| Basic Information | |
|---|---|
| Family ID | F033933 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LAYYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.43 % |
| % of genes from short scaffolds (< 2000 bps) | 85.23 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.295 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.977 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.568 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 9.09% Coil/Unstructured: 90.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF00459 | Inositol_P | 44.89 |
| PF08308 | PEGA | 4.55 |
| PF11528 | DUF3224 | 2.27 |
| PF07642 | BBP2 | 2.27 |
| PF13414 | TPR_11 | 1.14 |
| PF02518 | HATPase_c | 1.14 |
| PF00561 | Abhydrolase_1 | 1.14 |
| PF02566 | OsmC | 1.14 |
| PF01243 | Putative_PNPOx | 1.14 |
| PF13426 | PAS_9 | 1.14 |
| PF13551 | HTH_29 | 0.57 |
| PF01476 | LysM | 0.57 |
| PF12897 | Asp_aminotransf | 0.57 |
| PF03065 | Glyco_hydro_57 | 0.57 |
| PF03130 | HEAT_PBS | 0.57 |
| PF05343 | Peptidase_M42 | 0.57 |
| PF12840 | HTH_20 | 0.57 |
| PF05973 | Gp49 | 0.57 |
| PF08530 | PepX_C | 0.57 |
| PF04185 | Phosphoesterase | 0.57 |
| PF08673 | RsbU_N | 0.57 |
| PF12867 | DinB_2 | 0.57 |
| PF00326 | Peptidase_S9 | 0.57 |
| PF01850 | PIN | 0.57 |
| PF01565 | FAD_binding_4 | 0.57 |
| PF13744 | HTH_37 | 0.57 |
| PF01740 | STAS | 0.57 |
| PF02371 | Transposase_20 | 0.57 |
| PF00596 | Aldolase_II | 0.57 |
| PF05170 | AsmA | 0.57 |
| PF13589 | HATPase_c_3 | 0.57 |
| PF02922 | CBM_48 | 0.57 |
| PF04120 | Iron_permease | 0.57 |
| PF00581 | Rhodanese | 0.57 |
| PF00092 | VWA | 0.57 |
| PF00072 | Response_reg | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.14 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.14 |
| COG2208 | Phosphoserine phosphatase RsbU, regulator of sigma subunit | Transcription [K] | 1.14 |
| COG1362 | Aspartyl aminopeptidase | Amino acid transport and metabolism [E] | 0.57 |
| COG1363 | Putative aminopeptidase FrvX | Carbohydrate transport and metabolism [G] | 0.57 |
| COG2195 | Di- or tripeptidase | Amino acid transport and metabolism [E] | 0.57 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.57 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.57 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.30 % |
| Unclassified | root | N/A | 1.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105700186 | All Organisms → cellular organisms → Bacteria | 2618 | Open in IMG/M |
| 3300001154|JGI12636J13339_1022307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300001174|JGI12679J13547_1000323 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100701914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100713819 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100730148 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300002911|JGI25390J43892_10073011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 787 | Open in IMG/M |
| 3300002916|JGI25389J43894_1081231 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300002917|JGI25616J43925_10018710 | All Organisms → cellular organisms → Bacteria | 3069 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10091124 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300004091|Ga0062387_100623719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 777 | Open in IMG/M |
| 3300004091|Ga0062387_101551992 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005167|Ga0066672_10082000 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300005178|Ga0066688_10008967 | All Organisms → cellular organisms → Bacteria | 4812 | Open in IMG/M |
| 3300005566|Ga0066693_10237065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 720 | Open in IMG/M |
| 3300005995|Ga0066790_10247257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 761 | Open in IMG/M |
| 3300006041|Ga0075023_100106312 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300006047|Ga0075024_100463355 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006057|Ga0075026_100997285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300006172|Ga0075018_10720874 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006176|Ga0070765_100074883 | All Organisms → cellular organisms → Bacteria | 2853 | Open in IMG/M |
| 3300006354|Ga0075021_10478673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 787 | Open in IMG/M |
| 3300006755|Ga0079222_10394949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 959 | Open in IMG/M |
| 3300006804|Ga0079221_10521988 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300006954|Ga0079219_11741421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300007255|Ga0099791_10229263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300007258|Ga0099793_10320582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 755 | Open in IMG/M |
| 3300007265|Ga0099794_10058893 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300009038|Ga0099829_10695666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300009038|Ga0099829_11382858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 581 | Open in IMG/M |
| 3300009088|Ga0099830_10124425 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300009088|Ga0099830_10435702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1063 | Open in IMG/M |
| 3300009088|Ga0099830_11699055 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300009089|Ga0099828_10595976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 995 | Open in IMG/M |
| 3300009524|Ga0116225_1477669 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009635|Ga0116117_1015927 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300009700|Ga0116217_10410343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300009792|Ga0126374_11033212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300010048|Ga0126373_10125814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2404 | Open in IMG/M |
| 3300010048|Ga0126373_12231956 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300010048|Ga0126373_12728944 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010154|Ga0127503_10354298 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010303|Ga0134082_10165204 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300010339|Ga0074046_10626749 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010343|Ga0074044_10599973 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010362|Ga0126377_12129063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 637 | Open in IMG/M |
| 3300010376|Ga0126381_103010259 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300011269|Ga0137392_10520979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 987 | Open in IMG/M |
| 3300011269|Ga0137392_10615326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 901 | Open in IMG/M |
| 3300011271|Ga0137393_10232185 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300011271|Ga0137393_10377604 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300011271|Ga0137393_10820149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 795 | Open in IMG/M |
| 3300012189|Ga0137388_10041887 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 | 3655 | Open in IMG/M |
| 3300012189|Ga0137388_10201898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1792 | Open in IMG/M |
| 3300012189|Ga0137388_10280335 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300012189|Ga0137388_10397982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300012189|Ga0137388_10584324 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300012202|Ga0137363_11484053 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012203|Ga0137399_10946932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 725 | Open in IMG/M |
| 3300012207|Ga0137381_10101884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2436 | Open in IMG/M |
| 3300012210|Ga0137378_10073382 | All Organisms → cellular organisms → Bacteria | 3108 | Open in IMG/M |
| 3300012285|Ga0137370_10265200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
| 3300012351|Ga0137386_11089231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300012362|Ga0137361_10432829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300012683|Ga0137398_11115055 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012918|Ga0137396_10174188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1575 | Open in IMG/M |
| 3300012918|Ga0137396_11056175 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012918|Ga0137396_11060860 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012922|Ga0137394_10942734 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300012922|Ga0137394_11202433 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012925|Ga0137419_10437245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
| 3300012925|Ga0137419_11371238 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012927|Ga0137416_12051072 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012929|Ga0137404_10072936 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300012929|Ga0137404_11291719 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300015054|Ga0137420_1297304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1862 | Open in IMG/M |
| 3300015242|Ga0137412_10736267 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300015245|Ga0137409_10957908 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300015245|Ga0137409_11485444 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300015264|Ga0137403_10665959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
| 3300016319|Ga0182033_10080065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2335 | Open in IMG/M |
| 3300016404|Ga0182037_10520846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300016702|Ga0181511_1187219 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300017823|Ga0187818_10125314 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300017823|Ga0187818_10535029 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300017934|Ga0187803_10379011 | Not Available | 571 | Open in IMG/M |
| 3300017936|Ga0187821_10189589 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300017955|Ga0187817_10020398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3930 | Open in IMG/M |
| 3300018006|Ga0187804_10089813 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300018006|Ga0187804_10118846 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300018035|Ga0187875_10007068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7430 | Open in IMG/M |
| 3300018058|Ga0187766_11102948 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300018085|Ga0187772_10083590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2028 | Open in IMG/M |
| 3300018090|Ga0187770_10105113 | All Organisms → cellular organisms → Bacteria | 2112 | Open in IMG/M |
| 3300018482|Ga0066669_10315151 | Not Available | 1278 | Open in IMG/M |
| 3300020015|Ga0193734_1056863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300020170|Ga0179594_10233636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300020170|Ga0179594_10345723 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300020199|Ga0179592_10002003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8399 | Open in IMG/M |
| 3300020199|Ga0179592_10109793 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300020580|Ga0210403_10309157 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300020581|Ga0210399_11102717 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300020582|Ga0210395_11125195 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300020582|Ga0210395_11155211 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300020583|Ga0210401_11242469 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300020583|Ga0210401_11518979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300021088|Ga0210404_10139763 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300021088|Ga0210404_10487939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 695 | Open in IMG/M |
| 3300021088|Ga0210404_10666982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 592 | Open in IMG/M |
| 3300021088|Ga0210404_10898232 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021168|Ga0210406_10018349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6581 | Open in IMG/M |
| 3300021168|Ga0210406_10208273 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300021168|Ga0210406_10432958 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300021170|Ga0210400_10289497 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300021170|Ga0210400_10586722 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300021178|Ga0210408_10620936 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300021181|Ga0210388_10928345 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300021401|Ga0210393_10014970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6006 | Open in IMG/M |
| 3300021407|Ga0210383_10978828 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021420|Ga0210394_10371056 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300021433|Ga0210391_10078119 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
| 3300021475|Ga0210392_10228935 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300021478|Ga0210402_10078797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2926 | Open in IMG/M |
| 3300021479|Ga0210410_11684394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300021559|Ga0210409_10579036 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300024178|Ga0247694_1020264 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300024330|Ga0137417_1036743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 803 | Open in IMG/M |
| 3300026317|Ga0209154_1101545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 1226 | Open in IMG/M |
| 3300026317|Ga0209154_1169646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300026374|Ga0257146_1031152 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300026542|Ga0209805_1317858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 591 | Open in IMG/M |
| 3300026551|Ga0209648_10389529 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300026859|Ga0207859_1021523 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300027034|Ga0209730_1016386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300027071|Ga0209214_1033260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300027297|Ga0208241_1076202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300027439|Ga0209332_1067846 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027651|Ga0209217_1215684 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027655|Ga0209388_1233076 | Not Available | 504 | Open in IMG/M |
| 3300027678|Ga0209011_1059443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_56_17 | 1154 | Open in IMG/M |
| 3300027729|Ga0209248_10083351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300027737|Ga0209038_10245310 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027748|Ga0209689_1009826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6394 | Open in IMG/M |
| 3300027862|Ga0209701_10004240 | All Organisms → cellular organisms → Bacteria | 9418 | Open in IMG/M |
| 3300027862|Ga0209701_10425844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 735 | Open in IMG/M |
| 3300027869|Ga0209579_10113341 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300027882|Ga0209590_10415128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300027894|Ga0209068_10456747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 733 | Open in IMG/M |
| 3300027965|Ga0209062_1236399 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300028906|Ga0308309_10773933 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300028906|Ga0308309_11636339 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300029636|Ga0222749_10018321 | All Organisms → cellular organisms → Bacteria | 2880 | Open in IMG/M |
| 3300029636|Ga0222749_10144964 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300029636|Ga0222749_10495554 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300030520|Ga0311372_10495089 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300031474|Ga0170818_113138662 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031573|Ga0310915_10179340 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300031682|Ga0318560_10136877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1290 | Open in IMG/M |
| 3300031720|Ga0307469_10888951 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031748|Ga0318492_10736855 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031754|Ga0307475_10342943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1200 | Open in IMG/M |
| 3300031768|Ga0318509_10560950 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031777|Ga0318543_10416344 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031820|Ga0307473_10978994 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031823|Ga0307478_11405338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_7 | 579 | Open in IMG/M |
| 3300031860|Ga0318495_10318464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300031941|Ga0310912_10443755 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031947|Ga0310909_10055913 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300032001|Ga0306922_11509820 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300032001|Ga0306922_12391181 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032042|Ga0318545_10180261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300032160|Ga0311301_10098328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5755 | Open in IMG/M |
| 3300032180|Ga0307471_100230206 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300032180|Ga0307471_103544767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300032783|Ga0335079_10154237 | All Organisms → cellular organisms → Bacteria | 2574 | Open in IMG/M |
| 3300032805|Ga0335078_10062874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5448 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.84% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.14% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.14% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.14% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.57% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.57% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1057001866 | 3300000364 | Soil | PNPRGAPNTYRTIEVKVLEGYTARHRTSYLSGAQ* |
| JGI12636J13339_10223071 | 3300001154 | Forest Soil | AYYPTPRGPANTYRSILVTVTPAGYHVRHRKSYLTGP* |
| JGI12679J13547_10003233 | 3300001174 | Forest Soil | RLAYYPTPRGPANSYRSIEVKVRGKYQVRHRKSYLTGAQ* |
| JGIcombinedJ26739_1007019143 | 3300002245 | Forest Soil | YYPEPRGPANTYRKIEVKVAGNYQVRHRKTYLTGPQ* |
| JGIcombinedJ26739_1007138191 | 3300002245 | Forest Soil | RLGYYPNPPGPVNTYRSIQVKVLDNYKVRHRKTYLTGPK* |
| JGIcombinedJ26739_1007301482 | 3300002245 | Forest Soil | AELRTQYRLAYYPYPRGAANTYRKIEVKVLPGYTARHRTAYLVGAQ* |
| JGI25390J43892_100730112 | 3300002911 | Grasslands Soil | LAYYPPPRGPANTYRSIVVTVTPANYQVRHRRSYLTGPQ* |
| JGI25389J43894_10812312 | 3300002916 | Grasslands Soil | TQYLLAYYPTPRGPANTYRSIVVTVTPANYQVRHRRSYLTGPQ* |
| JGI25616J43925_100187101 | 3300002917 | Grasslands Soil | ELRTQYLLAYYPTPRGPANTYRSIQVTVTPADYHVRHRKSYLTGPQ* |
| JGIcombinedJ51221_100911243 | 3300003505 | Forest Soil | LGYYPTPRGPASTYRNIEVKVLNGNYHVRARKTYLTGPQ* |
| Ga0062387_1006237191 | 3300004091 | Bog Forest Soil | DSELRTQYRLAYYPNPRGPANSYRTIEVKVLPGYTARHRTTYLSGPQ* |
| Ga0062387_1015519922 | 3300004091 | Bog Forest Soil | ELRTQYRLAYYPNPAGKPNTYRTIDVKVPTGYTARHRTTYLGGAQ* |
| Ga0066672_100820001 | 3300005167 | Soil | QYLLVYYPTPRGPANTYRSIQVTVTPADYHVRHRKSYLTGPQ* |
| Ga0066688_100089676 | 3300005178 | Soil | RTQYLLAYYPTPRGPANTFRSIQVTVTPADYHVRHRKSYLTGPQ* |
| Ga0066693_102370651 | 3300005566 | Soil | QYLLAYYPTPRGPANTYRSIVVTVTPSNYQVRHRRSYLTGPQ* |
| Ga0066790_102472572 | 3300005995 | Soil | LRTQYRLGYYPNPRGPANTYRSIEVKVLDNYKARHRKTYLTGPQ* |
| Ga0075023_1001063121 | 3300006041 | Watersheds | LRTQYRLGYYPNPRGPANTYRSIEVKVSGKYQVRHRKSYLTGPQ* |
| Ga0075024_1004633551 | 3300006047 | Watersheds | GYYPNPRGAANSYRSIEVKVSGKYQVRHRKSYLSGPQ* |
| Ga0075026_1009972852 | 3300006057 | Watersheds | PTPRGPANTYRSIEVKVSGKYQVRHRKSYLTGPQ* |
| Ga0075018_107208741 | 3300006172 | Watersheds | LAYYPNPRGAPNTYRTIEVKVLEGYTARHRTSYLSGAQ* |
| Ga0070765_1000748834 | 3300006176 | Soil | RLAYYPNPRGAANTYRKIEVKMLPGYTARHRTAYLVGAQ* |
| Ga0075021_104786732 | 3300006354 | Watersheds | PNPRGPASTYRSIQVTVTPADYHVRHRKSYLTGPQ* |
| Ga0079222_103949491 | 3300006755 | Agricultural Soil | TQYRLGYYPDPRGPANSYRSIQVKVAGNYQVRHRKSYLTGPQ* |
| Ga0079221_105219882 | 3300006804 | Agricultural Soil | RLGYYPNPKGSPETYRTIDVKVQGKYSVRHRKTYYTGRQ* |
| Ga0079219_117414211 | 3300006954 | Agricultural Soil | RLAYYPNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAPQ* |
| Ga0099791_102292631 | 3300007255 | Vadose Zone Soil | NPRGPANTYRSIVVKVSPGNYKVRHRKSYLTGPQ* |
| Ga0099793_103205821 | 3300007258 | Vadose Zone Soil | PTPRGPANTYRSIGVTVHPATYHVRHRKSYLTGPQ* |
| Ga0099794_100588933 | 3300007265 | Vadose Zone Soil | YRLGYYPNPRGPANTYRQIEVKVPAKYQVRHRKSYLTGPQ* |
| Ga0099829_106956661 | 3300009038 | Vadose Zone Soil | YYPNPRGPANTYRSIVVRVSPGNYQVRHRRSYLTAPQ* |
| Ga0099829_113828581 | 3300009038 | Vadose Zone Soil | ELRTQYLLAYYPTPRGPANTYRSIVVTVNPATYHVRHRKSYLTGPQ* |
| Ga0099830_101244252 | 3300009088 | Vadose Zone Soil | LGYYPNPRGPANTYRQLEVKVPGKYQVRHRKSYLTGPQ* |
| Ga0099830_104357023 | 3300009088 | Vadose Zone Soil | YPNPRGPANSYRSIEVKVIAGDYKVRHRRSYLTGPQ* |
| Ga0099830_116990551 | 3300009088 | Vadose Zone Soil | PNPRGPANSYRSIEVKVIAGDYKVRHRRSYLTGPQ* |
| Ga0099828_105959761 | 3300009089 | Vadose Zone Soil | YPNPRGPANTYRSIVVTVDPATYHVRHRKSYLTGPQ* |
| Ga0116225_14776692 | 3300009524 | Peatlands Soil | QYRLAYYPNPRGAANTYRTIEVKVLPGYTARHRTTYLSGPQ* |
| Ga0116117_10159271 | 3300009635 | Peatland | QELRTQYRLAYYPNPRGPANSYRSIDVKVLGTYHVRHRTSYLTGPQ* |
| Ga0116217_104103432 | 3300009700 | Peatlands Soil | LLAYYPSPRGPANTYRSIVVTVDPSTYHVRHRKSYLTGPQ* |
| Ga0126374_110332123 | 3300009792 | Tropical Forest Soil | NPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAPQ* |
| Ga0126373_101258141 | 3300010048 | Tropical Forest Soil | YRLGYYPNPRRPANTYRRIEVQVLPGYAARHRTSYLTQ* |
| Ga0126373_122319561 | 3300010048 | Tropical Forest Soil | SELRTQYRLAYYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ* |
| Ga0126373_127289441 | 3300010048 | Tropical Forest Soil | YYPNPRGPANSYRSIDVKVTTGNYQVRHRKTYLTAPQ* |
| Ga0127503_103542982 | 3300010154 | Soil | HELRTQYRLAYYPNPRGAPNTYRTIEVKVLEGYTARHRTSYLSGAQ* |
| Ga0134082_101652041 | 3300010303 | Grasslands Soil | YYPTPRGPANSFRSIQVTVTPADYHLRHRKSYLTGPQ* |
| Ga0074046_106267491 | 3300010339 | Bog Forest Soil | PNPRGPVNSYRTIEVKVLPGYSARHRTTYLTGPQ* |
| Ga0074044_105999732 | 3300010343 | Bog Forest Soil | ENELRTQYRMAYYPNPRGPANTYRTIEVKVLPGYTARHRTTYLTGPQ* |
| Ga0126377_121290631 | 3300010362 | Tropical Forest Soil | ELRTQYRLAYYPNPRGPADSLRNIEVSVLGDYKVRHRKNYYTGKE* |
| Ga0126381_1030102592 | 3300010376 | Tropical Forest Soil | YPNPRGPANSYRTIEVKVLPGYTARHRTTYFTGPQ* |
| Ga0137392_105209791 | 3300011269 | Vadose Zone Soil | AYYPNPHGPANTYRSIEVKVTTGNYQVRHRKSYLTAPQ* |
| Ga0137392_106153261 | 3300011269 | Vadose Zone Soil | AYYPTPRGPANTYRSIVVTVNPATYHVRHRKSYLTGPQ* |
| Ga0137393_102321851 | 3300011271 | Vadose Zone Soil | QYLLAYYPTPRGPANTYRSIVVTVAPSTYHVRHRRSYLTGPQ* |
| Ga0137393_103776042 | 3300011271 | Vadose Zone Soil | RTQYRLAYYPNPRGAADSYRKIEVKMLPGYTARHRTAYLVGAQ* |
| Ga0137393_108201491 | 3300011271 | Vadose Zone Soil | PTPRGPANTYRSIVVTVNPATYHVRHRKSYLTGPQ* |
| Ga0137388_100418871 | 3300012189 | Vadose Zone Soil | TPRGPANTYRSIVVTVDPATYHVRHRKSYLTGPQ* |
| Ga0137388_102018981 | 3300012189 | Vadose Zone Soil | YRLGYYPNPRGPANTYRQIEVKVAGNYQVRHSKSYLTGPQ* |
| Ga0137388_102803352 | 3300012189 | Vadose Zone Soil | YRLAYYPNPRGPANTYRNLEVKVFRGDYHVRHRKTYFTGPQ* |
| Ga0137388_103979821 | 3300012189 | Vadose Zone Soil | QYRLGYYPNPRGPANSYRSIEVKVIAGDYKVRHRRSYLTGPQ* |
| Ga0137388_105843243 | 3300012189 | Vadose Zone Soil | AYYPNPRGPANTYRSIVVTVSPGNYKVRHRKSYLTGPQ* |
| Ga0137363_114840531 | 3300012202 | Vadose Zone Soil | YPNPRGPANTYRSIVVTVTPSTYKVRHRKSYLTGPQ* |
| Ga0137399_109469322 | 3300012203 | Vadose Zone Soil | LRTQYLLAYYPTPRGLANTYRSIVVTVTPASYQVRHRKSYLTGPQ* |
| Ga0137381_101018841 | 3300012207 | Vadose Zone Soil | AYYPNPRGPANTYRSIEVKVTTGNYKVRHRKSYLTATQ* |
| Ga0137378_100733821 | 3300012210 | Vadose Zone Soil | TQYLLAYYPTPRGPANTYRSIAVAVNSSGYHVRHRKSYLTGPQGIRDWWHF* |
| Ga0137370_102652003 | 3300012285 | Vadose Zone Soil | YPTPRGPANTFRSIQVTVTPADYHVRHRKSYLTGPQ* |
| Ga0137386_110892312 | 3300012351 | Vadose Zone Soil | LLAYYPNPRGPANTYRSILVSVNPATYHVRHRKSYLTGPQ* |
| Ga0137361_104328291 | 3300012362 | Vadose Zone Soil | PNPRGPANTYRQIEVKVPAKYQVRHRKSYLTGSQ* |
| Ga0137398_111150552 | 3300012683 | Vadose Zone Soil | RWASYQNTRGAANSYRKIEVKMLPGYTARHRTAYLVGAQ* |
| Ga0137396_101741883 | 3300012918 | Vadose Zone Soil | LLAYYPTPRGPANTYRSIRVTVTPAGYHVRHRKSYLTGPQ* |
| Ga0137396_110561751 | 3300012918 | Vadose Zone Soil | TPRGLANTYRSIVVTVTPASYQVRHRKSYLTGPQ* |
| Ga0137396_110608602 | 3300012918 | Vadose Zone Soil | YRLAYYPNPRGPANTYRSIVVTVTPSAYKVRHRKSYLTGPQ* |
| Ga0137394_109427341 | 3300012922 | Vadose Zone Soil | DRELRTQYRLAYYPNPRGPANTYRSIVVTVTPSTYKVRHRKSYLTGPQ* |
| Ga0137394_112024332 | 3300012922 | Vadose Zone Soil | ELRTQYRLAYYPNPRGAANTYRKIEVKMLPGYAARHRTMYLVGAQ* |
| Ga0137419_104372451 | 3300012925 | Vadose Zone Soil | QYLLAYYPTPRGPANTYRSIVVTVDPSTFHVRHRKSYLTGPQ* |
| Ga0137419_113712382 | 3300012925 | Vadose Zone Soil | YRLGYYPTPRGPANTYREIEVKVSGKYQVRHRKSYLTGAQ* |
| Ga0137416_120510721 | 3300012927 | Vadose Zone Soil | LLAYYPIPRGPANTYRSIVVTVNPASYHVRHRRSYLTGPQ* |
| Ga0137404_100729361 | 3300012929 | Vadose Zone Soil | YPNPRGPANTYRSIVVTVSPSTYKVRHRKSYLTGPQ* |
| Ga0137404_112917192 | 3300012929 | Vadose Zone Soil | EAELRTQYRLAYYPNPRGAANSYRKIEVKMLPGYTARHRTAYLVGAQ* |
| Ga0137420_12973041 | 3300015054 | Vadose Zone Soil | LRTQYLLAYYPTPRGPANTYRSILVTVTPSTYQVRHRKSYLTGPQ* |
| Ga0137412_107362671 | 3300015242 | Vadose Zone Soil | GYYPEPRGPANTYRAVPVKVDGNYQVRHRKTYLIGPQ* |
| Ga0137409_109579082 | 3300015245 | Vadose Zone Soil | RLAYYPTPRGAATTYRKIEVKMLPGYAARHRTMYLVGAQ* |
| Ga0137409_114854442 | 3300015245 | Vadose Zone Soil | LRTQYRLAYYPNPRGPANTYRSIAVKVSPANYKVRHRKSYLTGPQ* |
| Ga0137403_106659591 | 3300015264 | Vadose Zone Soil | IDRELRTQYRLAYYPNPRGPANTYRSIVVTVTPSTYKVLHRKSYLTGPQ* |
| Ga0182033_100800651 | 3300016319 | Soil | LAYYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ |
| Ga0182037_105208462 | 3300016404 | Soil | RTQYRLAYYPNPRGPANSYRSIDVKVTTGNYQVRHRKTYLTAPQ |
| Ga0181511_11872192 | 3300016702 | Peatland | DNELRTQYRLAYYPNPRGPANTYRTIEVKVLPGYTARHRTTYLTGPQ |
| Ga0187818_101253141 | 3300017823 | Freshwater Sediment | LAYYPNPRGPANSYRTIEVKVLPGYTARHRTAYVTGPQ |
| Ga0187818_105350291 | 3300017823 | Freshwater Sediment | ELRTQYRLAYYPNPRGPANSYRTIEVKVLPGYTARHRTTYLTGPY |
| Ga0187803_103790111 | 3300017934 | Freshwater Sediment | YYPSPHGPANAYRTIEVKVLNGDYHVRHRKTYLTGPQ |
| Ga0187821_101895892 | 3300017936 | Freshwater Sediment | RTQYRLGYYPNPRGPANTYRNVEVKVLNGDYHVRSRKTYLTGPQ |
| Ga0187817_100203984 | 3300017955 | Freshwater Sediment | RELRTQYLLSYYPSPKGPANTYRSIQIRVSPEGYQVRHRKSYLTGPD |
| Ga0187804_100898131 | 3300018006 | Freshwater Sediment | RTQYRLAYYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ |
| Ga0187804_101188461 | 3300018006 | Freshwater Sediment | LRTQYRLGYYPNPRGPANTYRTIEVKVSGNYQVRHRKTYLTGPQ |
| Ga0187875_100070681 | 3300018035 | Peatland | YPNPRGAANTYRTIEVKVLPGYTARHRTTYLAGPQ |
| Ga0187766_111029481 | 3300018058 | Tropical Peatland | ELRTQYRLAYYPNPRAPANTYRTIEVKVLPGYTARHRTTYLTGPQ |
| Ga0187772_100835903 | 3300018085 | Tropical Peatland | YPNPRGAANTFRTIEVKVLPGYTARHRTTYLSGPQ |
| Ga0187770_101051131 | 3300018090 | Tropical Peatland | PNPRGAANTYRSIEVKITTGNYQVRHRKTYLTAPQ |
| Ga0066669_103151511 | 3300018482 | Grasslands Soil | RTQYLLAYYPTPRGPANTYRSIVVAVTPANYQVRHRRSYLTGPQ |
| Ga0193734_10568632 | 3300020015 | Soil | RTQYLLAYYPTPRGPANTYRSIVVAVNPSGYHVRHRKSYLTGPQ |
| Ga0179594_102336361 | 3300020170 | Vadose Zone Soil | YPNPRGPANTYREIEVKVSGKYQVRHRKSYLTGPQ |
| Ga0179594_103457231 | 3300020170 | Vadose Zone Soil | RLAYYPNPRGPANTYRSIVVKVAAADYKVRHRKSYLTGPQ |
| Ga0179592_100020031 | 3300020199 | Vadose Zone Soil | VRTQYRLAYYPNPRGAANTYRKIEVKMLPGYAARHRTAYLVGAQ |
| Ga0179592_101097931 | 3300020199 | Vadose Zone Soil | YYPNPRGPANTYRSMEVKVSGKYQVRHRKSYLTGPQ |
| Ga0210403_103091573 | 3300020580 | Soil | YYPTPRGPANTYRSIVVTVTPSNFQVRHRKSYLTGPQ |
| Ga0210399_111027171 | 3300020581 | Soil | LAYYPNPRGPANTYRTIEVKVLPGYTARHRTTYLSGPQ |
| Ga0210395_111251951 | 3300020582 | Soil | YRLAYYPTPRGPANTYRKIEVKVLNGDYHVRSRKTYLTGPQ |
| Ga0210395_111552111 | 3300020582 | Soil | RINSELRTQYRLAYYPNPRGPANTYRTIEVKVLPGYTARHRTTYLTGPQ |
| Ga0210401_112424691 | 3300020583 | Soil | LAYYPTPRGPANTYRKIEVKVLNGDYHVRSRKTYLTGPQ |
| Ga0210401_115189791 | 3300020583 | Soil | LRTQYRLGYYPNPRGPADTYRAIEVKVLSGDYHARHRKSYLTGP |
| Ga0210404_101397631 | 3300021088 | Soil | RLAYYPNPRGAANSYRKIEVKMLPGYTARHRTAYLVGAQ |
| Ga0210404_104879391 | 3300021088 | Soil | LRTQYLLAYYPTPRGPANTYRSIVVTVDPATFHVRHRKSYLTGSQ |
| Ga0210404_106669821 | 3300021088 | Soil | ELRTQYLLAYYPNPRGPANTYRSIVVTVDPATYHVRHRKSYLTGLP |
| Ga0210404_108982322 | 3300021088 | Soil | YRLGYYPEPRGPANTYRTIKVTVDGNYQVRHRKTYLTGPQ |
| Ga0210406_100183491 | 3300021168 | Soil | YPNPHGPANSYRNIEVKVLGTYHVRHRKSYLSGPQ |
| Ga0210406_102082731 | 3300021168 | Soil | QYRLGYYPEPRGPANTYRTIKVTVDGNYQVRHRKTYLTGPQ |
| Ga0210406_104329581 | 3300021168 | Soil | DNELRTQYRLAYYPNPRGPVNTYRTIEVKVLPGYTARHRTTYLSAQ |
| Ga0210400_102894972 | 3300021170 | Soil | YYPTPRGPANTYRSIVVTVNPATYHVRHRKSYLTGPQ |
| Ga0210400_105867221 | 3300021170 | Soil | SYYPMPRGPANTYRKIEVKVLGDYNVRHRKTYLTEPQ |
| Ga0210408_106209361 | 3300021178 | Soil | YPNTPGPANTYRKIEVKVLGDYVVRHRKTYLTGPQ |
| Ga0210388_109283452 | 3300021181 | Soil | TQYRLAYYPNPRGPANTYRTIEVKVLPGYTARHRTTYLSGPQ |
| Ga0210393_100149701 | 3300021401 | Soil | RLAYYPTPRGAANSYRKIEVKMIPGYTARHRTAYLVGAQ |
| Ga0210383_109788281 | 3300021407 | Soil | RTQYRLAYYPTPRGPANTYRKVEVKVLNGDYHVRARKTYLTGAQ |
| Ga0210394_103710562 | 3300021420 | Soil | LAYYPNPRGAANTYRKIEVKMLPGYTARHRTAYLVGAQ |
| Ga0210391_100781194 | 3300021433 | Soil | RLGYYPTPRGPASTYRNIEVKVLNGNYHVRARKTYLTGPQ |
| Ga0210392_102289353 | 3300021475 | Soil | YPTPRGPANTYRKVEVKVLNGDYHVRARKTYLTGAQ |
| Ga0210402_100787971 | 3300021478 | Soil | LAYYPNPRGAANTYRKIEVKMLPGYAARHRTAYLVGAQ |
| Ga0210410_116843943 | 3300021479 | Soil | VDGKALGPVNTYRSIEVKDFNGEYHVRHRKTYLTGPQ |
| Ga0210409_105790362 | 3300021559 | Soil | YYPNPRGPANTYRSIVVTVTPSTYKVRHRKSYLTGPQ |
| Ga0247694_10202642 | 3300024178 | Soil | RIEAELRTQYRLAYYPNPRGVANTYRKIEVKMQPGYAARHRTAYLVGAQ |
| Ga0137417_10367432 | 3300024330 | Vadose Zone Soil | AYYPNPRGPANTYRSIIVTVDPATYHVRHRKSYLTGPQ |
| Ga0209154_11015451 | 3300026317 | Soil | QYLLVYYPTPRGPANTYRSIQVTVTPADYHVRHRKSYLTGPQ |
| Ga0209154_11696462 | 3300026317 | Soil | RLAYYPNPRGPANTYRSIEVKVTTGNYQVRHRKSYLTAPQ |
| Ga0257146_10311521 | 3300026374 | Soil | WLAYYPNPRGPANTYRKIEVKMLPGYAARHRTAYLVGAQ |
| Ga0209805_13178581 | 3300026542 | Soil | LRTQYLLAYYPTPRGPANTFRSIQVTVTPADYHVRHRKSYLTGPQ |
| Ga0209648_103895294 | 3300026551 | Grasslands Soil | YLLAYYPTPRGPANTYRSIRVTVTPAGYHVRHRKSYLTGPQ |
| Ga0207859_10215232 | 3300026859 | Tropical Forest Soil | YRLAYYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ |
| Ga0209730_10163862 | 3300027034 | Forest Soil | PNPRGPANTYRSIEVKVSTGNYQVRHRKSYLTAPQ |
| Ga0209214_10332602 | 3300027071 | Forest Soil | AYYPNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTASQ |
| Ga0208241_10762021 | 3300027297 | Forest Soil | TQYRLAYYPNPRGPANTYRSIVVTVAPANYQVRHRKSYLTGPQ |
| Ga0209332_10678462 | 3300027439 | Forest Soil | RLGYYPNPPGPVNTYRSIQVKVLDNYKVRHRKTYLTGPK |
| Ga0209217_12156843 | 3300027651 | Forest Soil | QYRLGYYPNPPGPANTYRSIQVKVLDNYKVRHRKTYLTGPK |
| Ga0209388_12330762 | 3300027655 | Vadose Zone Soil | AYYPNPRGPANTYRSIVVKVAAADYKVRHRKSYLTGPQ |
| Ga0209011_10594431 | 3300027678 | Forest Soil | LRTQYLLAYYPTPRGPANTYRSIQVTVTPAGYHVRHRKSYLTGPQ |
| Ga0209248_100833512 | 3300027729 | Bog Forest Soil | ELRTQYRLAYYPNPRGPANTYRTIEVKVLPGYTARHRTTYLTGPQ |
| Ga0209038_102453102 | 3300027737 | Bog Forest Soil | LAYYPNPRGPANSYRTIDVKVLPGYTARHRTTYLTGAQ |
| Ga0209689_100982610 | 3300027748 | Soil | QYRLAYYPNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAP |
| Ga0209701_100042401 | 3300027862 | Vadose Zone Soil | PTPRGPANTYRSIQVTVTPADYHVRHRKSYLTGPQ |
| Ga0209701_104258441 | 3300027862 | Vadose Zone Soil | YPNPRGPANSYRSIEVKVIAGDYKVRHRRSYLTGPQ |
| Ga0209579_101133413 | 3300027869 | Surface Soil | YYPTPRGPANTYRKVEVKVLNGDYHVRARKTYLTGPQ |
| Ga0209590_104151281 | 3300027882 | Vadose Zone Soil | LGYYPNPRSPANTYRSIEVKVSGKYQVRHRKSYLTGPQ |
| Ga0209068_104567471 | 3300027894 | Watersheds | PNPRGPASTYRSIQVTVTPADYHVRHRKSYLTGPQ |
| Ga0209062_12363991 | 3300027965 | Surface Soil | QYRLCYYPNPKGPPNTYRTISMSVLGDYKVRHRKTYLTAP |
| Ga0308309_107739331 | 3300028906 | Soil | SELRTQYRLAYYPNPRGPANTYRTIEVKVLPGYTARHRTTYLSGPQ |
| Ga0308309_116363392 | 3300028906 | Soil | YRLAYYPNPRGAANTYRKIEVKMLPGYTARHRTAYLVGAQ |
| Ga0222749_100183215 | 3300029636 | Soil | ELRTQYRLAYYPTPRGPANTYRKVEVRVLNGDYHVRSRKTYLTGAQ |
| Ga0222749_101449643 | 3300029636 | Soil | YRLAYYPNPRGPANTYRSIVVTVSQDNYKVRHRRSYLTGSQ |
| Ga0222749_104955542 | 3300029636 | Soil | ELRTQYRLAYYPNPRGPANSYRKIEVKMLPGYTARHRTAYLVGAQ |
| Ga0311372_104950893 | 3300030520 | Palsa | YPEPRGPANTYRNIEVKVLGTYHVRHRKTYLTGPQ |
| Ga0170818_1131386622 | 3300031474 | Forest Soil | LAYYPTPRGPANTYRKVEVKVLNGDYHVRARKTYLTGAQ |
| Ga0310915_101793403 | 3300031573 | Soil | QYRLAYYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ |
| Ga0318560_101368773 | 3300031682 | Soil | QYRLAYYPNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAPQ |
| Ga0307469_108889511 | 3300031720 | Hardwood Forest Soil | LAYYPNPRGAPNTYRTIEVKVLEGYTARHRTSYLSGAQ |
| Ga0318492_107368551 | 3300031748 | Soil | YPNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAPQ |
| Ga0307475_103429433 | 3300031754 | Hardwood Forest Soil | LSYYPNPRGPANTFRSIVVTVNPSSFHVRHRKSYLTGPQ |
| Ga0318509_105609501 | 3300031768 | Soil | IDNELRTQYRLAYYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ |
| Ga0318543_104163441 | 3300031777 | Soil | RTQYRLAYYPNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAPQ |
| Ga0307473_109789941 | 3300031820 | Hardwood Forest Soil | LRTQYRLAYYPNPRGAANTYRKIEIKMLPGYTARHRTSYLVGPQ |
| Ga0307478_114053382 | 3300031823 | Hardwood Forest Soil | QYLLAYYPTPRGPANTYRSIVVAVDPSTYHVRHRKSYLTGPQ |
| Ga0318495_103184641 | 3300031860 | Soil | TQYRLAYYPNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAPQ |
| Ga0310912_104437551 | 3300031941 | Soil | YYPNPRGPANTYRTIEVKVLPGYSARHRTTYLTGPQ |
| Ga0310909_100559134 | 3300031947 | Soil | YYPEPRGPANTYRTIEVKVLPGYTTRHRTTYLTGPQ |
| Ga0306922_115098202 | 3300032001 | Soil | IDSELRTQYRLAYYPNPRGPANTYRTIEVRVLPGYSARHRTTYLTGPQ |
| Ga0306922_123911811 | 3300032001 | Soil | LAYYPNPRGPASTYRTIEVKVLPGYSARHRTSYLTGPQ |
| Ga0318545_101802612 | 3300032042 | Soil | PNPRGPANTYRSIEVKVTTGNYQVRHRKTYLTAPQ |
| Ga0311301_100983286 | 3300032160 | Peatlands Soil | QYRLAYYPNPRGPANTYRTIDVKVLPGYSARHRTTYLTGPQ |
| Ga0307471_1002302063 | 3300032180 | Hardwood Forest Soil | DAELRTQYRLAYYPNPRGPANTYRKIEVKMLPGYAARHRTAYLVGAQ |
| Ga0307471_1035447672 | 3300032180 | Hardwood Forest Soil | YPNPRGPANTYRSIVVKVTPSTYKVRHRKSYLTGPQ |
| Ga0335079_101542374 | 3300032783 | Soil | QYRLGYYPNPRGPANTYRKIEVKVLNGDYHVRYRKTYLTGPQ |
| Ga0335078_100628741 | 3300032805 | Soil | NNELRTQYRLAYYPNPRGPANSYRTIEVKVLPGYTARHRTTYFTGPQ |
| ⦗Top⦘ |