| Basic Information | |
|---|---|
| Family ID | F034221 |
| Family Type | Metagenome |
| Number of Sequences | 175 |
| Average Sequence Length | 44 residues |
| Representative Sequence | AVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETELATERR |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.29 % |
| % of genes near scaffold ends (potentially truncated) | 96.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.86 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.286 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF13795 | HupE_UreJ_2 | 41.71 |
| PF00215 | OMPdecase | 0.57 |
| PF07730 | HisKA_3 | 0.57 |
| PF00593 | TonB_dep_Rec | 0.57 |
| PF04433 | SWIRM | 0.57 |
| PF01464 | SLT | 0.57 |
| PF07638 | Sigma70_ECF | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.57 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.57 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.57 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.57 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.43 % |
| Unclassified | root | N/A | 32.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309009|GPKNP_F5JHDJD02GVYJQ | Not Available | 510 | Open in IMG/M |
| 3300000955|JGI1027J12803_103845692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300000956|JGI10216J12902_103075277 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300000956|JGI10216J12902_108544588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300002244|JGI24742J22300_10102804 | Not Available | 554 | Open in IMG/M |
| 3300002568|C688J35102_118374185 | Not Available | 553 | Open in IMG/M |
| 3300004114|Ga0062593_101483212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 730 | Open in IMG/M |
| 3300004156|Ga0062589_101456402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300004156|Ga0062589_101760617 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300004463|Ga0063356_104463621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300004480|Ga0062592_101555535 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300004480|Ga0062592_102420844 | Not Available | 527 | Open in IMG/M |
| 3300004480|Ga0062592_102452608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti | 524 | Open in IMG/M |
| 3300005175|Ga0066673_10473859 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005288|Ga0065714_10460573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300005289|Ga0065704_10060962 | Not Available | 624 | Open in IMG/M |
| 3300005289|Ga0065704_10828729 | Not Available | 508 | Open in IMG/M |
| 3300005294|Ga0065705_10048784 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300005294|Ga0065705_11021812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 541 | Open in IMG/M |
| 3300005295|Ga0065707_10008578 | All Organisms → cellular organisms → Bacteria | 2648 | Open in IMG/M |
| 3300005328|Ga0070676_10538877 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005330|Ga0070690_100404112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 1004 | Open in IMG/M |
| 3300005335|Ga0070666_11382142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 526 | Open in IMG/M |
| 3300005336|Ga0070680_100461175 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005338|Ga0068868_101465903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Congregibacter → Congregibacter litoralis | 638 | Open in IMG/M |
| 3300005338|Ga0068868_101537554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300005338|Ga0068868_101596002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300005353|Ga0070669_101632011 | Not Available | 561 | Open in IMG/M |
| 3300005354|Ga0070675_100805649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 859 | Open in IMG/M |
| 3300005364|Ga0070673_100082401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2611 | Open in IMG/M |
| 3300005364|Ga0070673_101142018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300005434|Ga0070709_10816528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 733 | Open in IMG/M |
| 3300005439|Ga0070711_101186495 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005441|Ga0070700_100882656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
| 3300005444|Ga0070694_101613441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300005455|Ga0070663_102070951 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005457|Ga0070662_100269261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1375 | Open in IMG/M |
| 3300005457|Ga0070662_101948876 | Not Available | 508 | Open in IMG/M |
| 3300005458|Ga0070681_11108210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
| 3300005459|Ga0068867_100454892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300005543|Ga0070672_101363427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 634 | Open in IMG/M |
| 3300005544|Ga0070686_101768194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300005618|Ga0068864_100020377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5547 | Open in IMG/M |
| 3300005618|Ga0068864_101052378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 808 | Open in IMG/M |
| 3300005618|Ga0068864_102147811 | Not Available | 565 | Open in IMG/M |
| 3300005843|Ga0068860_101743271 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300006237|Ga0097621_101603495 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006237|Ga0097621_102345251 | Not Available | 511 | Open in IMG/M |
| 3300006358|Ga0068871_100543103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300006358|Ga0068871_102373575 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300006844|Ga0075428_100005034 | All Organisms → cellular organisms → Bacteria | 14689 | Open in IMG/M |
| 3300006846|Ga0075430_100183774 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300006847|Ga0075431_101127550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300006871|Ga0075434_102474334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300006881|Ga0068865_101379225 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006931|Ga0097620_101509591 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300006969|Ga0075419_10920244 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009094|Ga0111539_12371260 | Not Available | 616 | Open in IMG/M |
| 3300009100|Ga0075418_11112289 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300009148|Ga0105243_11446483 | Not Available | 709 | Open in IMG/M |
| 3300009148|Ga0105243_12464283 | Not Available | 559 | Open in IMG/M |
| 3300009156|Ga0111538_10168031 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
| 3300009177|Ga0105248_12227970 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009545|Ga0105237_11699986 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009551|Ga0105238_11196006 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009553|Ga0105249_13001927 | Not Available | 542 | Open in IMG/M |
| 3300009610|Ga0105340_1140790 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300009610|Ga0105340_1514300 | Not Available | 535 | Open in IMG/M |
| 3300010036|Ga0126305_10050856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 2349 | Open in IMG/M |
| 3300010036|Ga0126305_10752572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300010373|Ga0134128_12363611 | Not Available | 586 | Open in IMG/M |
| 3300011430|Ga0137423_1251597 | Not Available | 523 | Open in IMG/M |
| 3300011441|Ga0137452_1043939 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300011443|Ga0137457_1316974 | Not Available | 532 | Open in IMG/M |
| 3300012480|Ga0157346_1032385 | Not Available | 515 | Open in IMG/M |
| 3300012488|Ga0157343_1033716 | Not Available | 528 | Open in IMG/M |
| 3300012494|Ga0157341_1024354 | Not Available | 617 | Open in IMG/M |
| 3300012503|Ga0157313_1034337 | Not Available | 592 | Open in IMG/M |
| 3300012892|Ga0157294_10103322 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012897|Ga0157285_10140586 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300012900|Ga0157292_10061657 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300012914|Ga0157297_10255586 | Not Available | 637 | Open in IMG/M |
| 3300012955|Ga0164298_10443458 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300012957|Ga0164303_10340109 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300012957|Ga0164303_10340385 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300012957|Ga0164303_10933089 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012960|Ga0164301_10798878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300012961|Ga0164302_10249997 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300012986|Ga0164304_10278849 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300012986|Ga0164304_11347427 | Not Available | 583 | Open in IMG/M |
| 3300012989|Ga0164305_10699002 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012989|Ga0164305_11735662 | Not Available | 561 | Open in IMG/M |
| 3300013296|Ga0157374_10068069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3349 | Open in IMG/M |
| 3300013297|Ga0157378_13191993 | Not Available | 509 | Open in IMG/M |
| 3300013306|Ga0163162_12465791 | Not Available | 598 | Open in IMG/M |
| 3300013308|Ga0157375_10925255 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300013500|Ga0120195_1001179 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300014745|Ga0157377_10662845 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300014968|Ga0157379_12388802 | Not Available | 527 | Open in IMG/M |
| 3300014969|Ga0157376_11059912 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300015077|Ga0173483_10248441 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300015372|Ga0132256_100208541 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300015373|Ga0132257_101841050 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300015373|Ga0132257_101977974 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300015373|Ga0132257_102294001 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300015373|Ga0132257_102432019 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300015374|Ga0132255_103043468 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300015374|Ga0132255_103406498 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300015374|Ga0132255_103889628 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300015374|Ga0132255_105325969 | Not Available | 544 | Open in IMG/M |
| 3300015374|Ga0132255_105618119 | Not Available | 531 | Open in IMG/M |
| 3300018084|Ga0184629_10305723 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300018469|Ga0190270_10452786 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300018469|Ga0190270_13422931 | Not Available | 503 | Open in IMG/M |
| 3300018476|Ga0190274_12852882 | Not Available | 579 | Open in IMG/M |
| 3300018481|Ga0190271_10452571 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300018481|Ga0190271_12797768 | Not Available | 586 | Open in IMG/M |
| 3300018481|Ga0190271_12977564 | Not Available | 568 | Open in IMG/M |
| 3300019361|Ga0173482_10058562 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300019362|Ga0173479_10504968 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300023064|Ga0247801_1077451 | Not Available | 539 | Open in IMG/M |
| 3300023066|Ga0247793_1057741 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025290|Ga0207673_1056049 | Not Available | 560 | Open in IMG/M |
| 3300025900|Ga0207710_10501049 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300025903|Ga0207680_11177471 | Not Available | 547 | Open in IMG/M |
| 3300025903|Ga0207680_11329646 | Not Available | 511 | Open in IMG/M |
| 3300025907|Ga0207645_10522591 | Not Available | 804 | Open in IMG/M |
| 3300025916|Ga0207663_10476163 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300025924|Ga0207694_11489096 | Not Available | 571 | Open in IMG/M |
| 3300025925|Ga0207650_10307115 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300025933|Ga0207706_11125886 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025933|Ga0207706_11376571 | Not Available | 580 | Open in IMG/M |
| 3300025935|Ga0207709_10240607 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300025938|Ga0207704_11853124 | Not Available | 519 | Open in IMG/M |
| 3300025940|Ga0207691_10521091 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300025940|Ga0207691_11554439 | Not Available | 539 | Open in IMG/M |
| 3300025961|Ga0207712_10624752 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300025986|Ga0207658_10540405 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300025986|Ga0207658_10771172 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300026067|Ga0207678_11282256 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026075|Ga0207708_10951103 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300026089|Ga0207648_10651692 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300026538|Ga0209056_10485138 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300026841|Ga0207490_1002378 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300026960|Ga0207582_1031927 | Not Available | 507 | Open in IMG/M |
| 3300027471|Ga0209995_1055271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300027526|Ga0209968_1045310 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027543|Ga0209999_1070720 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027552|Ga0209982_1049188 | Not Available | 679 | Open in IMG/M |
| 3300027665|Ga0209983_1106775 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300027821|Ga0209811_10083565 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300027873|Ga0209814_10152172 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300027880|Ga0209481_10679241 | Not Available | 535 | Open in IMG/M |
| 3300027909|Ga0209382_11918401 | Not Available | 572 | Open in IMG/M |
| 3300031226|Ga0307497_10370916 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031366|Ga0307506_10471537 | Not Available | 527 | Open in IMG/M |
| 3300031562|Ga0310886_10765359 | Not Available | 606 | Open in IMG/M |
| 3300031847|Ga0310907_10187496 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300031847|Ga0310907_10700985 | Not Available | 560 | Open in IMG/M |
| 3300031854|Ga0310904_10016283 | All Organisms → cellular organisms → Bacteria | 3159 | Open in IMG/M |
| 3300031858|Ga0310892_10622295 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031858|Ga0310892_11200818 | Not Available | 540 | Open in IMG/M |
| 3300031901|Ga0307406_10229126 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300031908|Ga0310900_11852452 | Not Available | 514 | Open in IMG/M |
| 3300031940|Ga0310901_10213973 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300031943|Ga0310885_10078588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
| 3300032005|Ga0307411_11457119 | Not Available | 628 | Open in IMG/M |
| 3300032012|Ga0310902_11009201 | Not Available | 578 | Open in IMG/M |
| 3300032017|Ga0310899_10464567 | Not Available | 616 | Open in IMG/M |
| 3300032075|Ga0310890_10534142 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300032122|Ga0310895_10460477 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300032179|Ga0310889_10108170 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300032180|Ga0307471_104177203 | Not Available | 510 | Open in IMG/M |
| 3300033551|Ga0247830_11554961 | Not Available | 529 | Open in IMG/M |
| 3300034417|Ga0364941_012583 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.29% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.43% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.43% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.43% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.29% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.29% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.71% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.14% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.57% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309009 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026841 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPKNP_04794190 | 2070309009 | Soil | VRDHVVREWENERRQRARNDAYTRMRGEYQVSIETELATQRR |
| JGI1027J12803_1038456921 | 3300000955 | Soil | PQLAAVRDHVVREWENERRQRARNDAYAKMRGGYEVSIEAKPSMELR* |
| JGI10216J12902_1030752772 | 3300000956 | Soil | AVRDQVIREWENDRRQRARVEAYARMRKGYDVSIDATLPGPQQ* |
| JGI10216J12902_1085445882 | 3300000956 | Soil | LADVHDVVVREWENERRQRARNDAYARMRGAYEVTIDTEPQTGRP* |
| JGI24742J22300_101028042 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | HVVREWENERRQRARTDAYARMRGEYEISMVANAPAEQP* |
| C688J35102_1183741851 | 3300002568 | Soil | PAVAPQLPAVRDQVVREWENERRQRARNDAYTKMRGDYQVSVETELATERR* |
| Ga0062593_1014832122 | 3300004114 | Soil | PQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR* |
| Ga0062589_1014564021 | 3300004156 | Soil | TPAKAPALAAVHDQVVREWENDRRQRARHEAYTRMRSGYEIRLEARPPAEPR* |
| Ga0062589_1017606172 | 3300004156 | Soil | TPRLADVRDQVVREWENERRRRARDESYTKMRAGYSVSIDATLPAQP* |
| Ga0063356_1044636211 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AVRDHVVREWENDRRQRARNDAYTKMRREYQVSIETKPAAGRR* |
| Ga0062592_1015555352 | 3300004480 | Soil | RDHVLREWENERRLRARTDAYARMRAGYQISIETKPAPERP* |
| Ga0062592_1024208441 | 3300004480 | Soil | RDQVVREWENERRRRARDESYTKMRAGYSVSIDATLPAQP* |
| Ga0062592_1024526081 | 3300004480 | Soil | AVRDQVVREWENERRQRARTDAYAKMRGEYEVSIEAKPAERP* |
| Ga0066673_104738591 | 3300005175 | Soil | VRDHVAREWENERRQRARNDAYARMRGEYTVSIETGPKTATARR* |
| Ga0065714_104605731 | 3300005288 | Miscanthus Rhizosphere | QLAAVRDQVVREWENERRQRARNDAYARMRGEYQVSVETTKATAGR* |
| Ga0065704_100609621 | 3300005289 | Switchgrass Rhizosphere | PAAAPQLAAVRDHVVREWENERRQRARTDAYTKMRGGYQVSIETTLVATRR* |
| Ga0065704_108287292 | 3300005289 | Switchgrass Rhizosphere | PQLAAVRDHVVREWENERRQRARNEAYARMRERYEVSIAATAPTEQP* |
| Ga0065705_100487843 | 3300005294 | Switchgrass Rhizosphere | PVVAPQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR* |
| Ga0065705_110218121 | 3300005294 | Switchgrass Rhizosphere | SDRTPAVAQQLAAVRDHVMREWENERRQRARTDAYAKMRGEYEVSIEAKPTERP* |
| Ga0065707_100085783 | 3300005295 | Switchgrass Rhizosphere | VRDHVVREWENERRQRARNDAYTKMRGEYAVSIETKVPTERR* |
| Ga0070676_105388772 | 3300005328 | Miscanthus Rhizosphere | VRDHVVREWENERRQRARTDAYARMRGEYEISMVANAPAEQP* |
| Ga0070690_1004041122 | 3300005330 | Switchgrass Rhizosphere | VAPQLAAVRDHVVREWENERRERARTDAYTTMRREYAVSIEAKPTERP* |
| Ga0070666_113821422 | 3300005335 | Switchgrass Rhizosphere | LAAVRDQVVREWEHERRLHARNDAYARMRGRYTVSIETKPPTQRP* |
| Ga0070680_1004611751 | 3300005336 | Corn Rhizosphere | QVVREWENDRRLRARADAYGRMRREYEVSIEAALPAGRP* |
| Ga0068868_1014659032 | 3300005338 | Miscanthus Rhizosphere | SDRTPAAAPPLAAVHDAVAREWENERRQRARQDAYARARSEYQVSIEGKAMTAQP* |
| Ga0068868_1015375541 | 3300005338 | Miscanthus Rhizosphere | AVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETELATERR* |
| Ga0068868_1015960022 | 3300005338 | Miscanthus Rhizosphere | PALAAVHDQVVREWENDRRQRARHDAYTRMRSGYEIRIEAKPPTEPR* |
| Ga0070669_1016320111 | 3300005353 | Switchgrass Rhizosphere | AAVRDHVVREWENERRQRARHDAYTKMRSEYQVSIETELATTRR* |
| Ga0070675_1008056492 | 3300005354 | Miscanthus Rhizosphere | RDQVVREWENDRRQRARNDAYARMRGRYDVSIEAPASRP* |
| Ga0070673_1000824013 | 3300005364 | Switchgrass Rhizosphere | LAAVRDHVVREWENERRQRARNEAYARMRERYEVSIAATAPTEQP* |
| Ga0070673_1011420181 | 3300005364 | Switchgrass Rhizosphere | AAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKPATKRR* |
| Ga0070709_108165281 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | APQLAAVRDHVVREWENERRQRARRDAYTKMRGEYRVSIETELATERR* |
| Ga0070711_1011864951 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | QLNAVRDHVVREWENERRQRARNDAYVKMRGEYTVRIETKPPTERP* |
| Ga0070700_1008826561 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | QVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR* |
| Ga0070694_1016134411 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR* |
| Ga0070663_1020709511 | 3300005455 | Corn Rhizosphere | SDRTHAVMPQLTAVRDQVEREWENERRQRARNDAYTKMRGEYQVTIEPKPLTDAR* |
| Ga0070662_1002692612 | 3300005457 | Corn Rhizosphere | RDQVVREWEHERRLHARNDAYARMRGRYTVSIETKPPTQRP* |
| Ga0070662_1019488761 | 3300005457 | Corn Rhizosphere | HVVREWENDRRQRARNDAYAKMRGAYQVSIETGLATTRR* |
| Ga0070681_111082102 | 3300005458 | Corn Rhizosphere | RVVREWENERRQRARDDAYARMRGEYTVSIETKPPTRRP* |
| Ga0068867_1004548922 | 3300005459 | Miscanthus Rhizosphere | VRDHVVREWENERRQRARTDAYAKMRGAYEISLEAKPTERP* |
| Ga0070672_1013634271 | 3300005543 | Miscanthus Rhizosphere | AVPPQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR* |
| Ga0070686_1017681941 | 3300005544 | Switchgrass Rhizosphere | PAVAPELAAVRNQVVREWENDRRQRARNDAYARMRGGYDVRIEAPARR* |
| Ga0068864_1000203771 | 3300005618 | Switchgrass Rhizosphere | VRDHVVREWENERRQRARNEAYARMREGYEVSIAATAPTEQP* |
| Ga0068864_1010523782 | 3300005618 | Switchgrass Rhizosphere | AVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETKLATEQR* |
| Ga0068864_1021478112 | 3300005618 | Switchgrass Rhizosphere | DAVAREWENERRQRARQDAYARARSEYQVSIEGKAMTAQP* |
| Ga0068860_1017432711 | 3300005843 | Switchgrass Rhizosphere | EWENDRRQRARNDAYTKMRSEYQVSIETKLATERR* |
| Ga0097621_1016034952 | 3300006237 | Miscanthus Rhizosphere | VVREWENERRQRARNEAYAKMRDGYAVGIEAKTAAERR* |
| Ga0097621_1023452511 | 3300006237 | Miscanthus Rhizosphere | REWENERRQRARNDAYAKMRGGYEVRVETTTPSEGR* |
| Ga0068871_1005431032 | 3300006358 | Miscanthus Rhizosphere | VRDHVVREWENERRQRARNDAYAKMRGGYEVRVETTTPSEGR* |
| Ga0068871_1023735752 | 3300006358 | Miscanthus Rhizosphere | VVRDQVVREWENERRQRARNDAYTKMRGEYIVSIESEPPIERP* |
| Ga0075428_10000503415 | 3300006844 | Populus Rhizosphere | AVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETMLATERR* |
| Ga0075430_1001837743 | 3300006846 | Populus Rhizosphere | VRDHVVREWENERRQRARNDAYTTMRGEYQVSIETKLATEQQ* |
| Ga0075431_1011275502 | 3300006847 | Populus Rhizosphere | PQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETMLATERR* |
| Ga0075434_1024743341 | 3300006871 | Populus Rhizosphere | AVRDQVVREWENDRRQRARNDAYAKMRGEYQVSNETKLATEPR* |
| Ga0068865_1013792251 | 3300006881 | Miscanthus Rhizosphere | VVREWENDRRQRARNDAYTKMRGEYIVSIESEPPIERP* |
| Ga0097620_1015095911 | 3300006931 | Switchgrass Rhizosphere | RDHVVREWENERRQRARNDAYTKMRGEYQVSIETKLATEQR* |
| Ga0075419_109202442 | 3300006969 | Populus Rhizosphere | VVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR* |
| Ga0111539_123712601 | 3300009094 | Populus Rhizosphere | PQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETKLATEQR* |
| Ga0075418_111122892 | 3300009100 | Populus Rhizosphere | AVRDQVVREWENERRQRARNDAYTKMRRGYEVSIEAKPSTERR* |
| Ga0105243_114464831 | 3300009148 | Miscanthus Rhizosphere | LAAVRDQVVREWESDRRQRARNDAYAKMRSGYEIRIEAESSAERR* |
| Ga0105243_124642831 | 3300009148 | Miscanthus Rhizosphere | AAPQLAAVRDHVVREWENERRQRARNDAYTKVRGEYQVSLETDLATERR* |
| Ga0111538_101680311 | 3300009156 | Populus Rhizosphere | DHVVREWENERRQRARNDAYARMRGEYEVSMEAKAPAERP* |
| Ga0105248_122279701 | 3300009177 | Switchgrass Rhizosphere | LADVHDQVVREWENDRRQRARNDAYTKMRAEYQVSIETDLPAEQR* |
| Ga0105237_116999861 | 3300009545 | Corn Rhizosphere | EWENERRLRARNDAYTRMRGDYQVSIETAQATKRQ* |
| Ga0105238_111960061 | 3300009551 | Corn Rhizosphere | RDQVVREWENERRQRSRNEAYAKMRREYQVSIETELTTQRR* |
| Ga0105249_130019272 | 3300009553 | Switchgrass Rhizosphere | ERIPAVAPQLAAVRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP* |
| Ga0105340_11407902 | 3300009610 | Soil | EWENERRQRARTDAYAKMRGEYEVSIETKPTERP* |
| Ga0105340_15143002 | 3300009610 | Soil | QLTAVRDQVVREWENERRQRARNDAYTNMRGEYQVDIETEPATERR* |
| Ga0126305_100508565 | 3300010036 | Serpentine Soil | LAAVRDRVVREWENDRRLRARTAAYARMRAGYEISIETKSPADRP* |
| Ga0126305_107525721 | 3300010036 | Serpentine Soil | AAPQLAAVRDHVVREWENERRQRARNDAYTNMRGEYQVSIETKLATERR* |
| Ga0134128_123636112 | 3300010373 | Terrestrial Soil | DQVVREWENERRQRARNDAYTKMRGEYTVSIETKPPTERP* |
| Ga0137423_12515971 | 3300011430 | Soil | AAPPLAAVRDYVMREWENERRQRARTDAYAKMRGGYEVSIEAKTPAERR* |
| Ga0137452_10439393 | 3300011441 | Soil | PLAAVRDYVMREWENERRQRARTDAYAKMRGGYEVSIEAKTPAERR* |
| Ga0137457_13169741 | 3300011443 | Soil | AAAPPLAAVRDYVMREWENERRQRARTDAYAKMRGGYEVSIEAKTPAERR* |
| Ga0157346_10323852 | 3300012480 | Arabidopsis Rhizosphere | WENDRRQRARTDAYAKMRGDYQVSIETTLAAERR* |
| Ga0157343_10337161 | 3300012488 | Arabidopsis Rhizosphere | TPAVAPELAAVRDQVVREWENDRRQRARNDAYTKMRGAYHVSIETKLATARR* |
| Ga0157341_10243541 | 3300012494 | Arabidopsis Rhizosphere | AVAPQLAAVRDQVVREWENERRLRARTDAYARMRGEYEVSVEARPTTERP* |
| Ga0157313_10343372 | 3300012503 | Arabidopsis Rhizosphere | AVRDQVVREWENERRRRARNDAYARMRGEYQVGIETTLATQRR* |
| Ga0157294_101033222 | 3300012892 | Soil | VREWENERRQRARNDAYTKMRGGYQVSIETKLATERR* |
| Ga0157285_101405862 | 3300012897 | Soil | DHVVREWENERRQRARTDAYRKMRGEYQVSIETGPATERR* |
| Ga0157292_100616572 | 3300012900 | Soil | AVRDHVVREWENDRRQRARNDAYTKLRGEYQVSIETKPATERR* |
| Ga0157297_102555862 | 3300012914 | Soil | VRDQVVREWENERRQRARTDAYAKMRGEYQVDIEMKLPTQRR* |
| Ga0164298_104434581 | 3300012955 | Soil | WENDRRQRARNDAYTKLRGEYDVSIETRPATAQR* |
| Ga0164303_103401091 | 3300012957 | Soil | AVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETEPATERR* |
| Ga0164303_103403852 | 3300012957 | Soil | LAAVRDQVVREWEHARRQRARNEAYAKMRGEYPVSVGTELAPERR* |
| Ga0164303_109330892 | 3300012957 | Soil | VREWENDRRQRARRDAYTKMRGEYRVSVETELATERR* |
| Ga0164301_107988782 | 3300012960 | Soil | VPAAAPQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSRETKRATERR* |
| Ga0164302_102499972 | 3300012961 | Soil | EWENERRQRARDDTYMKMRGEYQVTIEPEPATKRR* |
| Ga0164304_102788491 | 3300012986 | Soil | LAAVRDHVVREWENERRQRARNDAYAKMRGEYQVSIETKLTTERR* |
| Ga0164304_113474271 | 3300012986 | Soil | APQLAAVRDHVVREWENERRQRARNDAYTKIRGEYQISIETKPATERR* |
| Ga0164305_106990022 | 3300012989 | Soil | QVVREWENDRRQRARNDAYAKMRSGYEIRIEAESSAERR* |
| Ga0164305_117356622 | 3300012989 | Soil | PQLAAVRDHVVREWENERRQRARNDAYTKMRGEYTVSIEPELATERR* |
| Ga0157374_100680691 | 3300013296 | Miscanthus Rhizosphere | VREWENDRRQRARNDAYARMRGRYDVSIEAPASRP* |
| Ga0157378_131919932 | 3300013297 | Miscanthus Rhizosphere | EWENERRQRARNDAYTKMRGGYQVSVETELATERR* |
| Ga0163162_124657912 | 3300013306 | Switchgrass Rhizosphere | VREWENERRQRARNDAYTKMRSEYDVAVETKPTTMLPTARP* |
| Ga0157375_109252551 | 3300013308 | Miscanthus Rhizosphere | LAAVRDHVVREWENDRRQRARNDAYAKMRGDYQVSIETKLATERR* |
| Ga0120195_10011792 | 3300013500 | Terrestrial | VRDQVVREWENERRQRARNDAYAKMRGEYQVTIETKLATERR* |
| Ga0157377_106628452 | 3300014745 | Miscanthus Rhizosphere | VRDHVVREWENERRERARTDAYTTMRREYEVSIEAKPTERP* |
| Ga0157379_123888022 | 3300014968 | Switchgrass Rhizosphere | WENDRRQRARNDAYTKMRGEYIVSIESEPPIERP* |
| Ga0157376_110599122 | 3300014969 | Miscanthus Rhizosphere | AAVRGQVVREWENDRRQRARDDAYTKMRGEYQVSVETEPATGRR* |
| Ga0173483_102484412 | 3300015077 | Soil | VVREWENERRQRARSDAYAKMRGECQVSIETELATERR* |
| Ga0132256_1002085413 | 3300015372 | Arabidopsis Rhizosphere | LAAVRDQVVREWENARRQRARSEAYTKMQGGYRVSIETGLATKRR* |
| Ga0132257_1018410502 | 3300015373 | Arabidopsis Rhizosphere | LAAVRDHVVREWENDRRQRARTDAYAKMRGDYQVSIETTLAAERR* |
| Ga0132257_1019779741 | 3300015373 | Arabidopsis Rhizosphere | VAPQLTAVRDHVVREWENERRQRARNDAYARMRGEYEVSMDAKVPAEQP* |
| Ga0132257_1022940011 | 3300015373 | Arabidopsis Rhizosphere | PQLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR* |
| Ga0132257_1024320191 | 3300015373 | Arabidopsis Rhizosphere | AVRDAVAREWENERRQRARQSAYAQMRGEYEVSIEAKSTTALP* |
| Ga0132255_1030434682 | 3300015374 | Arabidopsis Rhizosphere | VRDQVVREWESDRRQRVRNDAYAKMRGEYEVRIEVKPSMDLR* |
| Ga0132255_1034064981 | 3300015374 | Arabidopsis Rhizosphere | QLAAVRDHVVREWENERRQRARNEAYTKMRGEYQVSIETKLAMERR* |
| Ga0132255_1038896282 | 3300015374 | Arabidopsis Rhizosphere | RDQVAREWENDRRQRARNDAYAKMRGEYQVSIETTPATERR* |
| Ga0132255_1053259691 | 3300015374 | Arabidopsis Rhizosphere | HVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR* |
| Ga0132255_1056181191 | 3300015374 | Arabidopsis Rhizosphere | VREWENDRRQRARNEAYEKMRSDYQVRIETTPATQQQ* |
| Ga0184629_103057231 | 3300018084 | Groundwater Sediment | DQVVREWENDRRLRARTDAYGRMRREYEVSIEAALPAGRP |
| Ga0190270_104527862 | 3300018469 | Soil | PQLAAVRDQVVREWENERRQRARHDAYTKMRSEYQVSIETELAAKRR |
| Ga0190270_134229311 | 3300018469 | Soil | LAAVRDHVVREWENERRQRARNDAYAKMRGGYEVSIEANPSMELR |
| Ga0190274_128528821 | 3300018476 | Soil | VAPQLAAVRDHVMREWENERRQRARSDAYTKMRGEYTVSIETKPPTERP |
| Ga0190271_104525711 | 3300018481 | Soil | REWENERRQRARADSYARMRADYEISIEATMPKERD |
| Ga0190271_127977682 | 3300018481 | Soil | LAAVRDHVMREWENERRQRARNDAYAKMRGRYEVSIEAKTPAKRR |
| Ga0190271_129775641 | 3300018481 | Soil | DLAAVRDHVVREWENERRVRARIEAYARMRARYEVSIETTLAADR |
| Ga0173482_100585621 | 3300019361 | Soil | TPAVAPQLAAVRDHVVREWENERRQRARSDAYAKMRGEYQVSIETELATERR |
| Ga0173479_105049682 | 3300019362 | Soil | RDNVVREWESERRERARDDAYTRMRGEYQISIETEAATKRR |
| Ga0247801_10774512 | 3300023064 | Soil | TPAVAPQLTAMRDQVVREWENERRQRARNDAYTKMRGGYQVSIETKLATERR |
| Ga0247793_10577411 | 3300023066 | Soil | LTAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKLATERR |
| Ga0207673_10560491 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVAPQLAAVRDHVVREWENERRQRARNEAYARMRERYEVSIAATAPTEQP |
| Ga0207710_105010492 | 3300025900 | Switchgrass Rhizosphere | DQVVREWENERRQRARDDTYMKMRGEYQVTIEPEPATKRR |
| Ga0207680_111774711 | 3300025903 | Switchgrass Rhizosphere | PALAAVREQVAREWENDRRQRARADAYARMRGEYEVSLEATRPTERR |
| Ga0207680_113296462 | 3300025903 | Switchgrass Rhizosphere | QLAAVRDQVVREWENERRQRARNDAYARMRGEYQVSVETTKATAGR |
| Ga0207645_105225911 | 3300025907 | Miscanthus Rhizosphere | DHVVREWENERRQRARHDAYTRMRSEYQVSLETELAAKRR |
| Ga0207663_104761631 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QLNAVRDHVVREWENERRQRARNDAYVKMRGEYTVRIETKPPTERP |
| Ga0207694_114890961 | 3300025924 | Corn Rhizosphere | VHDAVVREWENERRQQARQDAYARMRGEYQVSIEARPMTAQP |
| Ga0207650_103071153 | 3300025925 | Switchgrass Rhizosphere | PPQLAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR |
| Ga0207706_111258861 | 3300025933 | Corn Rhizosphere | HLAAVRDQVVREWEHERRLHARNDAYARMRGRYTVSIETKPPTQRP |
| Ga0207706_113765712 | 3300025933 | Corn Rhizosphere | PLAPVREQVAREWENERRQRARTDSYARMRADYEVSIEATMPKEQR |
| Ga0207709_102406073 | 3300025935 | Miscanthus Rhizosphere | LAAVRDQVVREWESDRRQRARNDAYAKMRSGYEIRIEAESSAERR |
| Ga0207704_118531241 | 3300025938 | Miscanthus Rhizosphere | VVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR |
| Ga0207691_105210912 | 3300025940 | Miscanthus Rhizosphere | AAVHDAVAREWENERRQRARQDAYARARGEYQVSIEAKPMTAQP |
| Ga0207691_115544392 | 3300025940 | Miscanthus Rhizosphere | VREWENERRQRARNDAYSKMREHYAISIEAELPTPAR |
| Ga0207712_106247521 | 3300025961 | Switchgrass Rhizosphere | ERIPAVAPQLAAVRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP |
| Ga0207658_105404051 | 3300025986 | Switchgrass Rhizosphere | KAPALAAVHDQVVREWENDRRQRARHDAYTRMRSGYEIRIEAKPPTEPR |
| Ga0207658_107711721 | 3300025986 | Switchgrass Rhizosphere | DQVVREWENDRRQRARNDAYAKMRSGYEIRIEAESSAERR |
| Ga0207678_112822562 | 3300026067 | Corn Rhizosphere | TPAVMPQLTAVRDQVEREWENERRQRARNDAYTKMRGEYQVSIEPKLAADAR |
| Ga0207708_109511031 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VVREWENERRQRARNDAYAKMRADYQVSIKTDPAAERR |
| Ga0207648_106516921 | 3300026089 | Miscanthus Rhizosphere | REWENERRQRARQDAYARARGEYQVSIEAKPMTAQP |
| Ga0209056_104851381 | 3300026538 | Soil | VREWENERRRRARNDAYTKMRGEYQVSIEAKTPTERP |
| Ga0207490_10023781 | 3300026841 | Soil | LAAVRDHVVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR |
| Ga0207582_10319271 | 3300026960 | Soil | VVREWENERRQRARNDAYTKMRAEYQVSIEAELTTERR |
| Ga0209995_10552711 | 3300027471 | Arabidopsis Thaliana Rhizosphere | APQLAAVRDRVVREWENERRQRARNDAYTKMRGEYQVSIETKLATERR |
| Ga0209968_10453101 | 3300027526 | Arabidopsis Thaliana Rhizosphere | APQLAAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETTPATERR |
| Ga0209999_10707201 | 3300027543 | Arabidopsis Thaliana Rhizosphere | QLAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETALPTERR |
| Ga0209982_10491882 | 3300027552 | Arabidopsis Thaliana Rhizosphere | VRDQVVREWENERRQRARNDAYARMRGEYEVSMDAKVPAEQP |
| Ga0209983_11067751 | 3300027665 | Arabidopsis Thaliana Rhizosphere | LRDHVVREWENERRQRARNDAYTKMRGEYLVSIETELATERR |
| Ga0209811_100835651 | 3300027821 | Surface Soil | PAVAPQLTAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR |
| Ga0209814_101521721 | 3300027873 | Populus Rhizosphere | HVVREWENERRQRARNDAYARMRDGYEVSIEATAPTEQP |
| Ga0209481_106792412 | 3300027880 | Populus Rhizosphere | AVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR |
| Ga0209382_119184011 | 3300027909 | Populus Rhizosphere | RDHVVREWENERRQRARNDAYRKMRGEYQVSIETKPTTERR |
| Ga0307497_103709162 | 3300031226 | Soil | DHLVREWENERRQRARNDAYTKMRGEYQVSIETKLATKRR |
| Ga0307506_104715372 | 3300031366 | Soil | ALAPQLADVQGQVAREWENERRQHARNEAYTRMRRGYEVAIETKLQADRP |
| Ga0310886_107653592 | 3300031562 | Soil | IPAVAPQLAAVRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP |
| Ga0310907_101874962 | 3300031847 | Soil | LAAVRDQVVREWENERRQRARTDAYAKMRGEYEVSIEAKPAERP |
| Ga0310907_107009852 | 3300031847 | Soil | APQLAAVRDHVVREWENERRQRARNDAYAKMRGGYEVSIEAKAPAEGR |
| Ga0310904_100162831 | 3300031854 | Soil | PQLTAVRDQVVREWENERRQRARNDAYTKMRGEYQVSIETKPATERR |
| Ga0310892_106222951 | 3300031858 | Soil | LAAVRDHVVREWENERRQRARNDAYTKMRGEYQVSIETTLATERR |
| Ga0310892_112008181 | 3300031858 | Soil | RDQVVREWENERRQRARNEAYAKMRGEYQVSIETELATERR |
| Ga0307406_102291263 | 3300031901 | Rhizosphere | VRDHVVREWENERRQRARNDAYTTMRGEYQVSIETNLATERR |
| Ga0310900_118524522 | 3300031908 | Soil | QVVREWENDRRQRARNDAYTKMRGEYRVSIETKPAAER |
| Ga0310901_102139731 | 3300031940 | Soil | DHVVREWENDRRQRARNDAYAKMRGDYQVSIETTLAAERR |
| Ga0310885_100785881 | 3300031943 | Soil | VVREWENERRQRARNDAYTKMRGDYQVSIETKLATERR |
| Ga0307411_114571192 | 3300032005 | Rhizosphere | QLAAVRGHVVREWENERRRRARDEAYTRMRNDYQVNIETESATKPAAEPR |
| Ga0310902_110092012 | 3300032012 | Soil | DHVLREWENERRQRARNDAYAKMRGAYHVSIETEPATERR |
| Ga0310899_104645672 | 3300032017 | Soil | LSDVRDQVVREWENDRRRQARDDSYANMRRGYVVSIGATLPVEQQ |
| Ga0310890_105341422 | 3300032075 | Soil | AVVPQLTAVRDQVVREWENERRQRARNEAYAKMRGEYQVSVGTELATERR |
| Ga0310895_104604772 | 3300032122 | Soil | VRDHVVREWENERRQRARNDAYARMRDGYEVSILATAPPEQP |
| Ga0310889_101081702 | 3300032179 | Soil | VVREWENDRRLRARADAYGRMRREYEVSIEAALPAGRP |
| Ga0307471_1041772031 | 3300032180 | Hardwood Forest Soil | RDQVVREWENERRQRARNDAYARMRRAYDVTIDTGTRTGRP |
| Ga0247830_115549611 | 3300033551 | Soil | REWENERRQHARTDSYARMRADYEVSIEATMPKEPR |
| Ga0364941_012583_1490_1618 | 3300034417 | Sediment | AVRDQVVREWENERRQRARNEAYARMRAGYDVSIDTKPLIRP |
| ⦗Top⦘ |