| Basic Information | |
|---|---|
| Family ID | F033972 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ATPAVAILEWSERFPLQSPWPQIRVRLEHLGGDARRITIL |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.14 % |
| % of genes near scaffold ends (potentially truncated) | 98.30 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 148 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.727 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.136 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.705 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.12% Coil/Unstructured: 80.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 1.14 |
| PF00106 | adh_short | 0.57 |
| PF07690 | MFS_1 | 0.57 |
| PF07238 | PilZ | 0.57 |
| PF12728 | HTH_17 | 0.57 |
| PF02367 | TsaE | 0.57 |
| PF08308 | PEGA | 0.57 |
| PF13450 | NAD_binding_8 | 0.57 |
| PF14827 | dCache_3 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10085608 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300001867|JGI12627J18819_10090328 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100417167 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300002561|JGI25384J37096_10071006 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300002907|JGI25613J43889_10007694 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300002908|JGI25382J43887_10076460 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300005175|Ga0066673_10197017 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300005176|Ga0066679_10882036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300005332|Ga0066388_100340874 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300005471|Ga0070698_101231769 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005538|Ga0070731_10197137 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300005542|Ga0070732_10251515 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005555|Ga0066692_10024285 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
| 3300005561|Ga0066699_10345896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300005568|Ga0066703_10809081 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005574|Ga0066694_10318107 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005586|Ga0066691_10628225 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005764|Ga0066903_102351293 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300005921|Ga0070766_11102399 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005921|Ga0070766_11111467 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300006052|Ga0075029_101165358 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006102|Ga0075015_100672684 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006163|Ga0070715_10576761 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006175|Ga0070712_101918524 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006755|Ga0079222_10588336 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300006796|Ga0066665_11112664 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006852|Ga0075433_11086090 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300006914|Ga0075436_100788079 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300007076|Ga0075435_101143916 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300007255|Ga0099791_10646655 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300007265|Ga0099794_10369352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300009038|Ga0099829_10303840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
| 3300009088|Ga0099830_11360267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300009101|Ga0105247_10110876 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300009137|Ga0066709_100999758 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300009522|Ga0116218_1256263 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300010043|Ga0126380_11286425 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010046|Ga0126384_10334617 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300010303|Ga0134082_10127443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300010320|Ga0134109_10049474 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300010329|Ga0134111_10404402 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300010341|Ga0074045_10383750 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300010360|Ga0126372_10210997 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300010360|Ga0126372_10492912 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300010360|Ga0126372_11693732 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010361|Ga0126378_10406186 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300010361|Ga0126378_12444038 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010362|Ga0126377_12725152 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010366|Ga0126379_11177256 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300010400|Ga0134122_10054633 | All Organisms → cellular organisms → Bacteria | 3073 | Open in IMG/M |
| 3300011269|Ga0137392_10031481 | All Organisms → cellular organisms → Bacteria | 3853 | Open in IMG/M |
| 3300011270|Ga0137391_10866076 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300011271|Ga0137393_11015941 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012189|Ga0137388_10054477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3262 | Open in IMG/M |
| 3300012189|Ga0137388_11550663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300012201|Ga0137365_10431660 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012202|Ga0137363_11395568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300012202|Ga0137363_11409927 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012205|Ga0137362_10786271 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300012205|Ga0137362_10928362 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012205|Ga0137362_11091392 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012207|Ga0137381_11046951 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012211|Ga0137377_10008905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8305 | Open in IMG/M |
| 3300012357|Ga0137384_10913314 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012361|Ga0137360_10527599 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012362|Ga0137361_10986313 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012469|Ga0150984_101098631 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300012582|Ga0137358_10991688 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012683|Ga0137398_10674336 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012917|Ga0137395_11053126 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012923|Ga0137359_11498742 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012924|Ga0137413_10828474 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012925|Ga0137419_10914512 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012925|Ga0137419_10975613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300012930|Ga0137407_10209781 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300012944|Ga0137410_10029769 | All Organisms → cellular organisms → Bacteria | 3806 | Open in IMG/M |
| 3300012976|Ga0134076_10309078 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300014166|Ga0134079_10162913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300014501|Ga0182024_10022427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11380 | Open in IMG/M |
| 3300015052|Ga0137411_1321352 | All Organisms → cellular organisms → Bacteria | 5934 | Open in IMG/M |
| 3300015054|Ga0137420_1064708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3396 | Open in IMG/M |
| 3300015054|Ga0137420_1064710 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300015054|Ga0137420_1167983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2992 | Open in IMG/M |
| 3300015054|Ga0137420_1354920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
| 3300015193|Ga0167668_1100576 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300015358|Ga0134089_10206567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300016294|Ga0182041_10055207 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
| 3300016319|Ga0182033_11149896 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300016357|Ga0182032_11817801 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300016387|Ga0182040_11284790 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300016404|Ga0182037_10671333 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300016422|Ga0182039_11578975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300017933|Ga0187801_10263000 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300017933|Ga0187801_10430143 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300017934|Ga0187803_10110646 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300017942|Ga0187808_10385776 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300017972|Ga0187781_10431611 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300017974|Ga0187777_10489033 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300017995|Ga0187816_10010981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3353 | Open in IMG/M |
| 3300017998|Ga0187870_1333243 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300017999|Ga0187767_10180364 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300018006|Ga0187804_10201966 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300018046|Ga0187851_10816149 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018047|Ga0187859_10263179 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300018062|Ga0187784_10012707 | All Organisms → cellular organisms → Bacteria | 6802 | Open in IMG/M |
| 3300018468|Ga0066662_10152757 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300020579|Ga0210407_10744180 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300020580|Ga0210403_10044503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3547 | Open in IMG/M |
| 3300020581|Ga0210399_10047647 | All Organisms → cellular organisms → Bacteria | 3441 | Open in IMG/M |
| 3300020581|Ga0210399_10593943 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300021086|Ga0179596_10363779 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300021168|Ga0210406_10335332 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300021168|Ga0210406_10626281 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300021171|Ga0210405_10743040 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300021401|Ga0210393_10318575 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300021401|Ga0210393_10393941 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300021403|Ga0210397_10948331 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300021405|Ga0210387_11240217 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021407|Ga0210383_10047351 | All Organisms → cellular organisms → Bacteria | 3584 | Open in IMG/M |
| 3300021478|Ga0210402_10297553 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300021479|Ga0210410_10877400 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300025501|Ga0208563_1021336 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300025922|Ga0207646_10716618 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300025934|Ga0207686_10233892 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300025939|Ga0207665_10277666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1246 | Open in IMG/M |
| 3300026328|Ga0209802_1202999 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300026330|Ga0209473_1218184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300026332|Ga0209803_1034970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2336 | Open in IMG/M |
| 3300026494|Ga0257159_1036989 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300026497|Ga0257164_1017068 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300026537|Ga0209157_1002353 | All Organisms → cellular organisms → Bacteria | 15120 | Open in IMG/M |
| 3300026540|Ga0209376_1147620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300027014|Ga0207815_1008402 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300027643|Ga0209076_1178955 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300027645|Ga0209117_1123182 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027655|Ga0209388_1072575 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300027660|Ga0209736_1026832 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300027671|Ga0209588_1148637 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300027701|Ga0209447_10035398 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300027727|Ga0209328_10196773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300027729|Ga0209248_10053980 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300027773|Ga0209810_1069830 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300027795|Ga0209139_10213701 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027853|Ga0209274_10034848 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
| 3300027869|Ga0209579_10215120 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300027903|Ga0209488_10760014 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300027915|Ga0209069_10897565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300028536|Ga0137415_11280159 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028792|Ga0307504_10391622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300028906|Ga0308309_10342003 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300028906|Ga0308309_11421545 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300029636|Ga0222749_10523817 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300030659|Ga0316363_10096245 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300031057|Ga0170834_109141545 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031233|Ga0302307_10471511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300031680|Ga0318574_10476496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300031718|Ga0307474_11024330 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031754|Ga0307475_11260369 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031795|Ga0318557_10393920 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031890|Ga0306925_11005333 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031897|Ga0318520_11069949 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031941|Ga0310912_10642642 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031941|Ga0310912_11403091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300031945|Ga0310913_10710022 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031954|Ga0306926_12466287 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300032001|Ga0306922_10274040 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
| 3300032055|Ga0318575_10181467 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300032059|Ga0318533_11291400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300032174|Ga0307470_10040164 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
| 3300032828|Ga0335080_10486770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300032892|Ga0335081_11910181 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300032893|Ga0335069_10521025 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300032893|Ga0335069_10676820 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300032954|Ga0335083_11370555 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300033004|Ga0335084_10017258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7301 | Open in IMG/M |
| 3300033134|Ga0335073_10164801 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.70% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.70% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.57% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_100856081 | 3300001867 | Forest Soil | PSVAILEWSERFPLQSPWPQVRIRLEHLGGDARRITIP* |
| JGI12627J18819_100903282 | 3300001867 | Forest Soil | IVILEWSEKFPLKTAWPQLSVRLEHLGGDSRRITLVGP* |
| JGIcombinedJ26739_1004171671 | 3300002245 | Forest Soil | ILEWSEKFPLQAPWPQVRLKLEHMGGDSRRITVG* |
| JGI25384J37096_100710062 | 3300002561 | Grasslands Soil | DFETLGMEDMFAAPTVAILEWSERFPLQSPWPQFRVRLEHLGGDSRRITVL* |
| JGI25613J43889_100076941 | 3300002907 | Grasslands Soil | MEDIFATPSVAILEWSERFPLXSAWPQIRVXLEHLGGDARRITVL* |
| JGI25382J43887_100764602 | 3300002908 | Grasslands Soil | APAVAILEWSEKFPLQSPWPLTRVRLEHLGGDSRRITVLDPA* |
| Ga0066673_101970171 | 3300005175 | Soil | DFETLGMEDLFAKPAIVILEWSERFPLPSPWPEIRIRLEHLGGDSRRITVL* |
| Ga0066679_108820361 | 3300005176 | Soil | TPAVAILEWSEKFPLPSPWPLVRVRLEHLGADSRRISVLDPT* |
| Ga0066388_1003408741 | 3300005332 | Tropical Forest Soil | TPAVAILEWSEKFPLPSPWPLVRVRLEHLGGDLRRISVPDPA* |
| Ga0070698_1012317691 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DLFAKPAIVILEWSERFPLPSPWPEMRVRLEHLGGDSRRITVL* |
| Ga0070731_101971371 | 3300005538 | Surface Soil | GLEDVFAKPAIVILEWSERFPLQLPWPEVRIRLEHCGGDLRRILVG* |
| Ga0070732_102515151 | 3300005542 | Surface Soil | GLEDVFASPAVVILEWSERFPLPSPWPQLRLRLEHQGGDTRRITVSAQ* |
| Ga0066692_100242852 | 3300005555 | Soil | TPSVAILEWSERFPLQSPWPQVQVRLEHLGGDARRITVL* |
| Ga0066699_103458962 | 3300005561 | Soil | ATPAVAILEWSEKFPLPSPWPLVRVRLEHLGADSRRISVLDPT* |
| Ga0066703_108090811 | 3300005568 | Soil | VILEWSERFPLPSPWPQIRIRLEHAGGDTRRIVVSA* |
| Ga0066694_103181072 | 3300005574 | Soil | VAILEWSERFPLQSPWPQVQVRLEHLGGDTRRITAL* |
| Ga0066691_106282252 | 3300005586 | Soil | FETLGMEDMFAAPTVAILEWSERFPLQSPWPQFRVRLEHLGGDSRRITVL* |
| Ga0066903_1023512932 | 3300005764 | Tropical Forest Soil | IEDVFSNPAIVILEWSEKFPLKTAWPQIRLRLEHLGGDVRRISRF* |
| Ga0070766_111023992 | 3300005921 | Soil | LGLEDAFAKPAVMILEWSEKFPLQAPWPQVRLKLEHMGGDSRRITVG* |
| Ga0070766_111114671 | 3300005921 | Soil | VVILEWSEKFPLESPWPQVRLRLEHLGADSRRILVL* |
| Ga0075029_1011653582 | 3300006052 | Watersheds | LEWSEKFPLKAAWPQLRLRLEHLGGDTRRITLLSPLESV* |
| Ga0075015_1006726841 | 3300006102 | Watersheds | SFRDFASLGMEDMFAEPAIAILEWSERFPLDAPWPQVRVLLEHLGHDQRRITVS* |
| Ga0070715_105767612 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LGMEDLFAKPTIVILEWSERFPLPSPWPEIRIRLEHLGGDLRRISVLSARSSEAH* |
| Ga0070712_1019185242 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YRIESFHDFETLGFEDVFAKPAVVILEWSEKFPLESPWPQLRLKLEHAGGDKRRIQIL* |
| Ga0079222_105883361 | 3300006755 | Agricultural Soil | DLFATPAVAILEWSERFPLQTPWPQVQVRLEHLGSDTRRITVL* |
| Ga0066665_111126642 | 3300006796 | Soil | GMEDMFAAPTVAILEWSERFPLQSPWPQFRVRLEHLGGDSRRITVL* |
| Ga0075433_110860901 | 3300006852 | Populus Rhizosphere | SKPGVVILEWSERFPLPSPWPEMRVRLEHLGGDARRITVL* |
| Ga0075436_1007880791 | 3300006914 | Populus Rhizosphere | IENFHDFETLGMEDIFSKPAIVILEWSERFPLASPWPEIRIRLEHLGRDSRRISLL* |
| Ga0075435_1011439161 | 3300007076 | Populus Rhizosphere | PGVVILEWSERFPLPSPWPEMRVRLEHLGGDARRITVL* |
| Ga0099791_106466551 | 3300007255 | Vadose Zone Soil | PAIVILEWSERFPPPSPWPEVRIRLEHLGGDSRRITVL* |
| Ga0099794_103693522 | 3300007265 | Vadose Zone Soil | AILEWSERFPLQSPWPRVRIRLEHFGGDARRIIVL* |
| Ga0099829_103038402 | 3300009038 | Vadose Zone Soil | ILEWSERFPLRSPWPQVRIHLEHSGGDARRIIVL* |
| Ga0099830_113602671 | 3300009088 | Vadose Zone Soil | PSVVILEWSERFPLHSPWPQFRVRLEHLGGDTRRITIF* |
| Ga0105247_101108761 | 3300009101 | Switchgrass Rhizosphere | LFSKPGVVILEWAERFPLPSPWPEMRIRLEHLGGDSRRISVL* |
| Ga0066709_1009997582 | 3300009137 | Grasslands Soil | MEDIFAKPSIVILEWSERFPLPSPWPQIRILLEHAGGDARRIVVSA* |
| Ga0116218_12562631 | 3300009522 | Peatlands Soil | ILEWSEKFPLKAPWPVIKVLLEHLGGDSRRITRG* |
| Ga0126380_112864251 | 3300010043 | Tropical Forest Soil | KPAIVILEWSEKFPLKTEWPQIRLRLEHLGGDARMISRF* |
| Ga0126384_103346171 | 3300010046 | Tropical Forest Soil | DLFNKPGVVILEWSERFPLPSPWPEMRIRLEHMGGDSRRITVL* |
| Ga0134082_101274431 | 3300010303 | Grasslands Soil | DFETLGMEDMFATPSVAILEWSERFPLQSPWPQVQVRLEHLGGDTRRITVL* |
| Ga0134109_100494741 | 3300010320 | Grasslands Soil | ILEWSERFPLQTPWPQVQVRLEHLGSDTRRITVL* |
| Ga0134111_104044022 | 3300010329 | Grasslands Soil | AILEWSERFPLQAPWPQLRVRLEHLGGDARRITVL* |
| Ga0074045_103837502 | 3300010341 | Bog Forest Soil | VFAEPAILILEWSEKFPLKTPWPVIRLRLEHLDGDSRRIVEC* |
| Ga0126372_102109972 | 3300010360 | Tropical Forest Soil | VILEWSERFPLPSPWPQVRIRLEHAGGDARRITVTS* |
| Ga0126372_104929121 | 3300010360 | Tropical Forest Soil | AVMILEWSEKFPLQAPWPQVRLKLEHMGGDSRRITVG* |
| Ga0126372_116937321 | 3300010360 | Tropical Forest Soil | AIVILEWSEKFPLKLSWPQLRVRLEHLGGDTRRITLL* |
| Ga0126378_104061862 | 3300010361 | Tropical Forest Soil | VILEWSERFPLKAPWPQVRVRLEHLGGDGRRITVES* |
| Ga0126378_124440382 | 3300010361 | Tropical Forest Soil | GLEDVFAQPAILILEWSDKFPLKTPWPQLRVQLEHLGGESRRIRVVEP* |
| Ga0126377_127251521 | 3300010362 | Tropical Forest Soil | DFETLGMEDIFENPAIFILEWSERFPLPSPWPQIRICLEHAGGDVRRITVSS* |
| Ga0126379_111772562 | 3300010366 | Tropical Forest Soil | EDLFAKPGIVILEWSERFPLEAPWPAVRIRLEHAGGDSRRITVW* |
| Ga0134122_100546331 | 3300010400 | Terrestrial Soil | DLFARSAVLILEWSEKFPLQSPWPQVRLKLEHAGGDKRRILVL* |
| Ga0137392_100314813 | 3300011269 | Vadose Zone Soil | ILEWSERFHLQSPWPQIRIRLEHLGGDARRITVL* |
| Ga0137391_108660762 | 3300011270 | Vadose Zone Soil | FAKPAIVILEWSEKFPLQSPWPQLRLKLEHAGGDKRRIVVL* |
| Ga0137393_110159411 | 3300011271 | Vadose Zone Soil | GMEDLFAKPAIVILEWSERFPLPSPWPEIRIRLEHVGGDSRRIAVL* |
| Ga0137388_100544771 | 3300012189 | Vadose Zone Soil | SVVILEWSERFPLQSPWPQFRVRLEHLGGDTRRITIF* |
| Ga0137388_115506632 | 3300012189 | Vadose Zone Soil | VVILEWSERFPLKSPWPEVRIRLEHLGGDARRITLP* |
| Ga0137365_104316602 | 3300012201 | Vadose Zone Soil | AIVILEWSERFPLASPWPEIRIRLEHLGGDSRRISIL* |
| Ga0137363_113955681 | 3300012202 | Vadose Zone Soil | HDFETLGMEDMFASPAVVILEWSERFPLPSPWPQVRLRLEHLGGDYRRITVL* |
| Ga0137363_114099271 | 3300012202 | Vadose Zone Soil | DFETLGMEDMFASPAVVILEWSERFPLPSPWPQVRLGLEHLGGDSRRITVL* |
| Ga0137362_107862711 | 3300012205 | Vadose Zone Soil | VVILEWSERFPLPSPWPQLRLKLEHLGGDSRRITQTP* |
| Ga0137362_109283621 | 3300012205 | Vadose Zone Soil | IETFHDFETLGMEDMFASPAVVILEWSERFPLPSPWPQVRLRLEHLGGDYRRITVL* |
| Ga0137362_110913921 | 3300012205 | Vadose Zone Soil | EDMFASPAVVILEWSERFPLPSPWPQVRLGLEHLGGDSRRITVL* |
| Ga0137381_110469512 | 3300012207 | Vadose Zone Soil | ILEWSERFPLPSPWPQIRIRLEHAGGDARRITVTP* |
| Ga0137377_100089051 | 3300012211 | Vadose Zone Soil | TLGMEDLFSKPAIVILEWSERFPLASPWPEIRIRLEHLGRDSRRISIL* |
| Ga0137384_109133141 | 3300012357 | Vadose Zone Soil | TLGMEDLFAKPAIVILEWSERFPLPSPWPEIRIRLEHLGGDSRRIIVL* |
| Ga0137360_105275992 | 3300012361 | Vadose Zone Soil | ATPAVAILEWSERFPLQSPWPQIRVRLEHLGGDARRITIL* |
| Ga0137361_109863131 | 3300012362 | Vadose Zone Soil | DIFAQPAVAILEWSERFPLQSPWPQIRVRLEHLGADTRRIQIDSL* |
| Ga0150984_1010986311 | 3300012469 | Avena Fatua Rhizosphere | EDVFAKPAVVILEWSEKFPLQSPWPQLRLKLEHAGGDKRRILVL* |
| Ga0137358_109916882 | 3300012582 | Vadose Zone Soil | GMEDMFSTPSVAILEWSERFPLQSPWPQVRLRLEHQGGDTRRITVL* |
| Ga0137398_106743361 | 3300012683 | Vadose Zone Soil | ILEWSERFPLKAPWPQIRIHLEHLGGDARRITVL* |
| Ga0137395_110531262 | 3300012917 | Vadose Zone Soil | VILEWSERFPLQSPWPQLRVKLEHLGGDSRRIQVT* |
| Ga0137359_114987421 | 3300012923 | Vadose Zone Soil | MFTTPSVAILEWSERFPLQYSWPQVQVRLEHLGGDARRITVL* |
| Ga0137413_108284741 | 3300012924 | Vadose Zone Soil | VILEWSERFPLPSPWPQIRILLEHAGGDARRIVVSA* |
| Ga0137419_109145121 | 3300012925 | Vadose Zone Soil | PAIVILEWSERFPLPSPWPQIHIRLEHAGGDARRITVSS* |
| Ga0137419_109756132 | 3300012925 | Vadose Zone Soil | TFHDFETLGMEDMFASPAVVILEWSERFPLPSPWPQVRLLLEHLGGDSRRITIL* |
| Ga0137407_102097811 | 3300012930 | Vadose Zone Soil | SFHDFETLGMEDLFAKPAIVILEWSERFPLPSPWPEIRIRLEHLGGDSRRIIVL* |
| Ga0137410_100297691 | 3300012944 | Vadose Zone Soil | IFAKPAIVILEWSERFPLPSPWPQIRILLEHAGGDARRIVVSA* |
| Ga0134076_103090782 | 3300012976 | Grasslands Soil | ETLGMEDMFATPSVAVLEWSERFPLQSPWPQVQVRMEHLGGDTRRITVL* |
| Ga0134079_101629132 | 3300014166 | Grasslands Soil | FETLGMEDMFAIPSVAILEWSERFPLQSPWPQVQVRLEHLGGDTRRITAL* |
| Ga0182024_1002242713 | 3300014501 | Permafrost | LFVTPAIAILEWSERFPLISPWPQIRIRLEHLGKDRRRITVL* |
| Ga0137411_13213529 | 3300015052 | Vadose Zone Soil | MEDMFATPSVAILEWSERFPLQSPWPQIRVRLEHLGRDARRITVL* |
| Ga0137420_10647083 | 3300015054 | Vadose Zone Soil | DIFATPSVAILEWSERFPLQSPWPQIRVRLEHLGADTRRITVL* |
| Ga0137420_10647101 | 3300015054 | Vadose Zone Soil | GYLHIFATPSVAILEWSERFPLQSPWPQIRVRLEHLGADTRRITVL* |
| Ga0137420_11679831 | 3300015054 | Vadose Zone Soil | LRNSPPSVAILEWSERFPLQSPWPQIRVRLEHLGADTRRITVL* |
| Ga0137420_13549201 | 3300015054 | Vadose Zone Soil | TLGMEDIFATPSVAILEWSERFPLQSPWPQIRVRLEHLGADTRRITVL* |
| Ga0167668_11005761 | 3300015193 | Glacier Forefield Soil | AVVILEWSERFPLPSPWPQLRLKLEHLGGDTRRIQVT* |
| Ga0134089_102065671 | 3300015358 | Grasslands Soil | SVAILEWSERFPLQAPWPQLHVRLEHLGGDARRITVL* |
| Ga0182041_100552072 | 3300016294 | Soil | LGLEDIFGQPSVIILEWSEKFPLKTPWPVLRLRLEHLGGDRRRITLL |
| Ga0182033_111498962 | 3300016319 | Soil | LFSKPGIVILEWSERFPLPSPWPSVRVRLEHLGGDSRRITVI |
| Ga0182032_118178012 | 3300016357 | Soil | DVFAQPAILILEWSEKFPLKAPWPQLRLHLEHLGGDSRRITQVTA |
| Ga0182040_112847901 | 3300016387 | Soil | ILEWSENFPLKVPWPQWYLRLEHLGGDARRITALTTYGSAT |
| Ga0182037_106713332 | 3300016404 | Soil | EDLFSKPGIVILEWSERFPLPSPWRSVRVRLEHLGGDSRRITLL |
| Ga0182039_115789752 | 3300016422 | Soil | LEWSEKFPLKTAWPQLRVRLEHLGGDARRITVLEG |
| Ga0187801_102630001 | 3300017933 | Freshwater Sediment | AEPAILILEWSEKFPLKVPWPVIRLRLEHLGGDSRRIMQL |
| Ga0187801_104301431 | 3300017933 | Freshwater Sediment | VFAQPAIVILEWSEKFPLKSAWPQLHVRLEHLGGDTRRIKVLSPAESA |
| Ga0187803_101106462 | 3300017934 | Freshwater Sediment | EPAILILEWSEKFPLKVPWPVIRLRLEHLGGDSRRIMQL |
| Ga0187808_103857762 | 3300017942 | Freshwater Sediment | FAYPAIVILEWSEKFPLKAPWPQWRLRLEHLGGDSRRITLDADEPK |
| Ga0187781_104316111 | 3300017972 | Tropical Peatland | IVILEWSEKFPLKASWPQFRVRLEHMGGNTRRLTLET |
| Ga0187777_104890331 | 3300017974 | Tropical Peatland | AIVILEWSEKFPLQTAWPQLRVHLQHLGGDSRRIQITEP |
| Ga0187816_100109811 | 3300017995 | Freshwater Sediment | ILILEWSEKFPLKAPWPQLRLRLEHLGGDSRRITIQAPQV |
| Ga0187870_13332431 | 3300017998 | Peatland | LILEWSEKFPLKTPWPVIRLLLEHLGGDSRHIVEF |
| Ga0187767_101803641 | 3300017999 | Tropical Peatland | AILEWSEKFPLKSPWPLLRIRLEHQGGDSRRITVLDPS |
| Ga0187804_102019661 | 3300018006 | Freshwater Sediment | TQPAILILEWSEKFPLKAPWPQLRLHLQHVGGDSRRITILAPQV |
| Ga0187851_108161492 | 3300018046 | Peatland | LEDVFAAPAILILEWSEKFPLKAPWPVMRVRLEHLGGDSRRITRS |
| Ga0187859_102631791 | 3300018047 | Peatland | VFAAPGILILEWSEKFPLKAPWPVMRVRLEHLGGDSRRITRS |
| Ga0187784_100127071 | 3300018062 | Tropical Peatland | LEDIFAKPAIVILEWSEKFPLKAPWPQLRVRLEHLGGDTRRITLESSPATSHGF |
| Ga0066662_101527572 | 3300018468 | Grasslands Soil | FETLGMEDMFAAPTVAILEWSERFPLQSPWPQFRVRLEHLGGNSRRITVL |
| Ga0210407_107441801 | 3300020579 | Soil | IVILEWSEKFPLKTEWPQIRVQLEHLGGDARRISRL |
| Ga0210403_100445033 | 3300020580 | Soil | VILEWSEKFPLKTEWPQIRLRLEHLGGDARRISRF |
| Ga0210399_100476473 | 3300020581 | Soil | TLGMEDVLAKPAIVILEWSEKFHLKTEWPQVRVRLEHLGGDSRRISRF |
| Ga0210399_105939431 | 3300020581 | Soil | KPAVVILEWSERFPLKSPWPQLSVKLQHLGADARRIKVT |
| Ga0179596_103637791 | 3300021086 | Vadose Zone Soil | PSVAILEWSERFPLKSPWPQIRIRLEHLGGDARRITVR |
| Ga0210406_103353321 | 3300021168 | Soil | EDVFTKPAIVILEWSEKFPLKTEWPQVRVRLEHLGGDSRRISRF |
| Ga0210406_106262812 | 3300021168 | Soil | LGLEDVFSKPAVVILEWSERFPLPSPWPQVRLRLEHAGGDRRRIVVV |
| Ga0210405_107430402 | 3300021171 | Soil | IVILEWSERFPLLSPWPKIHIRLEHHGGDSRLISVL |
| Ga0210393_103185752 | 3300021401 | Soil | ILILEWSEKFPLKAPWPQFRLRLEHLGGDTRRITLLTPEL |
| Ga0210393_103939412 | 3300021401 | Soil | VFAKPAVVILEWSERFPLQSPWPQVRIRLEHQGGDSRRISVG |
| Ga0210397_109483312 | 3300021403 | Soil | AIVILEWSEKFPLKTEWPQVRVRLEHLGGDSRRISRF |
| Ga0210387_112402172 | 3300021405 | Soil | KPAIVILEWSEKFPLKTEWPQIRVRLEHLGGDARRISRF |
| Ga0210383_100473511 | 3300021407 | Soil | DFETLVLEDVFAAPAVMILEWSEKFPLESPWPQVRVRLEHVGGDSRRILVG |
| Ga0210402_102975531 | 3300021478 | Soil | DVLAKPAIVILEWSEKFPLKTEWPQVRVRLEHLGGDSRRISRF |
| Ga0210410_108774001 | 3300021479 | Soil | ILEWSERFPLPSPWPQLRLRLEHQGGDTRRITVSAQ |
| Ga0208563_10213362 | 3300025501 | Peatland | EDVFAEPAILILEWSEKFPLKTPWPVIRLRLEHLGGDSRRIVEF |
| Ga0207646_107166182 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVILEWSERFPLPSPWPEMRVRLEHLGGDARRITVL |
| Ga0207686_102338921 | 3300025934 | Miscanthus Rhizosphere | FETLGMEDLFAKPGVVILEWSERFPLPSPWPEIRIRLEHLGGDSRRITVL |
| Ga0207665_102776662 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SVAILEWSERFPLRSPWPEIRVHLEHLGGDVRRITVL |
| Ga0209802_12029992 | 3300026328 | Soil | ETLGMEDMFAAPTVAILEWSERFPLQSPWPQFRVRLEHLGGDSRRITVL |
| Ga0209473_12181841 | 3300026330 | Soil | LGLEDMFAVPAVAIVEWSERFALPSPWPQVRVRLEHLGGDTRRISVLDPA |
| Ga0209803_10349702 | 3300026332 | Soil | GMEDMFTTSAVAILEWSERFPLRSPWPEIRVHLEHLGGDVRRITVL |
| Ga0257159_10369891 | 3300026494 | Soil | GMEDLFANPAIVILEWSERFPTPSPWPEVRIRLEHLGGDSRRITVL |
| Ga0257164_10170681 | 3300026497 | Soil | LGMEDMFACPTVVILEWSERFPLPSPWPKFRLRLEHLGGDSRRITVL |
| Ga0209157_10023531 | 3300026537 | Soil | PSVAILEWSERFPLQSPWPQVQVRLEHLGGDTRRITAL |
| Ga0209376_11476201 | 3300026540 | Soil | VAILEWSEKFPLPSPWPLVRVRLEHLGGNSRRISVLGPS |
| Ga0207815_10084022 | 3300027014 | Tropical Forest Soil | AVVILEWSEKFPLKTAWPQLRVRLEHLGGDARRITVLEG |
| Ga0209076_11789551 | 3300027643 | Vadose Zone Soil | AILEWSERFPLKSPWPQIRIRLEHLGGDARRITVR |
| Ga0209117_11231821 | 3300027645 | Forest Soil | SEKFPLKAPWPQFRLRLEHLGGDARQITLLAPLSGR |
| Ga0209388_10725751 | 3300027655 | Vadose Zone Soil | IEDMFTNPSVAILEWSERFPLQSPWPQFRVRLEHLGGDTRRITVF |
| Ga0209736_10268321 | 3300027660 | Forest Soil | VFAEPAIVILEWPEKFPLELAWPVVRLRLEHLGGDGRKITVL |
| Ga0209588_11486372 | 3300027671 | Vadose Zone Soil | MFATPSVVILEWSERFPLQSPWPQFRVRLEHLGGDTRRITIF |
| Ga0209447_100353981 | 3300027701 | Bog Forest Soil | ESFHDFETLGMEDMFTQPSIAILEWSERFPLEAPWPQVRIRLEHLGRDQRRITVF |
| Ga0209328_101967732 | 3300027727 | Forest Soil | ESFHDFETLGFEDVFEKPAIVILEWSERFPLKTPWPAVRIQLEHAGGDTRRISVL |
| Ga0209248_100539801 | 3300027729 | Bog Forest Soil | AKPAVVILEWSERFPLASPWPAFRVRLEHAGGDSRRITVL |
| Ga0209810_10698301 | 3300027773 | Surface Soil | GILIVEWSERFPLPSPWPQVRIRLEHLGGDKRRISVS |
| Ga0209139_102137011 | 3300027795 | Bog Forest Soil | GIAILEWSERFPLNAPWPQIRVQLEHLGQDQRRITVY |
| Ga0209274_100348481 | 3300027853 | Soil | APAVMILEWSEKFPLESPWPQVRLRLEHLGGDSRRIAVLGSGLP |
| Ga0209579_102151202 | 3300027869 | Surface Soil | GLEDVFAKPAIVILEWSERFPLQLPWPEVRIRLEHCGGDLRRILVG |
| Ga0209488_107600141 | 3300027903 | Vadose Zone Soil | VAILEWSERFPLQSPWPQIRVRLEHLGADTRSIQVDPL |
| Ga0209069_108975652 | 3300027915 | Watersheds | MFAMPTVAILEWSERFPLQSPWPQIRIRLEHLGGDARRITVL |
| Ga0137415_112801591 | 3300028536 | Vadose Zone Soil | SVAILEWSERFPLQSPWPQVRICLEHAGGDSRRITVG |
| Ga0307504_103916222 | 3300028792 | Soil | PAVVILEWSERFPLPSPWPQIRLRLEHLGSDSRRITLL |
| Ga0308309_103420031 | 3300028906 | Soil | EDAFAKPAVMILEWSEKFPLQAPWPQVRLKLEHLGGDSRRITLD |
| Ga0308309_114215452 | 3300028906 | Soil | DVFARPGIVILEWPEKFPLHVEWPVVRVRLEHAGGDRRRIRVL |
| Ga0222749_105238171 | 3300029636 | Soil | AKPAIVILEWSEKFPLKTEWPQIRVQLEHLGGDARRISRL |
| Ga0316363_100962451 | 3300030659 | Peatlands Soil | LGLEDVLAQPGILILEWSEKFPLKTPWPVIRLGLEHLGGDSRRIAEF |
| Ga0170834_1091415451 | 3300031057 | Forest Soil | VILEWSERFPLPSPWPEIRIRLEHLGGDSRRIAVL |
| Ga0302307_104715111 | 3300031233 | Palsa | FHDFETLGMEDMFTEPGIAILEWSERFPLEAPWPQVRIRLEHLGQDQRRITVD |
| Ga0318574_104764962 | 3300031680 | Soil | FETLGMEDLFSTPGIVILEWSERFPLPSPWPSVRVRLEHLGGDSRRITLL |
| Ga0307474_110243301 | 3300031718 | Hardwood Forest Soil | AFAKPAVMILEWSEKFPLQAPWPQVRLKLEHLGGDSRRITVG |
| Ga0307475_112603692 | 3300031754 | Hardwood Forest Soil | GLEDVFAEPAVVILEWSERFPLQSPWPKIHIRLEHHGGDSRLISVL |
| Ga0318557_103939201 | 3300031795 | Soil | VLILEWSERFPLPSPWPEMRIRLEHLGGDSRRITLL |
| Ga0306925_110053332 | 3300031890 | Soil | SKPAIVILEWSENFPLKTFWPQMRLQLQHLGGESRQITTL |
| Ga0318520_110699492 | 3300031897 | Soil | EDIFGQPSVIILEWSEKFPLKTPWPVLRLRLEHLGGDRRRITLL |
| Ga0310912_106426421 | 3300031941 | Soil | FHDFETLGMEDLFSTLGIVILEWSERFPLPSPWPSVRVRLEHLGGDSRRITLL |
| Ga0310912_114030911 | 3300031941 | Soil | LEWSEKFPLKMAWPQLRVRLEHLGGDARRITVLEP |
| Ga0310913_107100222 | 3300031945 | Soil | PAIIILEWSEKFPLKTEWPQIRLRLEHLGGDNRMISRL |
| Ga0306926_124662872 | 3300031954 | Soil | LGMEDLFSKPGIVILEWSERFPLRSPWPSVSVRLEHLGGDSRRITVS |
| Ga0306922_102740401 | 3300032001 | Soil | WSENFPLKVPWPQWYLRLEHLGGDARRITALTTYGSAT |
| Ga0318575_101814672 | 3300032055 | Soil | ILEWSDKFPLKMAWPQLRVRLEHLGGDARRITVME |
| Ga0318533_112914001 | 3300032059 | Soil | VILEWSEKFPLKMAWPQLRVRLEHLGGDARRITVMEQ |
| Ga0307470_100401642 | 3300032174 | Hardwood Forest Soil | IVILEWSEKFPLKTEWPQVRVRLEHLGGDARRISRF |
| Ga0335080_104867701 | 3300032828 | Soil | FAQPAIVILEWSENFPLKTPWPQIRLQLQHLGGDARQITVR |
| Ga0335081_119101811 | 3300032892 | Soil | VFVQPGIVILEWSEKFPLKSPWPQLRVKLEHLGGDNRRITVVERMGVGS |
| Ga0335069_105210251 | 3300032893 | Soil | KPAVVILEWSEKFPLKTEWPQIRLRLEHLGGDGRRISRL |
| Ga0335069_106768201 | 3300032893 | Soil | EDVFADPAIVILEWSDRFPLAMPWPQLRIQLEHLGGDSRRIRVLPP |
| Ga0335083_113705551 | 3300032954 | Soil | VIIILEWSDKFPLKTPWPQLAILLEHLGGDSRRIRVDKP |
| Ga0335084_100172581 | 3300033004 | Soil | DVFAKPAIVILEWSEKFPLTTDWPQVRLRLEHLGGDSRRISRL |
| Ga0335073_101648011 | 3300033134 | Soil | AEPAIVILEWSEKFPLKARWPLLQLRLEHMSGDARRITVLNPAI |
| ⦗Top⦘ |