| Basic Information | |
|---|---|
| Family ID | F034179 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 175 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSDQISTMFGQSYSKKKPTLLAQQGSNVKIKLKKKNGKKKS |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 175 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 32.00 % |
| % of genes near scaffold ends (potentially truncated) | 18.86 % |
| % of genes from short scaffolds (< 2000 bps) | 85.14 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.714 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (13.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.429 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 175 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 14.86 |
| PF11351 | GTA_holin_3TM | 9.71 |
| PF08299 | Bac_DnaA_C | 5.71 |
| PF07460 | NUMOD3 | 1.14 |
| PF03237 | Terminase_6N | 1.14 |
| PF13730 | HTH_36 | 0.57 |
| PF02630 | SCO1-SenC | 0.57 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 5.71 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.71 % |
| All Organisms | root | All Organisms | 18.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.86% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.29% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.43% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.86% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.86% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.86% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.29% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.71% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.71% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.71% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.71% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.14% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.57% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.57% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.57% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.57% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.57% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200244864 | 2199352005 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGSNVKVKIKNGKKKLRK |
| B570J29587_10045233 | 3300002296 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGSNVKVKIKNGKKKS* |
| B570J29599_10125262 | 3300002298 | Freshwater | MSDQITTMFAQAYSKXKPTLLAQQGSNVKVKIKNGKKKLRK* |
| metazooDRAFT_14397442 | 3300002471 | Lake | MSDDIVTMFAQAYSKKKPTLLSQQGSNATQSVKPKVKIKKNGKKAPTRFLKK* |
| B570J40625_1009683481 | 3300002835 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVKIKVKKKNGKKALRK* |
| JGI25908J49247_100207383 | 3300003277 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKS* |
| JGI25910J50241_100888711 | 3300003388 | Freshwater Lake | MSNQIMTASGQMYSKKVSLLSQQGSNVKIKLKKKNGKKKP* |
| JGI25907J50239_10118096 | 3300003394 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIKXKKKNGKKKS* |
| Ga0031653_101060922 | 3300003859 | Freshwater Lake Sediment | MSDQISTMFGQSYSKKKPTLLAQQGVNATQGSNIKIKLKKKNGKKKS* |
| Ga0065166_104634743 | 3300004112 | Freshwater Lake | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKAPTRYLSK* |
| Ga0069718_145011051 | 3300004481 | Sediment | MSDQIMTASGQMYSKKVSLLSQQGIKAKVKIKKNGKKTFRK* |
| Ga0007763_100014433 | 3300004796 | Freshwater Lake | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKVKVKKKNGKKTFRK* |
| Ga0068876_101751384 | 3300005527 | Freshwater Lake | MSDDIVTMFAQAYSKKKPTLLSQQGSNVKIKLKKKNGKKAFRK* |
| Ga0068876_105217262 | 3300005527 | Freshwater Lake | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKIKLKKKNGKKALRK* |
| Ga0049083_102170983 | 3300005580 | Freshwater Lentic | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKK |
| Ga0049085_102614222 | 3300005583 | Freshwater Lentic | MSNQIMTASGQMYSKKVSLLSQQGSNVKIKLKKKNGKKKS* |
| Ga0049085_103190632 | 3300005583 | Freshwater Lentic | MSNQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKP* |
| Ga0079957_101285911 | 3300005805 | Lake | MSDQITTMFAQAYSKKKPTLLAQQGSNVKIKVKKKNGKKKS* |
| Ga0079957_10146142 | 3300005805 | Lake | MSDQITTMFAQSYSKKKPTLLAQQGVKAKVKIKKNGKKKS* |
| Ga0079957_101810310 | 3300005805 | Lake | MSNQIMTAAGQMYSKKVSLLSQQGIKAKAKIKKNGKKAPRK* |
| Ga0073913_100241383 | 3300005940 | Sand | MSDQIMTASGQIYSKKVSLLSQQGSKVKVKIKKKNG |
| Ga0070744_100491102 | 3300006484 | Estuarine | MSDQISTMFGQSYSKKKPTLLSQQGSNIKIKLKKKNGKKKS* |
| Ga0070744_100888812 | 3300006484 | Estuarine | MSNDIGTMFSQAYSKKVSLLSQQGSNVKIKLKKKNGKKKS* |
| Ga0079301_11558893 | 3300006639 | Deep Subsurface | MSDQIMTSSGQMYNKKVSLLSQQGSNVKVKVKKKNGKKTFRK* |
| Ga0075464_102066193 | 3300006805 | Aqueous | MSDQITTMFAQSYSKKKPTLLAQQGVKAKVKIKKNGKKEFRK* |
| Ga0075464_105450653 | 3300006805 | Aqueous | MSDDIVTMFAQAYSKKKPTLLSQQGSNIKVKIKKNGKKALRK* |
| Ga0075464_106448812 | 3300006805 | Aqueous | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKHGKKASRK* |
| Ga0075464_108699482 | 3300006805 | Aqueous | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKIKLKKKNGKKKS* |
| Ga0079300_100312453 | 3300007162 | Deep Subsurface | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIKIKKKNGKKKS* |
| Ga0075458_102573352 | 3300007363 | Aqueous | MSDQIMTASGQMYSKKVSLLSQQGIKAKATQSVKSKIKKNGKKTFRK* |
| Ga0102859_10219615 | 3300007708 | Estuarine | MSNDIGTMFSQAYSKKVSLLSQQGSNVKVKITKKKNG |
| Ga0104986_172337 | 3300007734 | Freshwater | MSDDIVTMFAQAYSKKKPTLLAQQGSNIKVKLKKKNGKKKS* |
| Ga0105748_102027922 | 3300007992 | Estuary Water | MSDQIMTASGQMYSKKVSLLSQQGSNVKVKLKKKNGKKKS* |
| Ga0114340_10154644 | 3300008107 | Freshwater, Plankton | MSDQITTMFAQSYSKKKPTLLAQQGIKAKVKIKKNGKKKS* |
| Ga0114340_11640861 | 3300008107 | Freshwater, Plankton | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKIKLKKKNGKKAFRK* |
| Ga0114347_101376410 | 3300008114 | Freshwater, Plankton | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKALRK* |
| Ga0114347_10159033 | 3300008114 | Freshwater, Plankton | MSDQITTMFAQAYSKKKPTLLAQQGSNVKVKIKNGKKKLRK* |
| Ga0114347_10390162 | 3300008114 | Freshwater, Plankton | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKAATRYLSK* |
| Ga0114347_11965922 | 3300008114 | Freshwater, Plankton | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKIKLKKKNGKKISRK* |
| Ga0114350_10185119 | 3300008116 | Freshwater, Plankton | MSDQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKASRK* |
| Ga0114359_10361926 | 3300008122 | Freshwater, Plankton | MSDDIVTMFAQAYSKKKPTLLAQQGSNIKIKLKKKNGKKAFRK* |
| Ga0114349_10931446 | 3300008263 | Freshwater, Plankton | MSDDIVTMFAQAYSKKKPTLLAQQGIKAKVKIKKNGKKAFRK* |
| Ga0114363_10724072 | 3300008266 | Freshwater, Plankton | MSDQIMTASGQMYSKKVSLLSQQGSNVKVKVKKKNGKKTFRK* |
| Ga0114363_10847133 | 3300008266 | Freshwater, Plankton | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKASTRYLSK* |
| Ga0114363_11036214 | 3300008266 | Freshwater, Plankton | NQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKALRK* |
| Ga0114363_11484623 | 3300008266 | Freshwater, Plankton | MSDQITTMFGQSYSKKKPTLLAQQGSNVKIKLKKKNGKKALRK* |
| Ga0114363_11660972 | 3300008266 | Freshwater, Plankton | MSDEIVTMFAQAFSKKKPTLLAQQGSNVKIKIKKKNGKKTFRK* |
| Ga0114363_12073142 | 3300008266 | Freshwater, Plankton | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKTFRK* |
| Ga0114363_12384132 | 3300008266 | Freshwater, Plankton | MSNQIMTAAGQMYSKKVSLLSQQGSNVKIKLKKKNGKKALRK* |
| Ga0114363_12401822 | 3300008266 | Freshwater, Plankton | MSDQIMTSSGQMYSKKVSLLSQQGSNVIVKATQVKVKKKNGKKALRK* |
| Ga0114876_10413294 | 3300008448 | Freshwater Lake | MSDQIMTSSGQMYSKKVSLLSQQGSNVKIKVKKKNGKKAPRK* |
| Ga0114876_12144141 | 3300008448 | Freshwater Lake | MSDQIMTASGQMYSKKVSLLSQQGSNVKIKVKKKNGKKTFRK* |
| Ga0114880_11836222 | 3300008450 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLTQQGSNIKIKLKKKNGKKKS* |
| Ga0114880_12521992 | 3300008450 | Freshwater Lake | MSDQITTMFGQSYSKKKPTLLAQQGVKAKVKIKNGKKKFRK* |
| Ga0114880_12638213 | 3300008450 | Freshwater Lake | MSDQITTMFAQAYSKKKPTLLAQQGSNVKIKIKKKNGKKALRK* |
| Ga0114973_102732151 | 3300009068 | Freshwater Lake | MSDDIVTMFAQAYSKKKPTLLAQQGSNIKIKLKKKNGKKKS* |
| Ga0114973_107198222 | 3300009068 | Freshwater Lake | MSDQIMTASGQMYSKKVSLLSQQGSNATQSVKPKIKLNKKNGKKKS* |
| Ga0105098_107114562 | 3300009081 | Freshwater Sediment | MSDQIMTSSGQMYSKKVSLLSQQGSNVKIKVKKKNGKKTFRK* |
| Ga0105103_105319881 | 3300009085 | Freshwater Sediment | MSDQITTMFAQAYSKKKPTLLAQQGVKAKVKIKNGKKKFRK* |
| Ga0114977_104908243 | 3300009158 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIRLKKKNGKKKS* |
| Ga0114977_105327171 | 3300009158 | Freshwater Lake | IMTASGQIYSKKVSLLSQQGSNVKVKLKKKNGKKKP* |
| Ga0105096_100830463 | 3300009170 | Freshwater Sediment | MSNQIMTASGQMYSKKVSLLSQQGSNATQSVKPKIKLKKKNGKKKS* |
| Ga0105096_107004442 | 3300009170 | Freshwater Sediment | MSNEITTMFAQAYSKKKPTLLAQQGVKAKVKIKNGKKKFRK* |
| Ga0114976_101582272 | 3300009184 | Freshwater Lake | MSDQIMTASGQIYSKKVSLLSQQGSNVKVKLKKKNGKKKP* |
| Ga0114967_103460633 | 3300010160 | Freshwater Lake | MSNQIMTASGQMYSKKVSLLSQQGSNVKVKITKKKNGKKKS* |
| Ga0129336_103167162 | 3300010370 | Freshwater To Marine Saline Gradient | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKAPRK* |
| Ga0119955_10117552 | 3300012006 | Freshwater | MSDQIMTAAGQMYSKKVSLLSQQGIKAKVKIKKNGKKASRK* |
| Ga0164293_102561382 | 3300013004 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGIKAKVKIKKNGKKAATRYLSK* |
| Ga0164293_103927892 | 3300013004 | Freshwater | MSDQISTMFGQSYSKKKPTLLAQQGSNVKIKLKKKNGKKKS* |
| Ga0164293_105195222 | 3300013004 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKTFRK* |
| (restricted) Ga0172368_103143203 | 3300013123 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGVKAKVKIKKNGKKKS* |
| (restricted) Ga0172367_101057251 | 3300013126 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGIKAKVKIKKNGKKAFRK* |
| (restricted) Ga0172367_104441782 | 3300013126 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGVKAKVKIKKNGKKAFRK* |
| (restricted) Ga0172372_110034842 | 3300013132 | Freshwater | MSDQITTMFAQSYSKKKPTLTSQQGSNVKVKFIKS |
| Ga0170791_159343662 | 3300013295 | Freshwater | MSNDIGTMFSQAYSKKVSLLSQQGSNVKVKITKKKNGKKKS* |
| Ga0177922_110352302 | 3300013372 | Freshwater | MSNQIMTASGQMYSKKVPLLSQQGSNVKIKLKKKNGKKKS* |
| Ga0181338_10407191 | 3300015050 | Freshwater Lake | MSDQISTMFGQSYSKKKPSLLAQQGSNIKIKLKKKNGKKKS* |
| Ga0181355_11735724 | 3300017785 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAQQGVNATQGSNIKIKLKKKN |
| Ga0181355_11948413 | 3300017785 | Freshwater Lake | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKIKVKKKNGKKAATRYLSK |
| Ga0181355_13194181 | 3300017785 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAHQGSNIKIKLKKKNGKKKSXEQTY |
| Ga0181355_13627491 | 3300017785 | Freshwater Lake | MSDQIMTASGQMYSKKVSLLSQQGSNVKVKLKKKNGKKTFRK |
| Ga0169931_101251932 | 3300017788 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGVKAKVKIKKNGKKKS |
| Ga0181359_10547325 | 3300019784 | Freshwater Lake | MSDQIMTLSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKALRK |
| Ga0181359_10603883 | 3300019784 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAQQGSNVKIKLKKKNGKKKP |
| Ga0181359_12598201 | 3300019784 | Freshwater Lake | MSNQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKSXEQ |
| Ga0211732_11128932 | 3300020141 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGVKAKVKIKNGKKKLRK |
| Ga0211732_14801472 | 3300020141 | Freshwater | MSDQITTMFGQSYSKKKPTLLAQQGVKAKVKIKNGKKKFRK |
| Ga0211736_104452204 | 3300020151 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGSNVKVKITKKKNGKKAFRK |
| Ga0211736_105478663 | 3300020151 | Freshwater | MSDQIMTASGQMYSKKVSLLSQQGSNVKIKINKKKNGKKAFRK |
| Ga0211734_107381402 | 3300020159 | Freshwater | MSDQIMTASGQMYSKKVSLLSQQGIKAKVKIKKNGKKTFRK |
| Ga0211735_103260224 | 3300020162 | Freshwater | MSDQITTMFGQSYSKKKPTLLAQQGSNVKIKINKKKNGKKAFRK |
| Ga0211735_108240203 | 3300020162 | Freshwater | MSNQIMTASGQMYSKKVSLLSQQGSNVKVKLKKKNGKKKP |
| Ga0208050_10102082 | 3300020498 | Freshwater | MSNQIMTASGQMYSKKVSLLSQQGSNVKVKLKKKNGKKKS |
| Ga0208232_10516763 | 3300020527 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGSNVKVKLKKKNG |
| Ga0207942_10427931 | 3300020549 | Freshwater | MSDQIMTASGQMYSKKVSLLSQQGSNIKIKLKKKNG |
| Ga0207909_10218031 | 3300020572 | Freshwater | SDQITTMFAQAYSKKKPTLLAQQGSNVKVKIKNGKKN |
| Ga0222714_106323442 | 3300021961 | Estuarine Water | MSDQITTIFGQSYSKKKPTLLAQQGSNVKIKLKKKNGKKKS |
| Ga0222713_103300362 | 3300021962 | Estuarine Water | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKATQVKVKNGKKVATRYLSK |
| Ga0222713_104192053 | 3300021962 | Estuarine Water | MSNDIGTMFSQVYSKKVSLLSQQGSNVKIKLKKKNGKKKS |
| Ga0222712_101700133 | 3300021963 | Estuarine Water | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKATQVKVKKKNGKKVATRYLSK |
| Ga0222712_102314934 | 3300021963 | Estuarine Water | MSDQITTMFAQSYSKKKPTLLAQQGVKAKVKIKKNGKKEFRK |
| Ga0181354_12053161 | 3300022190 | Freshwater Lake | MSNQIMTASGQMYSKKVSLLSQQGSNIKIKLKKKNG |
| Ga0181354_12097571 | 3300022190 | Freshwater Lake | GEIMSDQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKSXEQTY |
| Ga0214917_1000109010 | 3300022752 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKAPTRYLSK |
| Ga0214921_100172173 | 3300023174 | Freshwater | MSNDIGTMFSQAYSKKVSLLSQQGSNVKIKIKKKNGKKKS |
| Ga0214921_101672963 | 3300023174 | Freshwater | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKP |
| Ga0214919_104077531 | 3300023184 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKA |
| Ga0255185_10065255 | 3300024490 | Freshwater | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKLKKKNGKKAFRK |
| Ga0208916_100287193 | 3300025896 | Aqueous | MSDDIVTMFAQAYSKKKPTLLSQQGSNIKVKIKKNGKKALRK |
| Ga0208009_10311372 | 3300027114 | Deep Subsurface | MSDQISTMFGQSYSKKKPILLAQQGSNIKIKLKKKNGKKKS |
| Ga0255090_10252813 | 3300027123 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGIKAKVKIKKNGKKAFRK |
| Ga0208787_10799164 | 3300027518 | Deep Subsurface | DQITTMFGQSYSKKKPTLLAQQGSNIKIKIKKKNGKKKS |
| Ga0208787_10859142 | 3300027518 | Deep Subsurface | MSDQIMTSSGQMYNKKVSLLSQQGSNVKVKVKKKNGKKTFRK |
| Ga0208942_10455842 | 3300027627 | Freshwater Lentic | MSNQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKP |
| Ga0208133_10360764 | 3300027631 | Estuarine | MSDQIMTASGQMYSKKVSLLSQQGSNVKIKLKKKNGKKKS |
| Ga0209392_11549762 | 3300027683 | Freshwater Sediment | MSDQIMTASGQMYSKKVSLLSQQGSNVKVKVKKKNGKKTFRK |
| Ga0209492_11768881 | 3300027721 | Freshwater Sediment | MSDQITTMFAQAYSKKKPTLLAQQGVKAKVKIKNGKKKFRK |
| (restricted) Ga0247836_11401112 | 3300027728 | Freshwater | MSDQITTMFGQSYSKKKPTLLAQQGVKAKVKIKNGKKKLRK |
| Ga0209297_10576025 | 3300027733 | Freshwater Lake | MSDQIMTASGQMYSKKVSLLSQQGSNVKVKLKKKNGKKKP |
| Ga0209087_10950193 | 3300027734 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIRLKKKNGKKKS |
| Ga0209190_10467435 | 3300027736 | Freshwater Lake | MSNDIGTMFSQAYSKKVSLLSQQGSNVKVKITKKKNGKKKS |
| Ga0209358_103279501 | 3300027804 | Freshwater Lake | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKVKVKKKNGKKTFRK |
| Ga0209550_106983193 | 3300027892 | Freshwater Lake | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKK |
| Ga0209253_104430033 | 3300027900 | Freshwater Lake Sediment | MSDQISTMFGQSYSKKKPTLLAQQGVNATQGSNIKIKLKKKNGKKKS |
| Ga0209253_110212862 | 3300027900 | Freshwater Lake Sediment | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKTFRK |
| Ga0209400_10130046 | 3300027963 | Freshwater Lake | MSDQIMTASGQMYSKKVSLLSQQGSNATQSVKPKIKLNKKNGKKKS |
| Ga0209400_10452767 | 3300027963 | Freshwater Lake | MSNDIGTMFSQAYSKKVSLLSQQGNNVKVKITKKKNGKKKS |
| Ga0209299_10067611 | 3300027974 | Freshwater Lake | ISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKP |
| Ga0247723_100024632 | 3300028025 | Deep Subsurface Sediment | MSDQIMTASGQMYSKKVSLLSQQGSNVKIKVKKKNGKKALRK |
| Ga0247723_10127437 | 3300028025 | Deep Subsurface Sediment | MSDDIVTMFAQAYSRKKPTLLAQQGSNVKIKLKKKNGKKALRK |
| Ga0247723_11391952 | 3300028025 | Deep Subsurface Sediment | MSDDIVTMFAQAYSKKKPTLLAQQGSNVKIKLKKKNGKKISRK |
| Ga0304730_11075282 | 3300028394 | Freshwater Lake | MSNQIMTASGQMYSKKVSLLSQQGSNVKVKITKKKNGKKKS |
| (restricted) Ga0247841_101721955 | 3300029286 | Freshwater | MSDQITTMFGQSYSKKKPTLLAQQGSNVKVKITKKKNGKKAFRK |
| (restricted) Ga0247841_104049294 | 3300029286 | Freshwater | MSDQITTMFGQSYSKKKPTLLAQQGSNVKVKITKK |
| Ga0315291_110131482 | 3300031707 | Sediment | MSDQITTMFGQSYSKKKPTLLAQQGVKAKVKIKKNGKKKS |
| Ga0315293_102980792 | 3300031746 | Sediment | MSDQIMTASGQMYSKKVSLLSQQGSNVKIKIKKKNGKKKS |
| Ga0315293_104756865 | 3300031746 | Sediment | DQISTMFGQSYSKKKPTLLAQQGVKAKVKIKKNGKKKS |
| Ga0315907_110901892 | 3300031758 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKAATRYLSK |
| Ga0315907_111835411 | 3300031758 | Freshwater | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKASRK |
| Ga0315907_112107922 | 3300031758 | Freshwater | MSDNIVTMFAQAYSKKKPTLLAQQGSNVKIKLKKKNGKKAFRK |
| Ga0315908_116023142 | 3300031786 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVKVKVKKKNGKKASRK |
| Ga0315909_102704681 | 3300031857 | Freshwater | MSDQISTMFGQSYSKKKPTLLTQQGSNIKIKLKKKNGKKKS |
| Ga0315909_103711674 | 3300031857 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVIVKATQVKVKKKNGKKALRK |
| Ga0315909_107516702 | 3300031857 | Freshwater | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKTFRK |
| Ga0315297_101969116 | 3300031873 | Sediment | MSDQISTMFGQSYSKKKPTLLAQQGVKAKVKIKKNGKKKSXEQTY |
| Ga0315285_103439473 | 3300031885 | Sediment | MSDQISTMFGQSYSKKKPTLLAQQGVKAKVKIKKNGKKKS |
| Ga0315904_106216271 | 3300031951 | Freshwater | MSDQISTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKSXEQ |
| Ga0315904_107737022 | 3300031951 | Freshwater | MTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKALRK |
| Ga0315294_109714951 | 3300031952 | Sediment | MSDQITTMFGQSYSKKKPTLLAQQGSNIKIKLKKKNGKKKS |
| Ga0315274_102278622 | 3300031999 | Sediment | MSDQISTMFGQSYSKKKPTLLAQQGSNVKIKLKKKNGKKKS |
| Ga0315906_101418107 | 3300032050 | Freshwater | MSDDIVTMFAQAYSKKKPTLLAQQGSNIKIKLKKKNGKKAFRK |
| Ga0315906_109315682 | 3300032050 | Freshwater | MTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKASRK |
| Ga0315906_109636062 | 3300032050 | Freshwater | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKALRK |
| Ga0315284_119816252 | 3300032053 | Sediment | MSDQIMTASGQMYSKKVSLLSQQGSNVKIKLKKKNGKKKSXEQT |
| Ga0315902_110250421 | 3300032093 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGSNVKIKVKKKNGKKAPRK |
| Ga0315903_105503411 | 3300032116 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGIKAKVKIKKNGKKAPRK |
| Ga0315903_111031931 | 3300032116 | Freshwater | AAGQMYSKKVSLLSQQGSNVKIKLKKKNGKKALRK |
| Ga0315903_111789832 | 3300032116 | Freshwater | AAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKALRK |
| Ga0315292_109249803 | 3300032143 | Sediment | MSDQISTMFGQSYSKKKPTLLAQQGSNVKIKLKKKNGK |
| Ga0315273_131460902 | 3300032516 | Sediment | MSDQIYTMFGQSYSKKKPTLLAQQGSNVKIKLKKKNGKKKS |
| Ga0334722_101472118 | 3300033233 | Sediment | SDQITTMFGQSYSKKKPTLLSQQGSNIKIKLKKKNGKKKL |
| Ga0334979_0111096_584_721 | 3300033996 | Freshwater | MSDQIMTSSGQMYSKKVSLLSQQGIKAKVKIKKNGKKAATRYLSK |
| Ga0334986_0629802_3_113 | 3300034012 | Freshwater | TSSGQIYSKKVSLLSQQGSNVKVKVKKKNGKKTFRK |
| Ga0335004_0412646_605_712 | 3300034021 | Freshwater | MTASGQMYSKKVSLLSQQGIKAKVKLKKKNGKKKS |
| Ga0334995_0137297_2_106 | 3300034062 | Freshwater | MSDQIMTASGQMYSKKVSLLSQQGSNVKVKLKKKN |
| Ga0335019_0864564_91_213 | 3300034066 | Freshwater | MSDQITTMFGQAYSKKKPTLLAQQGIKAKVKIKKNGKKKS |
| Ga0310127_189200_438_566 | 3300034072 | Fracking Water | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKAFRK |
| Ga0310130_0029594_205_345 | 3300034073 | Fracking Water | MSNQIMTAAGQMYSKKVSLLSQQGSNVKVKVKKKNGKKASTRYLSK |
| Ga0310130_0040521_143_265 | 3300034073 | Fracking Water | MSNQIMTAAGQIYSKKVSLLSQQGSNIKIKLKKKNGKKKS |
| Ga0310130_0111360_609_731 | 3300034073 | Fracking Water | MSDQITTMFAQSYSKKKPTLLAQQGVKTKVKIKKNGKKKS |
| Ga0310130_0222038_295_426 | 3300034073 | Fracking Water | MSDDIVTMFAQAYSKKKPTLLSQQGSNVKIKLKKKNGKKALRK |
| Ga0335027_0635082_104_229 | 3300034101 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGSNVKIKLKKKNGKKKS |
| Ga0335030_0781422_167_289 | 3300034103 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGIKAKVKIKKNGKKKS |
| Ga0335066_0442378_2_112 | 3300034112 | Freshwater | MSDQITTMFAQAYSKKKPTLLAQQGSNVKVKIKNGKK |
| Ga0335054_0309750_507_647 | 3300034119 | Freshwater | MSDQIMTASGQMYSKKVSLLSQQGSNATQSVKPKIKLKKKNGKKKS |
| ⦗Top⦘ |