILTLSGFLKRAPLILEFMRGTW* |
JGI12627J18819_100169704 | 3300001867 | Forest Soil | VYLLIYSRLQMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGLLIAEFLRGTW* |
JGI24746J21847_10427381 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | MQQQTETLEVGSRAPEFALEAANRDGVFTLSGFLRRAVLVIEFLR |
JGIcombinedJ26739_1003464541 | 3300002245 | Forest Soil | MSDRTETLAVGSRAPEFLLAAAYRDGILSLSGFLSRGALVVEFLRRTW* |
Ga0063455_1002440742 | 3300004153 | Soil | MRDRTETLAVGSVAPEFALSAANRAGMFSLRELLGGLLVVEFLRGTW* |
Ga0066395_108330411 | 3300004633 | Tropical Forest Soil | CCSPFAAALESRQMLDHTETLKLGDRAPEFLLRAANRDGISSLSGALTRAVVILEFLRGTW* |
Ga0066395_109753451 | 3300004633 | Tropical Forest Soil | MLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKRGSLILEFLRGTW* |
Ga0066672_104062951 | 3300005167 | Soil | MLDYTETLKVGSRAPEFALDAANREGMLTLSGFLRRGLLIAEFLRGTW* |
Ga0066679_104098533 | 3300005176 | Soil | YSRLQMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW* |
Ga0066388_1000237115 | 3300005332 | Tropical Forest Soil | MLDHTETLRVGARAPEFSLEGANRDGILTLSGFLRRGVLIAEFLRGTW* |
Ga0066388_1000646844 | 3300005332 | Tropical Forest Soil | VVCFTFSKQMLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKRGSLILEFLRGTW* |
Ga0066388_1054084692 | 3300005332 | Tropical Forest Soil | MQDRTETFTAGSRAPEFLLPAANREGILSLSGFLSRGTLIIEFLRGTW* |
Ga0070689_1004418083 | 3300005340 | Switchgrass Rhizosphere | VGARAPEFLLSAANRDGILSLSGFLSRGTLIVEFLRGTW* |
Ga0070674_1003518512 | 3300005356 | Miscanthus Rhizosphere | MLDRTETLAVGARAPEFLLSAPNRDGILSLSGFLSRGTLIVEFLRGTW* |
Ga0070709_102368302 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW* |
Ga0070709_109536252 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDHTETLKIGSRAPEFALEAANREGMLTLSGFLRRGVLIAEFLRGTW* |
Ga0070714_1006183601 | 3300005435 | Agricultural Soil | MLDHTETLKVGARAPEFALEAANRDGVLTLSGFLKRGILIAEFLRGTW* |
Ga0070714_1008199943 | 3300005435 | Agricultural Soil | IYSRLQMLDHTETLKIGSRAPEFALEAANREGMLTLSGFLRRGVLIAEFLRGTW* |
Ga0070713_1001246744 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDHTETLKVGSRAPEFALQAANREGVLTLSGFLRRGMLIAEFLRGTW* |
Ga0070713_1003986111 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLI |
Ga0070713_1005451451 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LIYSRLQMLDHTETLKIGSRAPEFALEAANREGMLTLSGFL |
Ga0070711_1010617031 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LIYSRLQMLDHTETLKIGSRAPEFALEAANREGMLTLSGFLRRGVLIAEFLRGTW* |
Ga0070741_1000647320 | 3300005529 | Surface Soil | MQDHTETLQVGLRAPEFALGSANRDGVLTLSGFLKRGVLVAEFLRGTW* |
Ga0070731_100307355 | 3300005538 | Surface Soil | MLDHTETLKVSARAPEFSLDAANRDGILTLSGFLKRAPLILEFLRGTW* |
Ga0070731_105776211 | 3300005538 | Surface Soil | MLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKRGLLILEFLRGTW* |
Ga0070732_106297861 | 3300005542 | Surface Soil | MLDRTETLQVGSRAPEFTLEPANREGILTLSGFLQRGRLILEFLRG |
Ga0070672_1000026401 | 3300005543 | Miscanthus Rhizosphere | MQQQTETLEVGSRAPEFALEAANRDGVFTLSGFLRR |
Ga0066661_104947233 | 3300005554 | Soil | KVGSRAPEFALDAANREGMLTLSGFLRRGLLIAEFLRGTW* |
Ga0066704_102286173 | 3300005557 | Soil | APEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW* |
Ga0066705_103244763 | 3300005569 | Soil | VDFQMLDYTETLKVGSRAPEFALDAANREGMLTLSGFLRRGLLIAEFLRGTW* |
Ga0068857_1000027501 | 3300005577 | Corn Rhizosphere | MQQQTETLEVGSRAPEFALEAANRDGVFTLSGFLRRA |
Ga0070762_112016921 | 3300005602 | Soil | MLDHTETLKVGARAPEFSLDAANRDGILTLSGFLKRAPLILEFLRGT |
Ga0066903_1000550666 | 3300005764 | Tropical Forest Soil | VVCFTFSKQMLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKHGSLILEFLRGTW* |
Ga0066903_1004225142 | 3300005764 | Tropical Forest Soil | MLDHTETLKLGDRAPEFLLRAANRDGISSLSGALTRAVVILEFLRGTW* |
Ga0068858_1003572621 | 3300005842 | Switchgrass Rhizosphere | MQDRTETLQVGSRAPEFLLSPLNGEGIVSLSGCLKRG |
Ga0070766_101351733 | 3300005921 | Soil | MLDHTETQQVGSRAPEFTLEAANREGVLTLSGFLRRGVLIAEFLRGTW* |
Ga0080027_103501421 | 3300005993 | Prmafrost Soil | VGSRAPEFLLSAANRDGILSLSGFLSRGGLIVEFLRGTW* |
Ga0070717_118365882 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNRTDTLSLGSRAPEFLLSAANRDGILSLSGFLSRGPL |
Ga0075023_1002428933 | 3300006041 | Watersheds | LTVGSRAPEFLLSAANRDGILSLSGFLSRGTVIVEFLRGTW* |
Ga0075023_1005455002 | 3300006041 | Watersheds | MQMSDRTETLTIGSRAPEFLLSAANRDGILSLSGFLSRG |
Ga0075017_1008516672 | 3300006059 | Watersheds | MLDHTETLKVGGRAPEFSLEAANRDGILTLSGFLRRGLLILEFLRGTW* |
Ga0075017_1009672493 | 3300006059 | Watersheds | MLDHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRAVLVADFLRGTW* |
Ga0075017_1014890251 | 3300006059 | Watersheds | MLDHTETLKAGARAPEFSLEAANRDGILTLSGFLRRGLLILEFLRGTW* |
Ga0075015_1007362471 | 3300006102 | Watersheds | LIYIHFLMQDHQMQDHTETLKVGSRAPEFALEAANREGVLTLSGFLRRGVLIAEFLRGTC |
Ga0075015_1010188882 | 3300006102 | Watersheds | MVDHTDSLQVGARAPEFSLEAANRDGILTLSGFLKRGLLILEFLRG |
Ga0070765_1000381124 | 3300006176 | Soil | MLDRTETLQVGSRAPEFTLEPANREGILTLSGFLQRGKLILEFLRGTW* |
Ga0097621_1002159554 | 3300006237 | Miscanthus Rhizosphere | MLDRTETLAVGSRAPEFLLPAANRDGILSLSGFLWRGVLIVEFLRGTW* |
Ga0068871_1021830032 | 3300006358 | Miscanthus Rhizosphere | MQMLDRTETLAVGSRAPEFLLPAANRDGILSLSGFLWRGVLIVEFLRGTW* |
Ga0075433_100472475 | 3300006852 | Populus Rhizosphere | MLDHTETLGVGARAPEFSLEAANRDGILTLSGFLRRGVLIAEFLRGTW* |
Ga0075425_1006983561 | 3300006854 | Populus Rhizosphere | SRAPEFLLPAANRDGIVSLSGLLSSGTLIVEFLRRTW* |
Ga0075425_1011165031 | 3300006854 | Populus Rhizosphere | LTGGSKAPEFLLPAANRDGIFSLSGFLSRGTLIAEFLRGTW* |
Ga0075435_1016018372 | 3300007076 | Populus Rhizosphere | MQQQTETLEVGSRAPEFALEAANRDGVFTLSGFLRRAVL |
Ga0105241_104344842 | 3300009174 | Corn Rhizosphere | MLDRTETLVVGARAPEFLLSAANRDGILSLSGFRSRGTLIVEFLRGTW* |
Ga0105241_119831322 | 3300009174 | Corn Rhizosphere | RAPEFLLSAANRDGILSLSGFLSRGTLIVEFLRGTW* |
Ga0105242_116096653 | 3300009176 | Miscanthus Rhizosphere | GSRAPEFALEAANRDGVFTLSGFLRRAVLVIEFLRGTW* |
Ga0105237_105993572 | 3300009545 | Corn Rhizosphere | MLDRTETLVVGARAPEFLLSAANRDGILSLSGFLSRGTLI |
Ga0105237_107863231 | 3300009545 | Corn Rhizosphere | MQMLDRTETLAVGSRAPEFLMPAANRNGILSLSGFLWRGVLIVEFLRGTW* |
Ga0126380_100121853 | 3300010043 | Tropical Forest Soil | MLDHTETLRVGARAPEFSLEAANRDGILTLSGFLRRGVLVAEFLRGTW* |
Ga0126373_100475561 | 3300010048 | Tropical Forest Soil | MLDHTEALKVGSRAPEFALGAANREGVLTLSGFLRRGMLI |
Ga0126372_100482412 | 3300010360 | Tropical Forest Soil | MLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKHGSLILEFLRGTW* |
Ga0126379_107983772 | 3300010366 | Tropical Forest Soil | MLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKRGSLILEFL |
Ga0105239_117215971 | 3300010375 | Corn Rhizosphere | MLHRTETLAVSSRAPEFLLSAANRDGILSLSGFLSRGALIVEFLRGTW* |
Ga0126381_1049012212 | 3300010376 | Tropical Forest Soil | MLDHTETLQVGRRAPEFALEAANRPGVLTLSGFLRRGTLVAEFLR |
Ga0134124_109886851 | 3300010397 | Terrestrial Soil | MLDRTETLSVGSRAPEFLLPAANREGILSLSGFLLRGVLIVEFLRGTW* |
Ga0134127_114181411 | 3300010399 | Terrestrial Soil | MQQQTETLEVGSRAPEFALEAANRDGVFTLSGFLRRAV |
Ga0137776_15845511 | 3300010937 | Sediment | MQDRTETLQVGSHAPEFALEAANREGMLTLSGFLQRGNLILELLRGTW* |
Ga0137463_10610941 | 3300011444 | Soil | LRWFIHLFTGCGHPLVLYSRSRMSDRTETLAVGSRAPEFLLPAANRDGILSLSGFLSRATLIVEFLRGTW* |
Ga0137388_113305381 | 3300012189 | Vadose Zone Soil | MSDRTETLAVGSRAPEFLLSAANRDGIFSLSGFLSRGALIVE |
Ga0137382_100066596 | 3300012200 | Vadose Zone Soil | MLDHTETLRVGARAPEFSLGAANRDGILTLSGFLRRAVLIAEFLRGTW* |
Ga0137382_100230143 | 3300012200 | Vadose Zone Soil | MLDYTETMQVGARAPEFSLEAANRDGILTLSGFLRRAVLIADFLRGTW* |
Ga0137363_101719023 | 3300012202 | Vadose Zone Soil | MGDHTDTLCVGVRAPEFSLEAANRDGILTLSGFLKRGLLVLEFLRGTW* |
Ga0137399_110538302 | 3300012203 | Vadose Zone Soil | MLDYTETMRVGARAPEFSLEAANRDGILTLSGFLRRAVLIADFLRGTW* |
Ga0137376_101400832 | 3300012208 | Vadose Zone Soil | MLDHTETLRVGARAPEFSLEAANCDGILTLSGFLRRAVLIADFLRGTW* |
Ga0137379_105563372 | 3300012209 | Vadose Zone Soil | VLDHTETLKIGERAPEFLLPAANRESMVSLSGSLSRGTVIVEFLRGTW* |
Ga0137375_101357402 | 3300012360 | Vadose Zone Soil | MLDHTETLRVGARAPEFSLEAANRDGIFTLSGFLRRAVLIADFLRGTW* |
Ga0137397_101358183 | 3300012685 | Vadose Zone Soil | MLDHTETLRVGARAPEFSLEAANRDGILTLSGFLRRAVLVAEFLRGTW* |
Ga0137419_107287051 | 3300012925 | Vadose Zone Soil | MLDYTETMRVGVRAPEFSLEAANRDGILTLSGFLRRAVLIADFLRGTW* |
Ga0137404_106823121 | 3300012929 | Vadose Zone Soil | MSDRTETLAVGVRAPEFLLPAANRDGILSLSGFLSCGLLIVEFLRGTW* |
Ga0137410_112526902 | 3300012944 | Vadose Zone Soil | MLDHTETLRVGARAPEFSLEAANRDGILTLSGFLRRAVLIADFLRGTW* |
Ga0126369_127766041 | 3300012971 | Tropical Forest Soil | MLDHTETLQLGARAPEFSLEAANRGGILTLSGFLKRAPLI |
Ga0137418_105811932 | 3300015241 | Vadose Zone Soil | MQDRTETLALGSRAREFLLLAANRDGLLWLSGLLSRGTLIVEFLRGTW* |
Ga0137409_108351511 | 3300015245 | Vadose Zone Soil | MLDRAETLTVGTSAPEFLLSTANREGILSLSGFLSR |
Ga0132258_110733681 | 3300015371 | Arabidopsis Rhizosphere | MLDHTETLRVRARAPEFSLEAANRDGILTLSGFLRRGVLVAE |
Ga0182039_102944253 | 3300016422 | Soil | FTVSKQMQDRTETLQVGSRAPEFTLEPANRQGILTLSGFLQRGKLILEFLRVTW |
Ga0187824_100470272 | 3300017927 | Freshwater Sediment | MLDHTETLKVGARAPEFALEAANRDGVLTLSGFLKRGILIAEFLRGTW |
Ga0187824_101068281 | 3300017927 | Freshwater Sediment | MLDHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRGILVAEFLRGTW |
Ga0187824_102382771 | 3300017927 | Freshwater Sediment | MFDHTETLKPGARAPEFSLEAANRDGILTLSGFLRRGLLILE |
Ga0187825_100460042 | 3300017930 | Freshwater Sediment | MLDRTETLSVGSRAPEFLLSAANRDGILSLSGFLSRGPLIVE |
Ga0187779_112219161 | 3300017959 | Tropical Peatland | MLDHADSLQIGSRAPEFALEAANRDGLHTLSGFLQRGILILEFLRGTW |
Ga0187776_108107092 | 3300017966 | Tropical Peatland | MLDHTETLKVGSRAPEFTLEAANRDGVLTLSGFLKRGVLVAEFLRGTW |
Ga0187822_100540302 | 3300017994 | Freshwater Sediment | MFDHTETLKPGARAPEFSLEAANRDGILTLSGFLRRGLLILEFLRGTW |
Ga0187773_108386031 | 3300018064 | Tropical Peatland | PAFTLLYSRAWMLDHTETLKVGSRAPEFTLEAANRDGVLTLSGFLKRGVLVAEFLRGTW |
Ga0193722_10077732 | 3300019877 | Soil | MLDHTETLKIGSRAPEFALESANREGVLTLSGFLRRGLLIAEFLRGTW |
Ga0193723_11288981 | 3300019879 | Soil | TETLAVGSRAPEFLLPAANRDGIVSLSGFLSRGTLIVEFLRGTW |
Ga0193730_11343292 | 3300020002 | Soil | MLNRTETLTVGARAPEFLLSAANREGILSLSGFLSRGT |
Ga0179594_101548613 | 3300020170 | Vadose Zone Soil | MLDYTETMRVGARAPEFSLEAANRDGILTLSGFLRRAVLIADFLRGTW |
Ga0210403_112845051 | 3300020580 | Soil | RAPEFALEAANRPGVLTLSGFLRRGALIAEFLRGTW |
Ga0210399_105501432 | 3300020581 | Soil | MLDHTETLRVGARAPEFSLEAANRDGILTLSGFLKRGLLVLEFLRGTW |
Ga0210401_1000001038 | 3300020583 | Soil | VYLLIYSRLQMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGLLIAEFLRGTW |
Ga0210401_100876032 | 3300020583 | Soil | MLDHTETQQVGSRAPEFTLEAANREGVLTLSGFLRRGVLIAEFLRGTW |
Ga0210404_100630182 | 3300021088 | Soil | MLDHTETLKIGSRAPEFALEAANREGVLTLSGFLRRGVLIAEFLRGTW |
Ga0210404_105942853 | 3300021088 | Soil | LDYTETLKMGVRAPEFSLEAANRDGILTLSGFLRRGLLILEFMRGTW |
Ga0210388_100183615 | 3300021181 | Soil | MLDRTETLQVGSRAPEFTLEPANREGILTLSGFLQRGKLILEFLRGTW |
Ga0193719_101846151 | 3300021344 | Soil | MLDHTETLKIGSRAPEFALESANREGVLTLSGFLRRGLLIAEFLLGTW |
Ga0213874_102583931 | 3300021377 | Plant Roots | MLNHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRAILVAEFLRGTW |
Ga0210389_105632933 | 3300021404 | Soil | MLDHTETLSVGARAPEFSLEAANRDGILTLSGFLKRGLLILEFLRGTW |
Ga0210386_100101773 | 3300021406 | Soil | VYLLIYSRLQMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW |
Ga0210386_100150195 | 3300021406 | Soil | MLDHTETQQVGSRAPEFTLEAANREGVLTLLGFLRRGVLIAEFLRGTW |
Ga0210386_108058852 | 3300021406 | Soil | MLDHTETLKVGDRAPEFLLPAANRDGIVSLSGSLTRGPVVIEFLR |
Ga0210383_110449781 | 3300021407 | Soil | MSDRTETLSVGSRAPEFLLSAANRDGILSLSGFLSRGALVVEFLRG |
Ga0210384_110185163 | 3300021432 | Soil | MSDRTETLAVGSRAPEFLLAAANCDGILALSGFLSRGALIVEFLRGTW |
Ga0210392_101473014 | 3300021475 | Soil | GSRAPEFTLEPANREGILTLSGFLQRGKLILEFLRGTW |
Ga0210409_115373652 | 3300021559 | Soil | MLDYTETLKMGVRAPEFSLEAANRDGILTLSGFLRRGLLILEFMRGTW |
Ga0126371_100255255 | 3300021560 | Tropical Forest Soil | MLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKRGSLILEFLRGTW |
Ga0126371_100567482 | 3300021560 | Tropical Forest Soil | MLDHTETLKLGDRAPEFLLRAANRDGISSLSGALTRAVVILEFLRGTW |
Ga0126371_109679892 | 3300021560 | Tropical Forest Soil | MLDHTETLQLGARAPEFSLEAANRDGILTLSGFLK |
Ga0242642_10969551 | 3300022504 | Soil | LKVGARAPEFSLDAANRDGILTLSGFLKRAPLILEFLRGTW |
Ga0242663_10323321 | 3300022523 | Soil | LKVGSRAPEFALEAANREGVLTLSGFLRRGLLIAEFLRGTW |
Ga0242664_11218821 | 3300022527 | Soil | ETLSVGARAPEFSLEAANRDGILTLSGFLKRGLLILEFLRGTW |
Ga0228600_10087973 | 3300024123 | Roots | RAPEFALESANRERLFLTLSGFLRRGTVILEFLRGTW |
Ga0207656_100748692 | 3300025321 | Corn Rhizosphere | MQQQTETLEVGSRAPEFALEAANRDGVFTLSGFLRRAVLVIE |
Ga0207654_102609761 | 3300025911 | Corn Rhizosphere | QQQTETLEVGSRAPEFALEAANRDGVFTLSGFLRRAVLVIEFVRGTW |
Ga0207700_101046264 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDHTETLKVGSRAPEFALQAANREGVLTLSGFLRRGMLIAEFLRGTW |
Ga0207664_101850721 | 3300025929 | Agricultural Soil | IGWVTFDLQMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW |
Ga0207670_111257761 | 3300025936 | Switchgrass Rhizosphere | VGARAPEFLLSAANRDGILSLSGFLSRGTLIVEFLRGTW |
Ga0207670_115652481 | 3300025936 | Switchgrass Rhizosphere | MQDRTETLQIGSRAPEFLLSPLNGQGIVSLSGCLKRGVLIV |
Ga0207669_103031761 | 3300025937 | Miscanthus Rhizosphere | SRAPEFALEAANRDGVFTLSGFLRRAVLVIEFLRGTW |
Ga0207658_101425391 | 3300025986 | Switchgrass Rhizosphere | MLDRTETLVVGARAPEFLLSAANRDGILSLSGFLSRGTL |
Ga0207674_100601501 | 3300026116 | Corn Rhizosphere | MLDRTETLVVGARAPEFLLSAANRDGILSLSGFLSRGT |
Ga0207675_1002183272 | 3300026118 | Switchgrass Rhizosphere | MLHRTETLAVSSRAPEFLLSAANRDGILSLSGFLSRGTLIVEFLRGTW |
Ga0209863_101940783 | 3300026281 | Prmafrost Soil | VGSRAPEFLLSAANRDGILSLSGFLSRGGLIVEFLRGTW |
Ga0209471_11686343 | 3300026318 | Soil | YSRLQMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW |
Ga0209804_11057823 | 3300026335 | Soil | QMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW |
Ga0257179_10405572 | 3300026371 | Soil | MLDRAETLTVGTSAPEFLLSTANREGILSLSGFLSRGPLIVECLRGTLGDRTACHAWL |
Ga0209161_105610351 | 3300026548 | Soil | LIYSRLQMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW |
Ga0209729_10281541 | 3300027061 | Forest Soil | LQVGSRAPEFALEAANREGVMTLSGFLRRGMLIAEFLRGTW |
Ga0209214_10271061 | 3300027071 | Forest Soil | MLDHTETLKVGARAPEFSLDAANRDGILTLSGFLKRAPLILEFMRGTW |
Ga0208368_1060731 | 3300027161 | Forest Soil | MLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRG |
Ga0209523_10106832 | 3300027548 | Forest Soil | MLDHTETLQVGSRAPEFALEAANREGVMTLSGFLRRGML |
Ga0209735_10702722 | 3300027562 | Forest Soil | MLDHTETLKIGSRAPEFALESANREGVLTLSGFLRRGLLVAEFLRGTW |
Ga0209528_10337621 | 3300027610 | Forest Soil | ETLAVGSRAPEFLLAAAYRDGILSLSGFLSRGALVVEFLRRTW |
Ga0207862_11289501 | 3300027703 | Tropical Forest Soil | APEFALEAANRDGLHTLSGFLQRGILILEFLRGTW |
Ga0209581_1000004363 | 3300027706 | Surface Soil | MQDHTETLQVGLRAPEFALGSANRDGVLTLSGFLKRGVLVAEFLRGTW |
Ga0209580_106624401 | 3300027842 | Surface Soil | MLDHTETLKVSARAPEFSLDAANRDGILTLSGFLKRAPLILEFLRGTW |
Ga0209701_103173431 | 3300027862 | Vadose Zone Soil | MLERTETLTVGSRAPEFLLSAANRDGLLSLSGFLSRGT |
Ga0209579_106295262 | 3300027869 | Surface Soil | MLDHTETLVVGARAPEFSLEAANRDGILTLSGFLKRGLLILEFLRGTW |
Ga0209283_102028651 | 3300027875 | Vadose Zone Soil | MLNRTETLTVGSRAPEFLLPAANRDGILSLSGFLSRGTLIVK |
Ga0209698_107140492 | 3300027911 | Watersheds | MLDHTETLKAGARAPEFSLEAANRDGILTLSGFLRRGLLILEFLRGTW |
Ga0209698_108626653 | 3300027911 | Watersheds | APEFLLSAANRDGLLSLSGFLSRGALIVEFLRGTW |
Ga0265356_10038573 | 3300028017 | Rhizosphere | MRDRTETLEIGSRAPEFALESANGERLFLTLSGFLRRGTVILEFLRGTW |
Ga0222749_101246653 | 3300029636 | Soil | ETLVVGARAPEFLLLAANRDGLLSLSGFLSRGALIVEFLRGTW |
Ga0318561_108086831 | 3300031679 | Soil | MQDRTETLQVGSRAPEFTLEPANRQGILTLSGFLQRGKLILEF |
Ga0307474_108144563 | 3300031718 | Hardwood Forest Soil | MLDHTETLKVGARAPEFSLDAANRGGILTLSGFLKRAP |
Ga0306917_100125293 | 3300031719 | Soil | MLDHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRGVLIAEFLRGTW |
Ga0307469_100147941 | 3300031720 | Hardwood Forest Soil | MLDRTETLWVGARAPEFSLEAANRDGILTLSGFLRRAVLIAEFLRGTW |
Ga0307469_122860992 | 3300031720 | Hardwood Forest Soil | MLHRTETLAVSSRAPEFLLSAANRDGILSLSGFLSRGALIVEFLRGTW |
Ga0307468_1002633741 | 3300031740 | Hardwood Forest Soil | MLHRTETLAVSSRAPEFLVSAANRDGILSLSGFLSRGALIVEFLRGTW |
Ga0307468_1003493082 | 3300031740 | Hardwood Forest Soil | MLDHTETLWVGARAPEFSLEAANRDGILTLSGFLRRAVLIAEFLRGTW |
Ga0307477_102413912 | 3300031753 | Hardwood Forest Soil | MLDHTETLKSGGRAPEFSLEAANRDGILTLSGFLRRGLLILEFLRGTW |
Ga0318508_10604903 | 3300031780 | Soil | PISMLDHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRGVLIAEFLRGTW |
Ga0307473_100791732 | 3300031820 | Hardwood Forest Soil | VYLLIYSRLRMLDRTETLKVGSRAPEFALEAANREGVLTLSGFLRRGMLIAEFLRGTW |
Ga0307473_115247921 | 3300031820 | Hardwood Forest Soil | ARAPEFSLEAANRDGILTLSGFLRRAVLVAEFLRGTW |
Ga0310917_100649301 | 3300031833 | Soil | TLQVGSRAPEFTLEPANRQGILTLSGFLQRGKLILEFLRGTW |
Ga0307479_1001035311 | 3300031962 | Hardwood Forest Soil | MLDRTETLVVGARAPEFLLLAANRDGLLSLSGFLSRGALIVEFLRGTW |
Ga0310911_100186325 | 3300032035 | Soil | LYSPISMLDHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRGVLIAEFLRGTW |
Ga0318549_102084271 | 3300032041 | Soil | YSPISMLDHTETLKVGSRAPEFALEAANRDGVLTLSGFLKRGVLIAEFLRGTW |
Ga0307470_105867573 | 3300032174 | Hardwood Forest Soil | MLDHTETLWVGARAPEFSLEAATRDGILTLSGFLRRAVLIAEFLRGTW |
Ga0307471_1001320952 | 3300032180 | Hardwood Forest Soil | MLDHTETLWVGARAPEFSLEAPNRDGILTLSGFLQRAALIAEFLRGTW |
Ga0335085_1000649114 | 3300032770 | Soil | MLDRTETLAVGSRAPEFLLSAANRDGILSLSGFLSRAALILEFLRGTW |
Ga0335070_100848052 | 3300032829 | Soil | MRDRTDTLQVGSRAPEFTLEPANRSGILTLSGFLQRGKLMLEFLRGTW |
Ga0335069_114955152 | 3300032893 | Soil | MLDHTETLKVGDRAPEFVLPAANREGVISLSGLLTRGTVIVEFLR |
Ga0335084_107765691 | 3300033004 | Soil | APEFSLEAANRNGILTLSGFLRRGVLIAEFLRGTW |
⦗Top⦘ |