Metagenome / Metatranscriptome Family F034097

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F034097
Family Type	Metagenome / Metatranscriptome
Number of Sequences	175
Average Sequence Length	44 residues
Representative Sequence	MKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPEAKKS
Number of Associated Samples	139
Number of Associated Scaffolds	175

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	86.86 %
% of genes near scaffold ends (potentially truncated)	13.14 %
% of genes from short scaffolds (< 2000 bps)	87.43 %
Associated GOLD sequencing projects	133
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (93.714 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (15.429 % of family members)
Environment Ontology (ENVO)	Unclassified (33.143 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline) (32.571 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 25.00% β-sheet: 2.78% Coil/Unstructured: 72.22%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 175 Family Scaffolds
PF00384	Molybdopterin	11.43
PF00890	FAD_binding_2	6.29
PF04909	Amidohydro_2	5.14
PF04879	Molybdop_Fe4S4	4.00
PF00355	Rieske	2.29
PF00856	SET	1.71
PF01568	Molydop_binding	1.14
PF13744	HTH_37	1.14
PF00892	EamA	1.14
PF02627	CMD	1.14
PF00596	Aldolase_II	0.57
PF00848	Ring_hydroxyl_A	0.57
PF01712	dNK	0.57
PF00691	OmpA	0.57
PF13649	Methyltransf_25	0.57
PF12974	Phosphonate-bd	0.57
PF01070	FMN_dh	0.57
PF01814	Hemerythrin	0.57
PF04892	VanZ	0.57

COG ID	Name	Functional Category	% Frequency in 175 Family Scaffolds
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	1.14
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	1.14
COG4638	Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit	Inorganic ion transport and metabolism [P]	1.14
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	0.57
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	0.57
COG1428	Deoxyadenosine/deoxycytidine kinase	Nucleotide transport and metabolism [F]	0.57

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.71 %
Unclassified	root	N/A	6.29 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.71 %
Unclassified	root	N/A	6.29 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.71 %
Unclassified	root	N/A	6.29 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	75.43 %
Unclassified	root	N/A	6.29 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.29 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.57 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	60.57 %
Unclassified	root	N/A	6.29 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.29 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.14 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.57 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.57 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.57 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	60.57 %
Unclassified	root	N/A	6.29 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.29 %
Dehalococcoidia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia	0.57 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.57 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.57 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.57 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	31.43 %
Unclassified	root	N/A	6.29 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.29 %
unclassified Dehalococcoidia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia	0.57 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.57 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.57 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.57 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	31.43 %
Unclassified	root	N/A	6.29 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.29 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.57 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.57 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.57 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.57 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c1810690	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	598	Open in IMG/M
3300000550\|F24TB_14020001	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	644	Open in IMG/M
3300000891\|JGI10214J12806_13058039	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	947	Open in IMG/M
3300000956\|JGI10216J12902_102169742	All Organisms → cellular organisms → Bacteria	1987	Open in IMG/M
3300000956\|JGI10216J12902_103742282	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1190	Open in IMG/M
3300003319\|soilL2_10160641	All Organisms → cellular organisms → Bacteria	1779	Open in IMG/M
3300003319\|soilL2_10320925	All Organisms → cellular organisms → Bacteria	1135	Open in IMG/M
3300004019\|Ga0055439_10296342	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	534	Open in IMG/M
3300004022\|Ga0055432_10098440	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	766	Open in IMG/M
3300004024\|Ga0055436_10078858	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	938	Open in IMG/M
3300004024\|Ga0055436_10159465	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	692	Open in IMG/M
3300004049\|Ga0055493_10055050	All Organisms → cellular organisms → Bacteria	764	Open in IMG/M
3300004067\|Ga0055485_10169421	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	605	Open in IMG/M
3300004114\|Ga0062593_100203900	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	1578	Open in IMG/M
3300004145\|Ga0055489_10040949	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1209	Open in IMG/M
3300004463\|Ga0063356_101692621	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	945	Open in IMG/M
3300004463\|Ga0063356_102551402	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	784	Open in IMG/M
3300004463\|Ga0063356_103672450	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	661	Open in IMG/M
3300004643\|Ga0062591_100408812	All Organisms → cellular organisms → Bacteria	1125	Open in IMG/M
3300004778\|Ga0062383_10096923	All Organisms → cellular organisms → Bacteria	1255	Open in IMG/M
3300004781\|Ga0062379_10220411	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	513	Open in IMG/M
3300004808\|Ga0062381_10421056	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	516	Open in IMG/M
3300005295\|Ga0065707_10757381	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	616	Open in IMG/M
3300005331\|Ga0070670_100938307	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	785	Open in IMG/M
3300005336\|Ga0070680_101820820	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	528	Open in IMG/M
3300005341\|Ga0070691_10971197	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	528	Open in IMG/M
3300005441\|Ga0070700_100098825	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1919	Open in IMG/M
3300005450\|Ga0066682_10164160	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1417	Open in IMG/M
3300005518\|Ga0070699_102094524	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	517	Open in IMG/M
3300005829\|Ga0074479_10761141	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	571	Open in IMG/M
3300005836\|Ga0074470_10090447	All Organisms → cellular organisms → Bacteria	3128	Open in IMG/M
3300005836\|Ga0074470_10217736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5834	Open in IMG/M
3300005836\|Ga0074470_10255448	All Organisms → cellular organisms → Bacteria	1919	Open in IMG/M
3300005836\|Ga0074470_10881863	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	587	Open in IMG/M
3300006845\|Ga0075421_101015584	All Organisms → cellular organisms → Bacteria → Proteobacteria	938	Open in IMG/M
3300006845\|Ga0075421_101567863	All Organisms → cellular organisms → Bacteria → Proteobacteria	717	Open in IMG/M
3300006894\|Ga0079215_10085622	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1343	Open in IMG/M
3300006969\|Ga0075419_10485343	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	857	Open in IMG/M
3300007258\|Ga0099793_10677161	Not Available	520	Open in IMG/M
3300009053\|Ga0105095_10252710	All Organisms → cellular organisms → Bacteria	967	Open in IMG/M
3300009053\|Ga0105095_10422506	All Organisms → cellular organisms → Bacteria → Proteobacteria	736	Open in IMG/M
3300009053\|Ga0105095_10784949	Not Available	533	Open in IMG/M
3300009078\|Ga0105106_10095559	All Organisms → cellular organisms → Bacteria → Proteobacteria	2187	Open in IMG/M
3300009078\|Ga0105106_10304773	Not Available	1153	Open in IMG/M
3300009087\|Ga0105107_10459128	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300009087\|Ga0105107_10706633	All Organisms → cellular organisms → Bacteria → Proteobacteria	701	Open in IMG/M
3300009091\|Ga0102851_12473843	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	594	Open in IMG/M
3300009100\|Ga0075418_11140386	All Organisms → cellular organisms → Bacteria → Proteobacteria	844	Open in IMG/M
3300009147\|Ga0114129_11088659	All Organisms → cellular organisms → Bacteria → Proteobacteria	1001	Open in IMG/M
3300009147\|Ga0114129_11777060	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	750	Open in IMG/M
3300009156\|Ga0111538_11990322	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	731	Open in IMG/M
3300009162\|Ga0075423_10045886	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4489	Open in IMG/M
3300009171\|Ga0105101_10633232	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	532	Open in IMG/M
3300009553\|Ga0105249_10717517	All Organisms → cellular organisms → Bacteria → Proteobacteria	1061	Open in IMG/M
3300009609\|Ga0105347_1015886	All Organisms → cellular organisms → Bacteria	2568	Open in IMG/M
3300009609\|Ga0105347_1323030	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	653	Open in IMG/M
3300009610\|Ga0105340_1012408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3359	Open in IMG/M
3300009678\|Ga0105252_10000016	All Organisms → cellular organisms → Bacteria	184907	Open in IMG/M
3300009678\|Ga0105252_10531026	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	543	Open in IMG/M
3300009678\|Ga0105252_10604616	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	506	Open in IMG/M
3300009777\|Ga0105164_10642848	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	523	Open in IMG/M
3300010391\|Ga0136847_10321205	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	831	Open in IMG/M
3300010400\|Ga0134122_10600026	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1017	Open in IMG/M
3300011406\|Ga0137454_1066881	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	598	Open in IMG/M
3300011414\|Ga0137442_1075179	All Organisms → cellular organisms → Bacteria → Proteobacteria	714	Open in IMG/M
3300011417\|Ga0137326_1061502	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
3300011420\|Ga0137314_1099600	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	713	Open in IMG/M
3300011421\|Ga0137462_1101461	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	683	Open in IMG/M
3300011427\|Ga0137448_1126805	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	700	Open in IMG/M
3300011437\|Ga0137429_1083088	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	961	Open in IMG/M
3300011438\|Ga0137451_1060153	All Organisms → cellular organisms → Bacteria	1121	Open in IMG/M
3300011441\|Ga0137452_1088473	All Organisms → cellular organisms → Bacteria	1011	Open in IMG/M
3300011441\|Ga0137452_1252030	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	595	Open in IMG/M
3300012040\|Ga0137461_1001325	All Organisms → cellular organisms → Bacteria	5040	Open in IMG/M
3300012040\|Ga0137461_1133174	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	724	Open in IMG/M
3300012041\|Ga0137430_1174973	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	619	Open in IMG/M
3300012133\|Ga0137329_1007759	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1116	Open in IMG/M
3300012929\|Ga0137404_10156532	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1900	Open in IMG/M
3300014262\|Ga0075301_1067669	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	721	Open in IMG/M
3300014262\|Ga0075301_1153405	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	538	Open in IMG/M
3300014269\|Ga0075302_1105384	All Organisms → cellular organisms → Bacteria → Proteobacteria	640	Open in IMG/M
3300014297\|Ga0075306_1116157	Not Available	526	Open in IMG/M
3300014312\|Ga0075345_1031047	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1044	Open in IMG/M
3300014326\|Ga0157380_11074919	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	842	Open in IMG/M
3300014865\|Ga0180078_1012277	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1209	Open in IMG/M
3300014871\|Ga0180095_1108873	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	517	Open in IMG/M
3300014872\|Ga0180087_1035062	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	925	Open in IMG/M
3300014877\|Ga0180074_1038008	Not Available	996	Open in IMG/M
3300014882\|Ga0180069_1138967	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	591	Open in IMG/M
3300014883\|Ga0180086_1082829	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	802	Open in IMG/M
3300015201\|Ga0173478_10447515	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	632	Open in IMG/M
3300015374\|Ga0132255_104827969	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	571	Open in IMG/M
3300017939\|Ga0187775_10019528	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1838	Open in IMG/M
3300017966\|Ga0187776_10090201	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1809	Open in IMG/M
3300018028\|Ga0184608_10256432	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	770	Open in IMG/M
3300018031\|Ga0184634_10281552	Not Available	763	Open in IMG/M
3300018053\|Ga0184626_10093330	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1274	Open in IMG/M
3300018056\|Ga0184623_10402484	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	602	Open in IMG/M
3300018063\|Ga0184637_10060871	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2307	Open in IMG/M
3300018071\|Ga0184618_10233864	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	775	Open in IMG/M
3300018077\|Ga0184633_10096633	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1525	Open in IMG/M
3300018077\|Ga0184633_10405006	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	681	Open in IMG/M
3300018078\|Ga0184612_10029154	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2850	Open in IMG/M
3300018079\|Ga0184627_10137271	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1295	Open in IMG/M
3300018083\|Ga0184628_10022024	All Organisms → cellular organisms → Bacteria → Proteobacteria	3144	Open in IMG/M
3300018083\|Ga0184628_10038510	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2399	Open in IMG/M
3300018084\|Ga0184629_10049398	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1912	Open in IMG/M
3300018084\|Ga0184629_10187977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1063	Open in IMG/M
3300018084\|Ga0184629_10439832	Not Available	683	Open in IMG/M
3300018084\|Ga0184629_10495095	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	637	Open in IMG/M
3300018422\|Ga0190265_10306260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1661	Open in IMG/M
3300018429\|Ga0190272_10521880	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1016	Open in IMG/M
3300018432\|Ga0190275_10024846	All Organisms → cellular organisms → Bacteria → Proteobacteria	4720	Open in IMG/M
3300018469\|Ga0190270_10033117	All Organisms → cellular organisms → Bacteria	3392	Open in IMG/M
3300018469\|Ga0190270_10512544	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1146	Open in IMG/M
3300018469\|Ga0190270_11556408	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	712	Open in IMG/M
3300018469\|Ga0190270_13401105	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	505	Open in IMG/M
3300018476\|Ga0190274_10162952	All Organisms → cellular organisms → Bacteria → Proteobacteria	1904	Open in IMG/M
3300018476\|Ga0190274_11525698	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	760	Open in IMG/M
3300018476\|Ga0190274_11692039	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	726	Open in IMG/M
3300018481\|Ga0190271_10457798	All Organisms → cellular organisms → Bacteria → Proteobacteria	1381	Open in IMG/M
3300018482\|Ga0066669_10242633	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1418	Open in IMG/M
3300018920\|Ga0190273_11323306	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	623	Open in IMG/M
3300019874\|Ga0193744_1048285	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	814	Open in IMG/M
3300019881\|Ga0193707_1055826	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1250	Open in IMG/M
3300019884\|Ga0193741_1043854	All Organisms → cellular organisms → Bacteria → Proteobacteria	1154	Open in IMG/M
3300020027\|Ga0193752_1237273	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	674	Open in IMG/M
3300020034\|Ga0193753_10363386	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	596	Open in IMG/M
3300020061\|Ga0193716_1002854	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	9632	Open in IMG/M
3300021051\|Ga0206224_1008542	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1111	Open in IMG/M
3300021051\|Ga0206224_1057418	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	532	Open in IMG/M
3300021081\|Ga0210379_10019898	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2533	Open in IMG/M
3300021332\|Ga0210339_1445019	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	620	Open in IMG/M
3300022208\|Ga0224495_10140918	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1034	Open in IMG/M
3300022209\|Ga0224497_10028955	All Organisms → cellular organisms → Bacteria	2490	Open in IMG/M
3300024241\|Ga0233392_1010152	All Organisms → cellular organisms → Bacteria → Proteobacteria	881	Open in IMG/M
3300025324\|Ga0209640_10326153	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1278	Open in IMG/M
3300025953\|Ga0210068_1019093	All Organisms → cellular organisms → Bacteria → Proteobacteria	975	Open in IMG/M
3300025971\|Ga0210102_1012739	All Organisms → cellular organisms → Bacteria	1786	Open in IMG/M
3300026095\|Ga0207676_11954734	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	585	Open in IMG/M
3300026320\|Ga0209131_1135342	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1264	Open in IMG/M
3300027573\|Ga0208454_1000020	All Organisms → cellular organisms → Bacteria	146887	Open in IMG/M
3300027731\|Ga0209592_1279735	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	574	Open in IMG/M
3300027778\|Ga0209464_10052601	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1341	Open in IMG/M
3300027815\|Ga0209726_10017289	All Organisms → cellular organisms → Bacteria	6408	Open in IMG/M
3300027815\|Ga0209726_10318662	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	752	Open in IMG/M
3300027815\|Ga0209726_10324417	All Organisms → cellular organisms → Bacteria → Proteobacteria	743	Open in IMG/M
3300027818\|Ga0209706_10484189	Not Available	567	Open in IMG/M
3300027831\|Ga0209797_10068640	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1565	Open in IMG/M
3300027840\|Ga0209683_10106310	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1271	Open in IMG/M
3300027843\|Ga0209798_10073928	All Organisms → cellular organisms → Bacteria	1755	Open in IMG/M
3300027843\|Ga0209798_10156507	Not Available	1140	Open in IMG/M
3300027909\|Ga0209382_11096727	All Organisms → cellular organisms → Bacteria → Proteobacteria	822	Open in IMG/M
3300027909\|Ga0209382_11250670	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	756	Open in IMG/M
3300028145\|Ga0247663_1086747	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	561	Open in IMG/M
3300028381\|Ga0268264_12211481	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
(restricted) 3300031248\|Ga0255312_1117733	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	653	Open in IMG/M
3300031548\|Ga0307408_100456702	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1109	Open in IMG/M
3300031716\|Ga0310813_10217558	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1575	Open in IMG/M
3300031852\|Ga0307410_10175447	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1619	Open in IMG/M
3300031965\|Ga0326597_10001635	All Organisms → cellular organisms → Bacteria	35744	Open in IMG/M
3300032144\|Ga0315910_10616686	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	841	Open in IMG/M
3300032157\|Ga0315912_10737218	Not Available	785	Open in IMG/M
3300032157\|Ga0315912_10910543	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	699	Open in IMG/M
3300032163\|Ga0315281_10315775	All Organisms → cellular organisms → Bacteria	1703	Open in IMG/M
3300033408\|Ga0316605_10456738	All Organisms → cellular organisms → Bacteria	1167	Open in IMG/M
3300033419\|Ga0316601_100027086	All Organisms → cellular organisms → Bacteria → Proteobacteria	3913	Open in IMG/M
3300033433\|Ga0326726_10092025	All Organisms → cellular organisms → Bacteria → Proteobacteria	2701	Open in IMG/M
3300033485\|Ga0316626_12180860	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	503	Open in IMG/M
3300033815\|Ga0364946_105037	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	630	Open in IMG/M
3300034115\|Ga0364945_0107620	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	819	Open in IMG/M
3300034149\|Ga0364929_0264002	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300034155\|Ga0370498_039795	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1030	Open in IMG/M
3300034177\|Ga0364932_0114587	Not Available	1024	Open in IMG/M
3300034257\|Ga0370495_0167491	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	701	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	88.00%
Host-Associated	Host-Associated	12.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	49.14%
Terrestrial	Environmental → Terrestrial	38.86%
Plants	Host-Associated → Plants	12.00%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	34.29%
Sediment	Environmental → Aquatic → Sediment	27.43%
Freshwater	Environmental → Aquatic → Freshwater	14.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.57%
Marine	Environmental → Aquatic → Marine	6.86%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.43%
Floodplain	Environmental → Terrestrial → Floodplain	2.29%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.71%
Peat	Environmental → Terrestrial → Peat	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Sediment → Unclassified	27.43%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	23.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.00%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.86%
Sediment	Environmental → Aquatic → Freshwater → Sediment	6.29%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.14%
Wetlands	Environmental → Aquatic → Marine → Wetlands	5.14%
Loam	Environmental → Terrestrial → Soil → Loam	3.43%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.86%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	2.29%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.71%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.71%
Lake	Environmental → Aquatic → Freshwater → Lake	1.14%
Sediment	Environmental → Aquatic → Marine → Sediment	1.14%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.57%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.57%
Sand	Environmental → Terrestrial → Soil → Sand	0.57%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.57%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	27.43%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.00%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.86%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	6.29%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	5.14%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	5.14%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.00%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.86%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.29%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	2.29%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	1.71%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.71%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.14%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	1.14%
Unchlorinated	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated	0.57%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.57%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.57%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.57%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.57%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.57%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	15.43%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.71%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	9.14%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	5.71%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.71%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	5.14%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	4.57%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	2.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.86%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.86%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	2.29%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	1.71%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.71%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.71%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.71%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	1.14%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.14%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.14%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.14%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.14%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.14%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.57%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.57%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.57%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.57%
Wastewater	Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater	0.57%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.57%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.57%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.57%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.57%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.57%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.57%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.57%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	0.57%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.57%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.57%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental	Open in IMG/M
3300004022	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1	Environmental	Open in IMG/M
3300004024	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2	Environmental	Open in IMG/M
3300004049	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2	Environmental	Open in IMG/M
3300004067	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004145	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300004778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh	Environmental	Open in IMG/M
3300004781	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh	Environmental	Open in IMG/M
3300004808	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009777	Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011406	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2	Environmental	Open in IMG/M
3300011414	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2	Environmental	Open in IMG/M
3300011417	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2	Environmental	Open in IMG/M
3300011420	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2	Environmental	Open in IMG/M
3300011421	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2	Environmental	Open in IMG/M
3300011427	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2	Environmental	Open in IMG/M
3300011437	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2	Environmental	Open in IMG/M
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental	Open in IMG/M
3300011441	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2	Environmental	Open in IMG/M
3300012040	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2	Environmental	Open in IMG/M
3300012041	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2	Environmental	Open in IMG/M
3300012133	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014262	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1	Environmental	Open in IMG/M
3300014269	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1	Environmental	Open in IMG/M
3300014297	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1	Environmental	Open in IMG/M
3300014312	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014865	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D	Environmental	Open in IMG/M
3300014871	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da	Environmental	Open in IMG/M
3300014872	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D	Environmental	Open in IMG/M
3300014877	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D	Environmental	Open in IMG/M
3300014882	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D	Environmental	Open in IMG/M
3300014883	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019874	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1	Environmental	Open in IMG/M
3300019881	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2	Environmental	Open in IMG/M
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental	Open in IMG/M
3300020027	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1	Environmental	Open in IMG/M
3300020034	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2	Environmental	Open in IMG/M
3300020061	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1	Environmental	Open in IMG/M
3300021051	Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021332	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022208	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1	Environmental	Open in IMG/M
3300022209	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13	Environmental	Open in IMG/M
3300024241	Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025953	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025971	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300027573	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)	Environmental	Open in IMG/M
3300027731	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)	Environmental	Open in IMG/M
3300027815	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)	Environmental	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027840	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)	Environmental	Open in IMG/M
3300027843	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028145	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031248 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental	Open in IMG/M
3300033815	Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17	Environmental	Open in IMG/M
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034155	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17	Environmental	Open in IMG/M
3300034177	Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17	Environmental	Open in IMG/M
3300034257	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_18106902	3300000033	Soil	MSQEDWVKKYAAMDQRLMLXYEHXPXGEQVGKXPXLPKPEAKKS*
F24TB_140200012	3300000550	Soil	MKPTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS*
JGI10214J12806_130580392	3300000891	Soil	MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS*
JGI10216J12902_1021697422	3300000956	Soil	MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPDLPKSEAKKS*
JGI10216J12902_1037422821	3300000956	Soil	LLPVEHFRTLSMQPEDWAKKYAAMDKPIDLKYQQLAKGEQIGKRPEAPKPPPKKS*
soilL2_101606412	3300003319	Sugarcane Root And Bulk Soil	MSGDWAKKYAAMDQRLLLKYQQLPQGEQVGKKVQALAPEARD*
soilL2_103209252	3300003319	Sugarcane Root And Bulk Soil	MSRVDWAKKYAAMDQRLSLKYEQLPRGEQIGKKAPEVKPAKKEAWQTTTRSAAR*
Ga0055439_102963422	3300004019	Natural And Restored Wetlands	MSQEDWAKKYAAMDKRLMLKYEQLPQGEQIGKQPELAKSEAKKC*
Ga0055432_100984401	3300004022	Natural And Restored Wetlands	MKPEDWARKYAAMDKRIELKYQQLAKGEQIGKRPEAPKSEAKKS*
Ga0055436_100788582	3300004024	Natural And Restored Wetlands	MSQEDWAKKYAAMDQRLTLKYEQLPKGEQIGKKPEWPKTEAKKC*
Ga0055436_101594652	3300004024	Natural And Restored Wetlands	MSQEDWAKKYAAMDQRLTLIYEQLPKGEQIGKKSERPQMEAKKCSSSAS*
Ga0055493_100550502	3300004049	Natural And Restored Wetlands	MKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS*
Ga0055485_101694211	3300004067	Natural And Restored Wetlands	MSREDWARKYAAMDKRLMLKYEQLPSGEQVGKKPKMAQSNGKQS*
Ga0062593_1002039003	3300004114	Soil	MKPTDWVKKYAAMDKRVELKYQHLPNGEQIGKRPEAPKSEAKKS*
Ga0055489_100409492	3300004145	Natural And Restored Wetlands	MSREDWARKYAAMDKRLMLKYEQQPSGEQVGKKPKIAQSDGKKS*
Ga0063356_1016926213	3300004463	Arabidopsis Thaliana Rhizosphere	RLSMNPTDWAKKYAAMNKRVGLKYQHLPKGEQIGKRPAMPKPDANKS*
Ga0063356_1025514022	3300004463	Arabidopsis Thaliana Rhizosphere	MKPTDWVKKYAAMDKRVELRYLHLPKGEQIGKRPAAPKPEVKKS*
Ga0063356_1036724502	3300004463	Arabidopsis Thaliana Rhizosphere	MSQEDWVKKYAAMDQRLMLKYEHLPKGEQVGKKPELPKPEAK
Ga0062591_1004088122	3300004643	Soil	MSQEDWVKKYAAMDQRLMLKYEHLPKGEQVGKKPELPKPEAKKS*
Ga0062383_100969232	3300004778	Wetland Sediment	MKPTDWVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS*
Ga0062379_102204111	3300004781	Wetland Sediment	WVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS*
Ga0062381_104210562	3300004808	Wetland Sediment	MKPTDWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPNAKKS*
Ga0065707_107573812	3300005295	Switchgrass Rhizosphere	MSQEDWAKKYAAMDKRLMIKYEHLPKGEQIGKKPELPLKEAKKS*
Ga0070670_1009383072	3300005331	Switchgrass Rhizosphere	MKSTDWAKKYAAMDKRVGLKYQYLPKGEQVGKRPFAPQAAAKKA*
Ga0070680_1018208202	3300005336	Corn Rhizosphere	QIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS*
Ga0070691_109711971	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPELPKQEPKKS*
Ga0070700_1000988252	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MNQIDWAKKYAAMERRVTLKYQQLPKGEQIGKRLEAEAPKTKKS*
Ga0066682_101641603	3300005450	Soil	MSDEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ*
Ga0070699_1020945241	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MSQEDWAKKYAAMDQRLLLKYEHLPNGEQIGKKPELPKPEAKKT*
Ga0074479_107611412	3300005829	Sediment (Intertidal)	MKPEDWARKYAAMDKRVGLKYQFLPKGEQTGKRPEAPKPEAKKP*
Ga0074470_100904472	3300005836	Sediment (Intertidal)	MKPTDWVKKYAAMDKRVGLKYQHLPKGEQIGKPPDAPKPQAK*
Ga0074470_102177368	3300005836	Sediment (Intertidal)	MSQEDWAKKYAAMDQRLTLKYEQLPRGEQIGKKPEPPNTEAKKCK
Ga0074470_102554483	3300005836	Sediment (Intertidal)	MKPTDWVKKYAAMDKRVELKYQHLPKGEQIGKRPDAPEPQAK*
Ga0074470_108818632	3300005836	Sediment (Intertidal)	MKPTDWVKKYAAMDKRVALKYQHLPKGEQIGKRPDAPKPQTK*
Ga0075421_1010155842	3300006845	Populus Rhizosphere	MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS*
Ga0075421_1015678632	3300006845	Populus Rhizosphere	MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEAKKS*
Ga0079215_100856222	3300006894	Agricultural Soil	MSQTDWAKIYAVMDKRVELKYAQLPKGEQIGERPALVKAQVKKS*
Ga0075419_104853431	3300006969	Populus Rhizosphere	MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEATKS*
Ga0099793_106771611	3300007258	Vadose Zone Soil	DEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ*
Ga0105095_102527102	3300009053	Freshwater Sediment	MKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS*
Ga0105095_104225061	3300009053	Freshwater Sediment	MEVSTMSQTDWAKKYAAMDKRIVLKYEQLPNGEQIGKRPQTGKAEQKAF*
Ga0105095_107849492	3300009053	Freshwater Sediment	MKAENWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAAKPEAKKS*
Ga0105106_100955591	3300009078	Freshwater Sediment	KKYAAMDKRVDLKYQHLPNGEQIGKRPEAPKPQAK*
Ga0105106_103047731	3300009078	Freshwater Sediment	MKPEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS*
Ga0105107_104591282	3300009087	Freshwater Sediment	MKAEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS*
Ga0105107_107066332	3300009087	Freshwater Sediment	MEVSTMSQTDWAKKYAAMDKRIVLKYEQLPNGEQVGKRPQTGKAEQKAF*
Ga0102851_124738432	3300009091	Freshwater Wetlands	MKSEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPEAPKPQAK*
Ga0075418_111403862	3300009100	Populus Rhizosphere	MMSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS*
Ga0114129_110886592	3300009147	Populus Rhizosphere	MMSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEPPKPEAKKS*
Ga0114129_117770602	3300009147	Populus Rhizosphere	MMSQEDWAKKYAAMDQRLLLKYEHLPNGEQIGKKPELPKPETKKV*
Ga0111538_119903222	3300009156	Populus Rhizosphere	MMSQEDWANKYAAMDQRLLLKYEHLPDGEQIGKKPELSKPETKKA*
Ga0075423_100458863	3300009162	Populus Rhizosphere	MMSQEDWAKKYAAMDQRLLLKYEHLPDGEQIGKKPELSKPETKKA*
Ga0105101_106332321	3300009171	Freshwater Sediment	SMKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS*
Ga0105249_107175172	3300009553	Switchgrass Rhizosphere	MMSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS*
Ga0105347_10158861	3300009609	Soil	MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKPPEAPKAAAKKS*
Ga0105347_13230302	3300009609	Soil	MSQEDWAKKYAAMDRRLMLKYEHLPKGEQIGKKPVSPKPEGKKS*
Ga0105340_10124082	3300009610	Soil	MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS*
Ga0105252_10000016132	3300009678	Soil	MGQEDWAKKYAAMDPRLMLKYEQLPKGEQIGKKPMAPKTPVKKS*
Ga0105252_105310262	3300009678	Soil	MKTEDWAKEYAAMDKRVDLKYQHLPNGEQIGKRPAAPKPNAKKS*
Ga0105252_106046162	3300009678	Soil	MKAEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPEAPNPQAK*
Ga0105164_106428482	3300009777	Wastewater	MKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPDTKKS*
Ga0136847_103212052	3300010391	Freshwater Sediment	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKTELSTADVKKS*
Ga0134122_106000262	3300010400	Terrestrial Soil	MKPEDWVKKYAAMDKRVGLKYQYLPKGEQIGKRSEPPKSEAKKS*
Ga0137454_10668811	3300011406	Soil	MKPADWAKKYAAMDKRLLLKYQYLPKGEQIGKKPAAPNPTAKKS*
Ga0137442_10751791	3300011414	Soil	MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPTSAQPASKKA*
Ga0137326_10615021	3300011417	Soil	MKSEDWAKKYAAMDKRIELKYQQLAKAEQIGKRPEAPKAAAKKS*
Ga0137314_10996002	3300011420	Soil	MKTEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPAAPKPNAKKS*
Ga0137462_11014612	3300011421	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPESPKPAAKKS*
Ga0137448_11268052	3300011427	Soil	LSMKPQDWAKKYAAMDKRVGLKYQHLPKGEQIGKRPETPKPATKIS*
Ga0137429_10830883	3300011437	Soil	MSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKKPASPKPEGKKS*
Ga0137451_10601532	3300011438	Soil	MKPEDWAKKYAVMDKRIDLKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0137452_10884732	3300011441	Soil	MKTEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPQAK*
Ga0137452_12520301	3300011441	Soil	YAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0137461_10013255	3300012040	Soil	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKRPELPKQELKKS*
Ga0137461_11331741	3300012040	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPETPKPATKKS*
Ga0137430_11749732	3300012041	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPNPQAK*
Ga0137329_10077592	3300012133	Soil	MSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPVSPKPEGKKS*
Ga0137404_101565321	3300012929	Vadose Zone Soil	MSDEDWATKYAAMNGRVPQKYEHLPNGEQIGKRPEAKPQ*
Ga0075301_10676692	3300014262	Natural And Restored Wetlands	MSQEDWAKRYAAMDQRLTLKYEQLPKGEQIGKKPEVPETEAKKCSSFAS*
Ga0075301_11534051	3300014262	Natural And Restored Wetlands	MSQENWAKKYAAMDKRLMLKYEQLPKGEQIGKKPVPAKSEANKS*
Ga0075302_11053842	3300014269	Natural And Restored Wetlands	MSQEDWAKRYAAMDQRSTLKYEQLPKGKQIGKKPELPETEAKKCSSFAS*
Ga0075306_11161571	3300014297	Natural And Restored Wetlands	MKPTDWVKKYAAMDKQVELKFLYLPKGEQIGKRPVAPKPDAKKSY
Ga0075345_10310472	3300014312	Natural And Restored Wetlands	MKSDNWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS*
Ga0157380_110749192	3300014326	Switchgrass Rhizosphere	MKPTDWVKKYAAMDKRVELKYQHLPKGEQIGKRLAAPTADVKKS*
Ga0180078_10122772	3300014865	Soil	MKSEDWAKKYAAMDKRIELKYQQLAKGEQNGKRPEAPKPAAKKS*
Ga0180095_11088731	3300014871	Soil	KPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0180087_10350622	3300014872	Soil	MSQEDWAKNYAAMDKRLMLKYEHLPKGEQIGKKPEAPKREATNS*
Ga0180074_10380082	3300014877	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS*
Ga0180069_11389672	3300014882	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKV*
Ga0180086_10828291	3300014883	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPAAPKPEAKKS*
Ga0173478_104475151	3300015201	Soil	MKSTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS*
Ga0132255_1048279692	3300015374	Arabidopsis Rhizosphere	MSQIDWAKKYAIMDKRLMLKYEYLPKGEQVGKKPQLPKPEAKKS*
Ga0187775_100195283	3300017939	Tropical Peatland	MSQEDWVKKYAAMDKRLMLKYEHLPKGEQIGKKPVQPKQGETKSSQAERLR
Ga0187776_100902013	3300017966	Tropical Peatland	MSQEDWVKKYAAMDKRLMLKYEHLPKGEQIGKKPVQPKQG
Ga0184608_102564322	3300018028	Groundwater Sediment	MSQIDWAKKYAAMDRRVTLKYQQVPKGEQIGKRLEAEAPKTKKS
Ga0184634_102815522	3300018031	Groundwater Sediment	MSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPDLPKHELKKS
Ga0184626_100933302	3300018053	Groundwater Sediment	MSQVDWAKKYAAMDKRLMLKYEHLPNGEQICKKPVALKTEVKKS
Ga0184623_104024842	3300018056	Groundwater Sediment	MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPLPKPTA
Ga0184637_100608714	3300018063	Groundwater Sediment	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPKLPKQE
Ga0184618_102338642	3300018071	Groundwater Sediment	MTQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0184633_100966333	3300018077	Groundwater Sediment	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIVRKPELPKQEAKKS
Ga0184633_104050062	3300018077	Groundwater Sediment	MSQVDWVKKYAAMEKQLMLKYEHLPKGEQIGKKPELAKQEAKKP
Ga0184612_100291542	3300018078	Groundwater Sediment	MSQVDWAKKYAAMDKRLMLKYEQLPNGEQIGKKPVALKTEAKKS
Ga0184627_101372712	3300018079	Groundwater Sediment	MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPEAPKSEAKQS
Ga0184628_100220242	3300018083	Groundwater Sediment	MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS
Ga0184628_100385102	3300018083	Groundwater Sediment	MSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS
Ga0184629_100493982	3300018084	Groundwater Sediment	MSQEDWAKKYAAMDKRLMLKYQQLPKGEQIGKKPVPQKSEGKKS
Ga0184629_101879772	3300018084	Groundwater Sediment	MKPEDWAKKYAAMDKRIDLKYQQLAKGEQIGKRPEAPKPEAKKS
Ga0184629_104398321	3300018084	Groundwater Sediment	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKRPELPKQELKKS
Ga0184629_104950951	3300018084	Groundwater Sediment	MSQEDWAKKYAAMDKRLILKYEQLPKGEQVGKKPVPPAANVKKA
Ga0190265_103062602	3300018422	Soil	MQPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPDAPKPQPKKS
Ga0190272_105218802	3300018429	Soil	MNQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0190275_100248464	3300018432	Soil	MQPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPDAPKTQPKKS
Ga0190270_100331174	3300018469	Soil	MSQEDWAKKYAAMDKRLMLKYEHLPNGEQIGKKPQLPKSEAKKS
Ga0190270_105125442	3300018469	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQNGKRPEAPKPAAKKS
Ga0190270_115564082	3300018469	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEASKPTAKKS
Ga0190270_134011052	3300018469	Soil	YAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKS
Ga0190274_101629523	3300018476	Soil	MKPTDWVKKYAAMDTRVELKYQHLPKGEQIGKRPAAPKPEVKKS
Ga0190274_115256982	3300018476	Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPPPKKS
Ga0190274_116920391	3300018476	Soil	MKSTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKNS
Ga0190271_104577982	3300018481	Soil	MKSEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS
Ga0066669_102426333	3300018482	Grasslands Soil	MSDEDWATKYAAMNGRVTQKYEHLPKGEQIGKRPEAKPQ
Ga0190273_113233062	3300018920	Soil	MQPEDWAKKYAAMDKRIEIKYQQLAKGEQIGKRPDAPKPQPKKA
Ga0193744_10482851	3300019874	Soil	MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKA
Ga0193707_10558262	3300019881	Soil	MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0193741_10438542	3300019884	Soil	MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKPEAKKS
Ga0193752_12372731	3300020027	Soil	KKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0193753_103633862	3300020034	Soil	MSQIDWAKKYAAMDRRVTLKYQQLPKGEQIGKHLEAEAPEAKKS
Ga0193716_100285411	3300020061	Soil	MSQFDWAKKYAAMDRRVTLKYQQLPKGEQIGKRLEAEAPKTKKS
Ga0206224_10085422	3300021051	Deep Subsurface Sediment	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPQPQKTEAKKS
Ga0206224_10574182	3300021051	Deep Subsurface Sediment	MKPEDWAKKYAAMDKRIALKYQLLAKGEQIGKRPAAPKPEAKKS
Ga0210379_100198982	3300021081	Groundwater Sediment	MSQEDWAKKYAAMDRRLMLKYEHLPKGEQIGKKPVSPKPEGKKS
Ga0210339_14450192	3300021332	Estuarine	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEASKAEAKKS
Ga0224495_101409182	3300022208	Sediment	MKPTDWVKKYAAMDKRVGFKYQFLPKGEQIGKRPEAPKTDAKKS
Ga0224497_100289552	3300022209	Sediment	MNQTDWAKLYAAMDERLVLKYEHLPNGEQIRKRPENPPRPAERKRT
Ga0233392_10101522	3300024241	Deep Subsurface Sediment	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKSEPANTEAKKS
Ga0209640_103261533	3300025324	Soil	MSQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPMAP
Ga0210068_10190932	3300025953	Natural And Restored Wetlands	MKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS
Ga0210102_10127394	3300025971	Natural And Restored Wetlands	RLWMKSEDWAKKYEAMDKRVDLKYQHLPNGEQIGKRPPAPKPEAKKS
Ga0207676_119547342	3300026095	Switchgrass Rhizosphere	KKYAAMDRRVTLKYQQLPNGEQIGKRLEAQAPKTKKS
Ga0209131_11353423	3300026320	Grasslands Soil	MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPTPAQPAPKKA
Ga0208454_100002050	3300027573	Soil	MGQEDWAKKYAAMDPRLMLKYEQLPKGEQIGKKPMAPKTPVKKS
Ga0209592_12797352	3300027731	Freshwater Sediment	MKPVDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPEAKKS
Ga0209464_100526012	3300027778	Wetland Sediment	MKPADWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPNAKKS
Ga0209726_100172896	3300027815	Groundwater	MGQEDWAKKYAAMDKRLMLKYEHLPKGEQIGKKPELSKLEVKKS
Ga0209726_103186622	3300027815	Groundwater	MKPEDWAKKYAAMDKRIELKYQQLAKGEQTGKRPEAPKPEAKKS
Ga0209726_103244171	3300027815	Groundwater	MSQVDWAKKYAAMDKRLLLKYEHLPKGEQIGKKPALPTPEAKKS
Ga0209706_104841891	3300027818	Freshwater Sediment	MKAEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRPPAPKPDAKKS
Ga0209797_100686403	3300027831	Wetland Sediment	VKKNAAMDKRVDLKYQFLPKGEQIGKRPEAPKPDAKKS
Ga0209683_101063103	3300027840	Wetland Sediment	MKPTDWVKKYSAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS
Ga0209798_100739282	3300027843	Wetland Sediment	MKPTDWVKKYAAMDKRVDLKYQFLPKGEQIGKRPEAPKPDAKKS
Ga0209798_101565071	3300027843	Wetland Sediment	MKPTDWVKKYAAMDKRVDLKYQFLPEGEQIGKRPEAPKPDAKKS
Ga0209382_110967272	3300027909	Populus Rhizosphere	MSQEDWAKKYAAMDQRLMLKYEHLPNGEQIGKKPALPKSEAKKS
Ga0209382_112506702	3300027909	Populus Rhizosphere	MSQEDWAKKYAAMDQRLLLKYEHLPDGEQIGKKPAPAQPEAKKS
Ga0247663_10867471	3300028145	Soil	LISDGERKQTMSQVDWAKKYSAMDKRLMLKYEQLPKGEQIGKKPVAVKQETKKV
Ga0268264_122114812	3300028381	Switchgrass Rhizosphere	MSQEDSAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS
(restricted) Ga0255312_11177332	3300031248	Sandy Soil	MKSEDWAKKYAAMDKRVDLKYQHLPKGEQIGKRPDAPKPQAK
Ga0307408_1004567022	3300031548	Rhizosphere	MKPTDWVKKYAAMDKRVELKYLHLPKGEQIGKRPAAPKPEVKKS
Ga0310813_102175582	3300031716	Soil	MSQVDWAKKYAAMDKRLMLKYEQLPKGEQIGKQPTSALPASKKA
Ga0307410_101754473	3300031852	Rhizosphere	MKPTDWVKKYAAMDKRVELKYLHLPKNEQIGKRPAAPKPEVKKS
Ga0326597_1000163535	3300031965	Soil	MSQEDWAKKYAAMDKRLLLKYEHLPNGEQIGGKPIAPNSEAKKS
Ga0315910_106166861	3300032144	Soil	MSQTDWVKKYAAMDKRLILKYEQLPKGEQIGKRPLVVKAEEKRS
Ga0315912_107372181	3300032157	Soil	MKPTDWVKKYAAMDKRVELKYQHLPNGEQIGKRPEAPKPEAKKS
Ga0315912_109105431	3300032157	Soil	PMKPEDWARKYAAMDKRVDLKFQHLPNGEQIGKRPAAPKPNAKKS
Ga0315281_103157752	3300032163	Sediment	MSQEDWAKKYAAMDKRLMLKYEQLPKGEQIGKKPETPKADVKKT
Ga0316605_104567382	3300033408	Soil	MKPEDWAKKYAAMDRRVDLKYQHLPNGEQIGKRSPAPKPDAKKS
Ga0316601_1000270862	3300033419	Soil	MKPEDWAKKYAAMDKRVDLKYQHLPNGEQIGKRSPAPKPDAKKS
Ga0326726_100920252	3300033433	Peat Soil	MKTEDWAKKYAAMDKRVDLKYQYLPKGEQIGKRPVAPKPDAKKS
Ga0316626_121808602	3300033485	Soil	MSQEDWAKKYAAMDKRLMLKYQHLPKGEQIGKKPVPPKS
Ga0364946_105037_11_145	3300033815	Sediment	MSKEDWAKKYAAMDKRLLLKYEHLPNGEQIGKKPELPKQEAKKS
Ga0364945_0107620_478_612	3300034115	Sediment	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKAAAKKS
Ga0364929_0264002_150_287	3300034149	Sediment	MMSQEDWAKKYAAMDQRLMLKYEHLPDCEQISKKPELPKPEAKKS
Ga0370498_039795_855_1004	3300034155	Untreated Peat Soil	MEDGSMSAIDWAKKYAAMDGRVTLKYQQLPKGEQIGKHLAPAAPEAKKS
Ga0364932_0114587_51_218	3300034177	Sediment	MVKQIERGGSPMSQTDWAKKYAAMDKRLQLKYEQLPKGEQIGKRPQAPKPQAQKS
Ga0370495_0167491_16_150	3300034257	Untreated Peat Soil	MKPEDWAKKYAAMDKRIELKYQQLAKGEQIGKRPEAPKPAAKKA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters