Basic Information | |
---|---|
Family ID | F034227 |
Family Type | Metagenome |
Number of Sequences | 175 |
Average Sequence Length | 42 residues |
Representative Sequence | ERGADKEGKDVNGRIMAAIAAKMTDAQMKALADYTAGLR |
Number of Associated Samples | 145 |
Number of Associated Scaffolds | 175 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.43 % |
% of genes from short scaffolds (< 2000 bps) | 93.71 % |
Associated GOLD sequencing projects | 137 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.857 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (9.143 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.429 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.286 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 175 Family Scaffolds |
---|---|---|
PF03476 | MOSC_N | 40.00 |
PF04321 | RmlD_sub_bind | 28.57 |
PF00908 | dTDP_sugar_isom | 2.29 |
PF13365 | Trypsin_2 | 1.71 |
PF16363 | GDP_Man_Dehyd | 0.57 |
PF00483 | NTP_transferase | 0.57 |
PF13442 | Cytochrome_CBB3 | 0.57 |
PF00083 | Sugar_tr | 0.57 |
PF09837 | DUF2064 | 0.57 |
COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
---|---|---|---|
COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 57.14 |
COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 57.14 |
COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 57.14 |
COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 40.00 |
COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 28.57 |
COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 28.57 |
COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 28.57 |
COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 28.57 |
COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 28.57 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 2.29 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.86 % |
Unclassified | root | N/A | 17.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps_contig47510.29685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3981 | Open in IMG/M |
3300000559|F14TC_102652732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100888190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
3300001213|JGIcombinedJ13530_108895785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 627 | Open in IMG/M |
3300004479|Ga0062595_100408342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 977 | Open in IMG/M |
3300004778|Ga0062383_10223920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 878 | Open in IMG/M |
3300005093|Ga0062594_102791288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
3300005184|Ga0066671_10765835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 619 | Open in IMG/M |
3300005293|Ga0065715_10155319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1683 | Open in IMG/M |
3300005328|Ga0070676_10397257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 958 | Open in IMG/M |
3300005328|Ga0070676_10487326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 873 | Open in IMG/M |
3300005339|Ga0070660_100704299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → Collimonas fungivorans | 847 | Open in IMG/M |
3300005345|Ga0070692_11063463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 569 | Open in IMG/M |
3300005354|Ga0070675_100667000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 946 | Open in IMG/M |
3300005355|Ga0070671_101390512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
3300005355|Ga0070671_101788652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 546 | Open in IMG/M |
3300005356|Ga0070674_100848552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
3300005364|Ga0070673_101925107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
3300005365|Ga0070688_100754327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 758 | Open in IMG/M |
3300005367|Ga0070667_102219420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 517 | Open in IMG/M |
3300005444|Ga0070694_101082199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 668 | Open in IMG/M |
3300005455|Ga0070663_100571115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
3300005456|Ga0070678_101173742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
3300005458|Ga0070681_11466170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300005459|Ga0068867_100268636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
3300005459|Ga0068867_102412665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300005529|Ga0070741_11001851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
3300005563|Ga0068855_100763119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
3300005564|Ga0070664_101402477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 660 | Open in IMG/M |
3300005578|Ga0068854_100572223 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300005578|Ga0068854_101154539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
3300005617|Ga0068859_102887530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
3300005618|Ga0068864_100045225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3776 | Open in IMG/M |
3300005834|Ga0068851_10359583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 849 | Open in IMG/M |
3300005841|Ga0068863_100715138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 996 | Open in IMG/M |
3300005842|Ga0068858_101100851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 780 | Open in IMG/M |
3300005842|Ga0068858_101518900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 661 | Open in IMG/M |
3300005843|Ga0068860_100242172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1754 | Open in IMG/M |
3300005843|Ga0068860_100915241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 893 | Open in IMG/M |
3300006057|Ga0075026_100828152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
3300006237|Ga0097621_100023861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 4768 | Open in IMG/M |
3300006806|Ga0079220_10023674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2630 | Open in IMG/M |
3300006844|Ga0075428_101370751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 743 | Open in IMG/M |
3300006854|Ga0075425_102048906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 639 | Open in IMG/M |
3300006871|Ga0075434_101598542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 660 | Open in IMG/M |
3300006904|Ga0075424_100207641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2081 | Open in IMG/M |
3300007076|Ga0075435_100853059 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300009131|Ga0115027_10912155 | Not Available | 680 | Open in IMG/M |
3300009156|Ga0111538_13953906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
3300009167|Ga0113563_10680323 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300009167|Ga0113563_12154548 | Not Available | 668 | Open in IMG/M |
3300009177|Ga0105248_12504526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 588 | Open in IMG/M |
3300009553|Ga0105249_12362001 | Not Available | 604 | Open in IMG/M |
3300009553|Ga0105249_13539000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
3300009870|Ga0131092_11440387 | Not Available | 527 | Open in IMG/M |
3300010360|Ga0126372_11774848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 660 | Open in IMG/M |
3300010371|Ga0134125_12531225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 558 | Open in IMG/M |
3300012094|Ga0136638_10385064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 659 | Open in IMG/M |
3300012185|Ga0136619_10094513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1146 | Open in IMG/M |
3300012200|Ga0137382_11135139 | Not Available | 557 | Open in IMG/M |
3300012469|Ga0150984_108130789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 786 | Open in IMG/M |
3300012469|Ga0150984_108338483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1036 | Open in IMG/M |
3300012509|Ga0157334_1010723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 861 | Open in IMG/M |
3300012924|Ga0137413_11139725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 619 | Open in IMG/M |
3300012955|Ga0164298_11061544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 603 | Open in IMG/M |
3300012958|Ga0164299_11312931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 554 | Open in IMG/M |
3300012986|Ga0164304_10804783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 725 | Open in IMG/M |
3300013100|Ga0157373_10762602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 712 | Open in IMG/M |
3300013104|Ga0157370_11684733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 569 | Open in IMG/M |
3300013104|Ga0157370_11918720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
3300013297|Ga0157378_12797301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 540 | Open in IMG/M |
3300013297|Ga0157378_12841187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 537 | Open in IMG/M |
3300013306|Ga0163162_11562460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 752 | Open in IMG/M |
3300013307|Ga0157372_12691836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 571 | Open in IMG/M |
3300013308|Ga0157375_10141484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2533 | Open in IMG/M |
3300014326|Ga0157380_10895526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Casimicrobiaceae → Casimicrobium → Casimicrobium huifangae | 913 | Open in IMG/M |
3300015372|Ga0132256_100337898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1598 | Open in IMG/M |
3300015373|Ga0132257_101538703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 850 | Open in IMG/M |
3300015373|Ga0132257_102205281 | Not Available | 713 | Open in IMG/M |
3300015374|Ga0132255_102989303 | Not Available | 722 | Open in IMG/M |
3300015374|Ga0132255_103026017 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300017787|Ga0183260_10746703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 616 | Open in IMG/M |
3300017789|Ga0136617_10384995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1135 | Open in IMG/M |
3300017959|Ga0187779_11184393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 537 | Open in IMG/M |
3300018073|Ga0184624_10305596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 713 | Open in IMG/M |
3300018431|Ga0066655_10745357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
3300018476|Ga0190274_13116351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
3300019356|Ga0173481_10353453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 703 | Open in IMG/M |
3300021445|Ga0182009_10353478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 751 | Open in IMG/M |
3300022213|Ga0224500_10197771 | Not Available | 740 | Open in IMG/M |
3300022214|Ga0224505_10302564 | Not Available | 607 | Open in IMG/M |
3300022892|Ga0247753_1048978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 540 | Open in IMG/M |
3300025878|Ga0209584_10268812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 654 | Open in IMG/M |
3300025907|Ga0207645_10025846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3797 | Open in IMG/M |
3300025907|Ga0207645_10772480 | Not Available | 653 | Open in IMG/M |
3300025909|Ga0207705_10216926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1452 | Open in IMG/M |
3300025912|Ga0207707_10423697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1141 | Open in IMG/M |
3300025923|Ga0207681_11209367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 635 | Open in IMG/M |
3300025936|Ga0207670_10010014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5439 | Open in IMG/M |
3300025937|Ga0207669_10195865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1462 | Open in IMG/M |
3300025937|Ga0207669_11145742 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300025938|Ga0207704_11734807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 537 | Open in IMG/M |
3300025940|Ga0207691_11660475 | Not Available | 518 | Open in IMG/M |
3300025941|Ga0207711_11617819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 591 | Open in IMG/M |
3300025945|Ga0207679_10634558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 965 | Open in IMG/M |
3300025945|Ga0207679_10911302 | Not Available | 804 | Open in IMG/M |
3300025951|Ga0210066_1060334 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300025960|Ga0207651_10615427 | Not Available | 951 | Open in IMG/M |
3300025972|Ga0207668_12101599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 508 | Open in IMG/M |
3300025981|Ga0207640_11016731 | Not Available | 730 | Open in IMG/M |
3300026041|Ga0207639_11583715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 615 | Open in IMG/M |
3300026041|Ga0207639_11972162 | Not Available | 545 | Open in IMG/M |
3300027787|Ga0209074_10101653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 973 | Open in IMG/M |
3300027885|Ga0209450_10568784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 829 | Open in IMG/M |
3300027890|Ga0209496_10471282 | Not Available | 663 | Open in IMG/M |
3300027890|Ga0209496_10658995 | Not Available | 570 | Open in IMG/M |
3300027899|Ga0209668_10112137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1603 | Open in IMG/M |
3300028379|Ga0268266_10870022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 871 | Open in IMG/M |
3300028381|Ga0268264_12021404 | Not Available | 585 | Open in IMG/M |
3300028592|Ga0247822_10268231 | Not Available | 1296 | Open in IMG/M |
3300028812|Ga0247825_10044420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2949 | Open in IMG/M |
3300028861|Ga0302259_1115608 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300028870|Ga0302254_10408830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 503 | Open in IMG/M |
3300029984|Ga0311332_11138881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 628 | Open in IMG/M |
3300029987|Ga0311334_10897876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
3300029987|Ga0311334_11752681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 529 | Open in IMG/M |
3300029990|Ga0311336_11995511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
3300030000|Ga0311337_11379269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 617 | Open in IMG/M |
3300030002|Ga0311350_11812040 | Not Available | 539 | Open in IMG/M |
3300030050|Ga0302255_1060238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
3300030294|Ga0311349_10036665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4469 | Open in IMG/M |
3300030294|Ga0311349_10215024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1810 | Open in IMG/M |
3300031152|Ga0307501_10231651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 542 | Open in IMG/M |
3300031232|Ga0302323_100200208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2017 | Open in IMG/M |
3300031232|Ga0302323_101309815 | Not Available | 812 | Open in IMG/M |
3300031247|Ga0265340_10407931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 599 | Open in IMG/M |
3300031543|Ga0318516_10853581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
3300031720|Ga0307469_10385289 | Not Available | 1191 | Open in IMG/M |
3300031722|Ga0311351_10619579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
3300031740|Ga0307468_102361661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
3300031779|Ga0318566_10519562 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300031834|Ga0315290_10937642 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300031834|Ga0315290_11076724 | Not Available | 673 | Open in IMG/M |
3300031873|Ga0315297_10273283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1404 | Open in IMG/M |
3300031873|Ga0315297_11295024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 594 | Open in IMG/M |
3300031873|Ga0315297_11462619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 553 | Open in IMG/M |
3300031893|Ga0318536_10200254 | Not Available | 1016 | Open in IMG/M |
3300031901|Ga0307406_10354491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1148 | Open in IMG/M |
3300031902|Ga0302322_100531339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1374 | Open in IMG/M |
3300031912|Ga0306921_10816672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1064 | Open in IMG/M |
3300031918|Ga0311367_12256052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
3300031943|Ga0310885_10757851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 549 | Open in IMG/M |
3300031944|Ga0310884_10243641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 980 | Open in IMG/M |
3300031997|Ga0315278_10553497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1180 | Open in IMG/M |
3300031997|Ga0315278_11394871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 678 | Open in IMG/M |
3300031997|Ga0315278_11632928 | Not Available | 615 | Open in IMG/M |
3300032075|Ga0310890_10409828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1009 | Open in IMG/M |
3300032143|Ga0315292_10244279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1481 | Open in IMG/M |
3300032144|Ga0315910_10332978 | Not Available | 1156 | Open in IMG/M |
3300032156|Ga0315295_11584292 | Not Available | 629 | Open in IMG/M |
3300032157|Ga0315912_10901090 | Not Available | 703 | Open in IMG/M |
3300032163|Ga0315281_10314368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1707 | Open in IMG/M |
3300032164|Ga0315283_12144012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 551 | Open in IMG/M |
3300032174|Ga0307470_11557973 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300032174|Ga0307470_11617096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 543 | Open in IMG/M |
3300032177|Ga0315276_10500654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1305 | Open in IMG/M |
3300032211|Ga0310896_10307702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 821 | Open in IMG/M |
3300032516|Ga0315273_11348225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 887 | Open in IMG/M |
3300033408|Ga0316605_11683143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 617 | Open in IMG/M |
3300033419|Ga0316601_100841841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
3300033482|Ga0316627_100960262 | Not Available | 825 | Open in IMG/M |
3300033557|Ga0316617_100429733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1176 | Open in IMG/M |
3300033557|Ga0316617_101195246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 754 | Open in IMG/M |
3300033557|Ga0316617_101337780 | Not Available | 717 | Open in IMG/M |
3300034150|Ga0364933_033548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 1256 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 9.14% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.43% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.43% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.29% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.29% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.29% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.14% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.14% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.14% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.14% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.14% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.14% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.14% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.57% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.57% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.57% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.57% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.57% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.57% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
3300012185 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ353 (21.06) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028861 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_4 | Environmental | Open in IMG/M |
3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_00131750 | 2199352024 | Soil | RGADPXXKDVNGRVMGKVAHEMTDAQMKAVADYAAGLR |
F14TC_1026527322 | 3300000559 | Soil | TQLKAFKAGERGADKEGKDANGMIMAAIAQRLTDAQMKALAEYTSGLR* |
JGIcombinedJ13530_1008881901 | 3300001213 | Wetland | ERGADKDGKDVNGKIMTAVAAKLTDAQMKAVAEYMQGLR* |
JGIcombinedJ13530_1088957852 | 3300001213 | Wetland | YAQLKAFGAGARGLDKEGKDASGRVMQAVAAKLTDDQMKALADYAAGLR* |
Ga0062595_1004083422 | 3300004479 | Soil | DGERGTDKEGKDYNGKIMATVAARMSDPQMKALAEYTSGLR* |
Ga0062383_102239202 | 3300004778 | Wetland Sediment | AFKAGERGADKDGKDVNGAIMVAIAAKMTDAQMKAAAEYTSGLR* |
Ga0062594_1027912882 | 3300005093 | Soil | SGERGADKGGKDVNGTIMATIAQRMTDAQMKAVAEYASGLR* |
Ga0066671_107658352 | 3300005184 | Soil | KLGQRGNDKDGKDINGRIMGTIASRLSDAQMKAVADYMAGLR* |
Ga0065715_101553191 | 3300005293 | Miscanthus Rhizosphere | KDGGRGADKDGKDAQGKIMAAIAQKMSDAQMKAVTDYAAGLR* |
Ga0070676_103972572 | 3300005328 | Miscanthus Rhizosphere | AFKSGERGNDAGGKDADGRVMADIAQKLTDTQMKALADYAAGLR* |
Ga0070676_104873261 | 3300005328 | Miscanthus Rhizosphere | GERGADKDGKDVNGRIMAAIAGRMSDAQMKAVADYMAGLHY* |
Ga0070660_1007042992 | 3300005339 | Corn Rhizosphere | QRGNDKDGKDVNGSIMVTIASRLTDAQMKAVADYLAGLR* |
Ga0070692_110634632 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | GERGNDAGGKDADGRIMAAIAQKLDDTQMKALADYAAGLR* |
Ga0070675_1006670001 | 3300005354 | Miscanthus Rhizosphere | ERGNDKDGKDTQGKIMWAVAQHMTDAQMKALADYAAGLR* |
Ga0070671_1013905122 | 3300005355 | Switchgrass Rhizosphere | FKTGERGNDKDGKDTQGKIMWAVAQHMTDAQMKALADYAAGLR* |
Ga0070671_1017886522 | 3300005355 | Switchgrass Rhizosphere | QRGNDKDGKDVNGRIMVDIASRLSDAQMKALADYMAGLR* |
Ga0070674_1008485522 | 3300005356 | Miscanthus Rhizosphere | YAQLQAFKTGERGNDKDGKDTQGKIMWAVAQHMTDAQMKALADYAAGLR* |
Ga0070673_1019251071 | 3300005364 | Switchgrass Rhizosphere | QRGNDKDGKDVNGRIMVDIASRLSDAQMKSLADYMAGLR* |
Ga0070688_1007543272 | 3300005365 | Switchgrass Rhizosphere | KAFKSGERGADKEGKDTNGMVMATIAQRLTDAQMKALAEYMSGLR* |
Ga0070667_1022194202 | 3300005367 | Switchgrass Rhizosphere | LKAFATGGRGADAAAKDTDGRIMVTIAQRMSDAQMKAVADYAAGLR* |
Ga0070694_1010821991 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | GERGADKEGKDANGKIMSTIAARMTDAQMKAIAEYTSGLR* |
Ga0070663_1005711152 | 3300005455 | Corn Rhizosphere | KAGQRGNDKDGKDVNGRIMVDIASRLSDAQMKSLADYMAGLR* |
Ga0070678_1011737421 | 3300005456 | Miscanthus Rhizosphere | ERGADAAGKDVNGRVMTAIASKMTDEQMKALADYAAGLR* |
Ga0070681_114661701 | 3300005458 | Corn Rhizosphere | KAFKSGARGADPGGKDVNGRIMASIAHDMTDAQMKAVADYAAGLR* |
Ga0068867_1002686361 | 3300005459 | Miscanthus Rhizosphere | AQLKAFKAGERGADKDGKDVNGKIMGTIAARMTDGQMKAVSDYMAGLRY* |
Ga0068867_1024126651 | 3300005459 | Miscanthus Rhizosphere | KGGERGADKDGKDANGAIMATVSSRMTEAQMKAVAEYASGLR* |
Ga0070741_110018511 | 3300005529 | Surface Soil | KAFKGGERGNDAAGKDANGRIMAAIAQKLSDAQMKALADYAAGLR* |
Ga0068855_1007631191 | 3300005563 | Corn Rhizosphere | DPGGKDASGRIMATIAGDMTDEQMKAVADYVMGLR* |
Ga0070664_1014024771 | 3300005564 | Corn Rhizosphere | GQRGNDKDGKDVNGRIMVDIASRLSDAQMKSLADYMAGLR* |
Ga0068854_1005722232 | 3300005578 | Corn Rhizosphere | FKAGERGADAAGKDINGRVMNAIAQQLSDAQMKAVADYAAGLR* |
Ga0068854_1011545392 | 3300005578 | Corn Rhizosphere | AFKSGERAADKAGKDVNGRIMADIARNMTDDEMKAVADYAMGLREAAQ* |
Ga0068859_1028875302 | 3300005617 | Switchgrass Rhizosphere | RGADPNGKDTNGRIMGVIAGKMTDYQMKAVADYMAGLRY* |
Ga0068864_1000452256 | 3300005618 | Switchgrass Rhizosphere | AFKGGERGADKDGKDANGAIMATVSSRMTEAQMKAVAEYASGLR* |
Ga0068851_103595832 | 3300005834 | Corn Rhizosphere | DAAGKDADGRIMASIAQKLDDTQMKALSDYAAGLR* |
Ga0068863_1007151381 | 3300005841 | Switchgrass Rhizosphere | DKEGKDYNGKIMATVAARMSDPQMRALAEYTSGLR* |
Ga0068858_1011008511 | 3300005842 | Switchgrass Rhizosphere | ADKEGKDTNGMVMATIAQRLTDAQMKALAEYMSGLR* |
Ga0068858_1015189002 | 3300005842 | Switchgrass Rhizosphere | YAQLVAFKSGQRGNDAAGKDAQGRIMAGVAAHMTDTQMKALADYAAGLR* |
Ga0068860_1002421721 | 3300005843 | Switchgrass Rhizosphere | GERGADKDGKDANGAIMATVSSRMTEAQMKAVAEYASGLR* |
Ga0068860_1009152412 | 3300005843 | Switchgrass Rhizosphere | LKAFKSGERGADKDANGTIMATIAQRMTDAQMKAVAEYASGLR* |
Ga0075026_1008281522 | 3300006057 | Watersheds | FKAGERGADKEGKDVNGKIMATIASRMTDAQMKAVADYMAGLRN* |
Ga0097621_1000238611 | 3300006237 | Miscanthus Rhizosphere | GERGADKEGKDVNGKIMAAIAGRMSDAQMKAVADYMAGLRN* |
Ga0079220_100236744 | 3300006806 | Agricultural Soil | AQLKAFKTGARGADPGGKDASGRIMATIAGDMTDEQMKAVADYVMGLR* |
Ga0075428_1013707511 | 3300006844 | Populus Rhizosphere | AQLKAFKAGERGADKDGKDVNGKIMATIAGRMTEAQMKAVADYMAGLRN* |
Ga0075425_1020489061 | 3300006854 | Populus Rhizosphere | RGGGDKAAKDANGAIMTTIAARLTDAQMKALADYIAGLH* |
Ga0075434_1015985421 | 3300006871 | Populus Rhizosphere | AFKNGERGADKAGKDGNGRIMATIANRMTDDQMKAVADYMAGLRN* |
Ga0075424_1002076414 | 3300006904 | Populus Rhizosphere | KEGKDYNGKIMATVAARMSDPQMRALAEYTSGLR* |
Ga0075435_1008530592 | 3300007076 | Populus Rhizosphere | ERGADPGGKDVNGRVMNTVAQQLTDAQMKAIADYAAGLR* |
Ga0115027_109121551 | 3300009131 | Wetland | DKEGKDVNGRIMAAIAGKMTDAQMKAVVEYTSALR* |
Ga0111538_139539061 | 3300009156 | Populus Rhizosphere | LKAFKAGERGADKDGKDVNGKIMATIASRMSDAQMKAVAD |
Ga0113563_106803231 | 3300009167 | Freshwater Wetlands | KAGKDVNGRNMAAIAAKMTDAQMKAVADYTAGLR* |
Ga0113563_121545482 | 3300009167 | Freshwater Wetlands | GERGADKDGKDVNGRIMAAIAAKMSDAQMKAVAEYAAGLH* |
Ga0105248_125045262 | 3300009177 | Switchgrass Rhizosphere | FKNGERGADKEGKDINGRIMATIAAKLTDEQMKAAAEYMSGLR* |
Ga0105249_123620012 | 3300009553 | Switchgrass Rhizosphere | DKEGKDYNGKIMATVAARMSDPQMKALAEYASGLR* |
Ga0105249_135390002 | 3300009553 | Switchgrass Rhizosphere | YAQLKAFKAGERGNDAGGKDADGRIMAAVAQRMTDTQMKALSDYAAGLR* |
Ga0131092_114403871 | 3300009870 | Activated Sludge | GERGADAAGKDVQGRTMAAVAARMSETQMKALADYASGLR* |
Ga0126372_117748481 | 3300010360 | Tropical Forest Soil | KEGKDLSGRIMGTIAKRMTDAQMKAVADYAAGLRAAEVALH* |
Ga0134125_125312251 | 3300010371 | Terrestrial Soil | KEGKDVNGRIMGMIASRLSDAQMKALADYLAGLR* |
Ga0136638_103850641 | 3300012094 | Polar Desert Sand | AGERGADKDGKDVQGRIMADITQKMSDADMKATADYAAGLR* |
Ga0136619_100945131 | 3300012185 | Polar Desert Sand | KAGERGADKDGKDVQGRIMGDITQKMTDGDMKAAADYAAGLR* |
Ga0137382_111351392 | 3300012200 | Vadose Zone Soil | AGERGADKEGKDLNGRIMATIAGRMTDSQMKAVADYMAGLRN* |
Ga0150984_1081307892 | 3300012469 | Avena Fatua Rhizosphere | ERGADAAGKDVNGRVMNTIAQQLTDAQMKAVADYAAGLR* |
Ga0150984_1083384832 | 3300012469 | Avena Fatua Rhizosphere | FKTGARGADPGGKDVNGRIMATIAGNMTDEQMKSIADYAMGLR* |
Ga0157334_10107232 | 3300012509 | Soil | ERGADPGGKDVNGRVMNTIAQQMTDAQMKAIADYAAGLR* |
Ga0137413_111397252 | 3300012924 | Vadose Zone Soil | AGGKDVNGRIMGTIAGKMTDSQMKAVADYMAGLRN* |
Ga0164298_110615441 | 3300012955 | Soil | KAFKAGERGADPWGKDANGRVMGKVAHEMTDAQMKAVADYAAGLR* |
Ga0164299_113129312 | 3300012958 | Soil | AGERGADAAGKDLNGRIMNTLAQKLRDAQMKALADYAAGLR* |
Ga0164304_108047832 | 3300012986 | Soil | DAAGKDINGRVMNAIAQQLSDAQMKAVADYAAGLR* |
Ga0157373_107626021 | 3300013100 | Corn Rhizosphere | AFKSGERGANAKDANGQIMATIAGNMTDAQMKAVADYAMGLR* |
Ga0157370_116847331 | 3300013104 | Corn Rhizosphere | VYAQLKAFKTGARGADPGGKDASGRIMATIAGDMTDEQMKVVADYVMGLR* |
Ga0157370_119187201 | 3300013104 | Corn Rhizosphere | VYAQLKAFKTGARGADPGGKDASGRIMATIAGDMTDEQMKAVADYVMGLR* |
Ga0157378_127973011 | 3300013297 | Miscanthus Rhizosphere | ADKEGKDYNGKIMATVAARMSDPQMKALAEYASGLR* |
Ga0157378_128411872 | 3300013297 | Miscanthus Rhizosphere | QLNAVKSGELVADKGVKDANGMIMATSAQRLTDEQMKALAEYMSGLR* |
Ga0163162_115624601 | 3300013306 | Switchgrass Rhizosphere | GERGADKDGKDVNGKIMGTIAARMTDGQMKAVSDYMAGLRY* |
Ga0157372_126918362 | 3300013307 | Corn Rhizosphere | FKSGERGADAAGKDQNGRIMNAIAQKMSDAQMKAIADYAAGLRD* |
Ga0157375_101414843 | 3300013308 | Miscanthus Rhizosphere | QLKAFKAGERGNDAGGKDADGRIMAAIAQKLDDTQMKALADYAAGLR* |
Ga0157380_108955262 | 3300014326 | Switchgrass Rhizosphere | RGSDPAGKDLNGKIMAGVARGMTDAQMKAVAEYAQGLR* |
Ga0132256_1003378981 | 3300015372 | Arabidopsis Rhizosphere | DAAGKDVNGRVMTTIATKMTDEQMKAIADYVAGLR* |
Ga0132257_1015387031 | 3300015373 | Arabidopsis Rhizosphere | QLKAFKAGERGADPGGKDVNGRGMNTVAQQLTDAQMKAIADYAAGLR* |
Ga0132257_1022052812 | 3300015373 | Arabidopsis Rhizosphere | DGERGADKEGKDYNGKIMATVAARMSDPQMKALAEYTSGLR* |
Ga0132255_1029893031 | 3300015374 | Arabidopsis Rhizosphere | LKAFKSGERGADKEGKDANGMIMATIAQRLTDAQMKALAEYMSGLR* |
Ga0132255_1030260171 | 3300015374 | Arabidopsis Rhizosphere | DEAGKDINGRIMAAITAKMTDAQMKAVAEYTSGLR* |
Ga0183260_107467031 | 3300017787 | Polar Desert Sand | KAGERGADKDGKDVQGKIMGDITQKMTEGDMKAAADYAAGLR |
Ga0136617_103849952 | 3300017789 | Polar Desert Sand | FKAGERGADKDGKDVQGKIMGDITQKMTEGDMKAAADYAAGLR |
Ga0187779_111843931 | 3300017959 | Tropical Peatland | FASGERGADKEGKDLNGRIMAAIASRMTDVQMKAVADYAAGLRAADVALR |
Ga0184624_103055962 | 3300018073 | Groundwater Sediment | DKDGKDAQGKIMAAIAQKMSDAQMKAVTDYAAGLR |
Ga0066655_107453572 | 3300018431 | Grasslands Soil | AFKAGERGNDKDGKDVNGRVMGLVAARMNDDQMRAAAEYVQGLR |
Ga0190274_131163512 | 3300018476 | Soil | MAFKSGQRGNDPAGKDAQGRIMAGVAAHMTDTQMKALADYAAGLR |
Ga0173481_103534531 | 3300019356 | Soil | SGERGNDAAGKDRNGRIMAGVARGMTDAQMKAVAEYAQGLR |
Ga0182009_103534781 | 3300021445 | Soil | ERGNDKDGKDVNGRVMGSVAARMNDNQMRAAAEYVQGLR |
Ga0224500_101977712 | 3300022213 | Sediment | ERGADKDGKDVNGAIMVTIAARMTDAQMKAAAEYTSGLR |
Ga0224505_103025641 | 3300022214 | Sediment | KAGERGADKDGKDVNGAIMVTIAARMTDAQMKAAAEYTSGLR |
Ga0247753_10489782 | 3300022892 | Soil | ADYTYAQLKAFKGGERGADKDGKDANGAIMATVSSRMTEAQMKAVAEYASGLR |
Ga0209584_102688122 | 3300025878 | Arctic Peat Soil | AGERGNDKDGKDVQGRIMWTVAQRMSDTQMKALADYASGLR |
Ga0207645_100258466 | 3300025907 | Miscanthus Rhizosphere | QLKAFKGGERGADKDGKDANGAIMATVSSRMTEAQMKAVAEYASGLR |
Ga0207645_107724802 | 3300025907 | Miscanthus Rhizosphere | ERGADKDGKDANGRIMATIAAKMTDAQMKAVAEYASGLH |
Ga0207705_102169262 | 3300025909 | Corn Rhizosphere | GADPGGKDASGRIMATIAGDMTDEQMKAVADYVMGLR |
Ga0207707_104236971 | 3300025912 | Corn Rhizosphere | RGADAGGKDVNGRVMTAIAGNMSDEQMKAVADYAMGLR |
Ga0207681_112093672 | 3300025923 | Switchgrass Rhizosphere | SGERGSDPAGKDRNGKIMAGVARGMTDAQMKAVAEYAQGLR |
Ga0207670_100100141 | 3300025936 | Switchgrass Rhizosphere | RGADPGGKDVNGRVMNTVAQQLTDAQMKAIADYAAGLR |
Ga0207669_101958652 | 3300025937 | Miscanthus Rhizosphere | QAFKTGDRGADKDGKDAQGKIMAAIAQKMSDAQMKAVTDYAAGLR |
Ga0207669_111457422 | 3300025937 | Miscanthus Rhizosphere | QLKAFRDGERGADKEGKDYNGKIMATVAARMSDPQMKALAEYASGLR |
Ga0207704_117348072 | 3300025938 | Miscanthus Rhizosphere | AFKSGERGADKDGKDANGSIMATIAAKMTDAQMKAVAEYASGLH |
Ga0207691_116604751 | 3300025940 | Miscanthus Rhizosphere | LKAFKAGERGADKEGKDVNGKIMATIAGRMTDAQMKAVADYMAGLRN |
Ga0207711_116178192 | 3300025941 | Switchgrass Rhizosphere | FKNGERGADKEGKDINGRIMATIAAKLTDEQMKAAAEYMSGLR |
Ga0207679_106345582 | 3300025945 | Corn Rhizosphere | NDKDGKDTQSKIMWAVAQHMTDAQMKALADYAAGLR |
Ga0207679_109113021 | 3300025945 | Corn Rhizosphere | FKAGERGNDAGGKDADGRIMAAIAQKLDDTQMKALADYAAGLR |
Ga0210066_10603341 | 3300025951 | Natural And Restored Wetlands | FKSGERGSDKDGKDVNGRIMATIAARMSDAQMKAVSEYASGLR |
Ga0207651_106154272 | 3300025960 | Switchgrass Rhizosphere | KAGQRGNDKDGKDVNGRIMVDIASRLSDAQMKSLADYMAGLR |
Ga0207668_121015992 | 3300025972 | Switchgrass Rhizosphere | YAQLKAFKAGERGADKEGKDTNGMIMATIAQRMTDAQMKAVAEYASGLR |
Ga0207640_110167312 | 3300025981 | Corn Rhizosphere | YAQLKAFKSGERAADKAGKDVNGRIMADIARNMTDDEMKAVADYAMGLREAAQ |
Ga0207639_115837151 | 3300026041 | Corn Rhizosphere | QLQAFKDGGRGADKDGKDAQGKIMAAIAQKMSDAQMKAVTDYAAGLR |
Ga0207639_119721621 | 3300026041 | Corn Rhizosphere | KAGERGADKEGKDTNGKIMTAIAAKMSDAQMKAAAEYVAGLR |
Ga0209074_101016532 | 3300027787 | Agricultural Soil | AGERGADAGGKDVNGRVMNTIAQQLTDAQMKAIADYAAGLR |
Ga0209450_105687841 | 3300027885 | Freshwater Lake Sediment | ADKEGKDVNGRIMAAVAAKLSDTQMKALAEYTAGLR |
Ga0209496_104712823 | 3300027890 | Wetland | AQLKAFKSGERAADAAGKDVNGRIMATIANKMTDDQMKAVAEGMK |
Ga0209496_106589952 | 3300027890 | Wetland | KAFKAGERGNDKDGKDLQGKIMAGVAARMTDTQMKALSDYVSGLR |
Ga0209668_101121372 | 3300027899 | Freshwater Lake Sediment | AGERGADKEGKDANGRIMAAVAAKLSDTQMKALAEYTTGLR |
Ga0268266_108700221 | 3300028379 | Switchgrass Rhizosphere | YGQLRAFKNGERGADPNGKDTNGRIMGVIAGKMTDYQMKAVADYMAGLRY |
Ga0268264_120214042 | 3300028381 | Switchgrass Rhizosphere | FRDGERGTDKEGKDYNGKIMATVAARMSDPQMKALAEYASGLR |
Ga0247822_102682312 | 3300028592 | Soil | GADKEGKDANGRIMHTIARQMSDTQMKAVAEYAAGLR |
Ga0247825_100444203 | 3300028812 | Soil | GADAAGKDVNGRVMTTIATKMTDEQMKAIADYVAGLR |
Ga0302259_11156082 | 3300028861 | Fen | DKDGKDVQGKVMATIAQKLSDAQMKAVTDYTAGLR |
Ga0302254_104088301 | 3300028870 | Fen | ADTEGKDVNGRIMVTIAGRMTDAQMKAAAEFTTGLQ |
Ga0311332_111388812 | 3300029984 | Fen | AGERGADKDGKDVQGKIMAAIAQKMSDAQMKAVTDYTAGLR |
Ga0311334_108978761 | 3300029987 | Fen | ADAEGKDVNGRIMVTIAGRMTDAQMKAAAEFTTGLQ |
Ga0311334_117526812 | 3300029987 | Fen | AGERGADKDGKDVQGKVMATIAQKMSDAQMKAVTDYTAGLR |
Ga0311336_119955111 | 3300029990 | Fen | LKAFKAGERGADKDGKDVNGRIMATIASRMSDAQMRSVAEYTSGLR |
Ga0311337_113792691 | 3300030000 | Fen | GDRGADKDGKDVQGKVMAAVAQKMSDEQMKAVADYSAGLR |
Ga0311350_118120401 | 3300030002 | Fen | GADKGGKDLNGRIMAAIAAKMTDAQMKAVTDYTAGLR |
Ga0302255_10602382 | 3300030050 | Fen | LKAFKAGERGADTDGKDVNGRIMVTIAGRMTDAQMKAAAEFTTGLQ |
Ga0311349_100366655 | 3300030294 | Fen | ERGADKDGKDVQGKIMAAIAQKMSDAQMKAVTDYTAGLR |
Ga0311349_102150241 | 3300030294 | Fen | AYAQLKAFKAGERGADKDGKDVQGKVMATIAQKLSDAQMKAVTDYTAGLR |
Ga0307501_102316512 | 3300031152 | Soil | DKAGKDANGRIMSAIAEKMSDDQMKAVADYMAGLRN |
Ga0302323_1002002084 | 3300031232 | Fen | AGERGADKDGKDVNGRIMVTIASRMTDAQMKAAAEFTTGLQ |
Ga0302323_1013098152 | 3300031232 | Fen | FKAGERGNDPAGKDAQGRIMGAVAARMTDTQMKALADYASGLR |
Ga0265340_104079312 | 3300031247 | Rhizosphere | DYAYAQLKAFKARERGADKEGKDVNGSIMATIATRMSDMQMKAVTDYTAGLR |
Ga0318516_108535811 | 3300031543 | Soil | LKAFRDGERGSDKEGKDYNGKIMATVAARMSDPQMKALAEYASGLR |
Ga0307469_103852892 | 3300031720 | Hardwood Forest Soil | ERGADKEGKDYNGKIMATVAARMSDPQMKALAEYTSGLR |
Ga0311351_106195791 | 3300031722 | Fen | AYAQLKAFKSGERGADKDGKDVQGRIMRAIAQKMSDEQMKAVADYTAGLR |
Ga0307468_1023616612 | 3300031740 | Hardwood Forest Soil | QLKAFRDGERGSDKEGTDYNGKIMATIAARMSDPQMKALAEYTSGLR |
Ga0318566_105195621 | 3300031779 | Soil | RDGERGSDKEGKDFNGKIMATVAARMSDPQMKALAEYASGLH |
Ga0315290_109376421 | 3300031834 | Sediment | AFKSGERGSDKDGKDVNGKIMATIAAKLTDGQMKAVAEYTSGLH |
Ga0315290_110767242 | 3300031834 | Sediment | TYAQLKAFKAGERGADKDGKDVNGAIMVAIAAKMTDAQMKAAAEYTSGLR |
Ga0315297_102732831 | 3300031873 | Sediment | KAFKAGERGADKDGKDVNGAIMVTVAARMTDAQMKAAAEYTSGLR |
Ga0315297_112950242 | 3300031873 | Sediment | TYMQLKSFKAGERGADKDGKDAQGRIMRAIAQKMSDDQMRAVADYTAGLR |
Ga0315297_114626192 | 3300031873 | Sediment | AFKNDERGADKDGRDINGKIMTMVAFKMSDAQMKAVAEYTAGLR |
Ga0318536_102002541 | 3300031893 | Soil | DLSGRIMGTIAKRMTDAQMKAVADYAAGLRAADVALH |
Ga0307406_103544911 | 3300031901 | Rhizosphere | QLKAFKSGERGNDAGGKDADGRIMAAIAQKLDDTQMKALADYAAGLR |
Ga0302322_1005313391 | 3300031902 | Fen | LKSFKAGERGADKDGKDVNGRIMVTIASRMTDAQMKAAAEFTTGLQ |
Ga0306921_108166721 | 3300031912 | Soil | DKDGKDVNGRIMATIAGRMTDAQMKAVADYMAGLRN |
Ga0311367_122560522 | 3300031918 | Fen | DKGGKDVNGRVMSQVAARMTDAEMQALAQYTSGLY |
Ga0310885_107578512 | 3300031943 | Soil | LKAFRAGERGNDAAGKDINGKIMAGVARGMTDAQMRAVAEYAQGLR |
Ga0310884_102436411 | 3300031944 | Soil | LKAFKAGERGADPGGKDVNGRVMNTVAQQMTDAQMKAIADYAAGLR |
Ga0315278_105534971 | 3300031997 | Sediment | RGADKDGKDVNGAIMVTIAAKMTDAQMKAAAEYTSGLR |
Ga0315278_113948711 | 3300031997 | Sediment | KAGERGADKDGKDVNGAIMVTVAARMTDAQMKAAAEYTSGLR |
Ga0315278_116329281 | 3300031997 | Sediment | FKAGERGADKDGKDVNGAIMVAIAAKMTDAQMKALAEYTSGLR |
Ga0310890_104098281 | 3300032075 | Soil | FKAGERGADPGGKDVNGRVMNTVAQQLTDAQMKAIADYAAGLR |
Ga0315292_102442791 | 3300032143 | Sediment | NDERGADKDGRDVNGKIMTTVAFKMSDAQMKAVAEYTAGLR |
Ga0315910_103329781 | 3300032144 | Soil | KAFKAGERGADPGGKDVNGRIMGAIARSMTDAQMKATAEFAQGLR |
Ga0315295_115842921 | 3300032156 | Sediment | DKDGKDVNGAIMVAIAAKMTDAQMKAAAEYTSGLR |
Ga0315912_109010902 | 3300032157 | Soil | TYAQLKAFKSGERGNDAAGKDADGRIMASIAQKLDDTQMKALADYAAGLR |
Ga0315281_103143683 | 3300032163 | Sediment | YAQLKAFKAGERGADKEGKDVNGMIMVTVAARMTDAQMKAVAEYTLGLR |
Ga0315283_121440121 | 3300032164 | Sediment | RGADKDGKDVNGAIMVTVAARMTDAQMKAAAEYTSGLR |
Ga0307470_115579732 | 3300032174 | Hardwood Forest Soil | FHMGERGADKEGKDANGKIMAAIAFKMNDEQMRAVAEYLAGLH |
Ga0307470_116170961 | 3300032174 | Hardwood Forest Soil | YAQLRAFRVGERGADKDGKDVNGKIMATIAGRMTDAQMKAVADYMAGLRN |
Ga0315276_105006543 | 3300032177 | Sediment | GADKDGKDVNGAIMVTVAARMTDAQMKAAAEYTSGLR |
Ga0310896_103077021 | 3300032211 | Soil | AFKAGERGADAAGKDVNGRVMTTIATKMTDEQMKAIADYVAGLR |
Ga0315273_113482252 | 3300032516 | Sediment | FKAGERGADKDGKDVNGAIMVTVAARMTDAQMKAAAEYTSGLR |
Ga0316605_116831431 | 3300033408 | Soil | DKEGKDVNGRIMAAVAAKLSDTQMKALAEYTAGLR |
Ga0316601_1008418411 | 3300033419 | Soil | ERGADKEGKDVNGRIMAAIAAKMTDAQMKALADYTAGLR |
Ga0316627_1009602621 | 3300033482 | Soil | LKAFKSGERAADAAGKDVNGRIMATIANKMTDDQMKAVAEYTSGLR |
Ga0316617_1004297332 | 3300033557 | Soil | KAFRAGDRGADKGGKDLNGRIMATIAARMTDAQMRAAAEFTQGLR |
Ga0316617_1011952461 | 3300033557 | Soil | LKAFKAGERGVDKEGKDINGRIMTAVAAKLTDAQMKALAEYTQGLR |
Ga0316617_1013377801 | 3300033557 | Soil | GTRGADKEGKDVNGRIMAAIAAKMTDKQMKAVVEYTSALR |
Ga0364933_033548_1149_1256 | 3300034150 | Sediment | DKDGKDVSGTIMVTVAARMSDAQMKAVAEYASGLR |
⦗Top⦘ |