| Basic Information | |
|---|---|
| Family ID | F033898 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 45 residues |
| Representative Sequence | KPEQYRIKVVEEAPTSVVSVQDPNGAPDKTQNSEKILALLKDQLK |
| Number of Associated Samples | 151 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.14 % |
| % of genes near scaffold ends (potentially truncated) | 98.30 % |
| % of genes from short scaffolds (< 2000 bps) | 92.05 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (10.227 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.932 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.636 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.18% β-sheet: 2.74% Coil/Unstructured: 78.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF12706 | Lactamase_B_2 | 44.32 |
| PF00753 | Lactamase_B | 39.20 |
| PF01259 | SAICAR_synt | 10.80 |
| PF08007 | JmjC_2 | 1.70 |
| PF13432 | TPR_16 | 0.57 |
| PF00583 | Acetyltransf_1 | 0.57 |
| PF00701 | DHDPS | 0.57 |
| PF01740 | STAS | 0.57 |
| PF02754 | CCG | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 10.80 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 1.70 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.57 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090009|LWAnN_F624WLL02G234G | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 2088090009|LWAnN_GIDYKCY01AQA8H | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
| 2170459017|G1E9HNB15JKYWU | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300003861|Ga0031654_10044695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
| 3300004067|Ga0055485_10119080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300004155|Ga0066600_10116117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1067 | Open in IMG/M |
| 3300004157|Ga0062590_100419313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300005187|Ga0066675_10609722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 820 | Open in IMG/M |
| 3300005327|Ga0070658_10756765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 844 | Open in IMG/M |
| 3300005328|Ga0070676_10145258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1514 | Open in IMG/M |
| 3300005328|Ga0070676_10395624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 960 | Open in IMG/M |
| 3300005334|Ga0068869_101779178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 551 | Open in IMG/M |
| 3300005337|Ga0070682_102017373 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005338|Ga0068868_100591149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 982 | Open in IMG/M |
| 3300005338|Ga0068868_101090795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 734 | Open in IMG/M |
| 3300005340|Ga0070689_101228623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300005356|Ga0070674_101675878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
| 3300005440|Ga0070705_101633725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300005458|Ga0070681_10502508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1126 | Open in IMG/M |
| 3300005458|Ga0070681_10733864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 904 | Open in IMG/M |
| 3300005530|Ga0070679_100695216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans | 960 | Open in IMG/M |
| 3300005543|Ga0070672_101290427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 652 | Open in IMG/M |
| 3300005546|Ga0070696_101655277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 551 | Open in IMG/M |
| 3300005548|Ga0070665_100070289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3508 | Open in IMG/M |
| 3300005553|Ga0066695_10387142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 870 | Open in IMG/M |
| 3300005563|Ga0068855_101951025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300005577|Ga0068857_101604664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 635 | Open in IMG/M |
| 3300005764|Ga0066903_102797317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 947 | Open in IMG/M |
| 3300005841|Ga0068863_100096954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2799 | Open in IMG/M |
| 3300005843|Ga0068860_100666714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1048 | Open in IMG/M |
| 3300005843|Ga0068860_100717824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1010 | Open in IMG/M |
| 3300005844|Ga0068862_101680857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300006047|Ga0075024_100085155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1367 | Open in IMG/M |
| 3300006175|Ga0070712_100954472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 741 | Open in IMG/M |
| 3300006354|Ga0075021_11099088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
| 3300006358|Ga0068871_102199831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
| 3300006578|Ga0074059_11832641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 905 | Open in IMG/M |
| 3300006881|Ga0068865_100636425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
| 3300006881|Ga0068865_101907260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300009094|Ga0111539_12780428 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009095|Ga0079224_104558580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300009100|Ga0075418_10579115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1207 | Open in IMG/M |
| 3300009111|Ga0115026_11593148 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009131|Ga0115027_11290535 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300009162|Ga0075423_10401811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1438 | Open in IMG/M |
| 3300009179|Ga0115028_11693766 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010051|Ga0133939_1077241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5833 | Open in IMG/M |
| 3300010373|Ga0134128_13084435 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010396|Ga0134126_11167794 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010397|Ga0134124_10611891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300010400|Ga0134122_10547235 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300012044|Ga0136636_10223448 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012203|Ga0137399_11594177 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012499|Ga0157350_1051651 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012519|Ga0157352_1063952 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012533|Ga0138256_10193616 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300012684|Ga0136614_10037748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3628 | Open in IMG/M |
| 3300012684|Ga0136614_11191400 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012903|Ga0157289_10412477 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012912|Ga0157306_10420315 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012944|Ga0137410_11087637 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300012957|Ga0164303_10703658 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012971|Ga0126369_12391950 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012984|Ga0164309_10839433 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012985|Ga0164308_10662037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
| 3300012986|Ga0164304_10694024 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300013297|Ga0157378_11549836 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300013306|Ga0163162_11073066 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300013308|Ga0157375_10362873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1615 | Open in IMG/M |
| 3300013308|Ga0157375_13426253 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300014260|Ga0075307_1150568 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300014306|Ga0075346_1067807 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300014497|Ga0182008_10926045 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300014968|Ga0157379_12593383 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300015203|Ga0167650_1002713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 5318 | Open in IMG/M |
| 3300015373|Ga0132257_100291530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1959 | Open in IMG/M |
| 3300015374|Ga0132255_103738333 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300019362|Ga0173479_10402167 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300020082|Ga0206353_11754632 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300022756|Ga0222622_11010236 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300022886|Ga0247746_1211056 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025321|Ga0207656_10030072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2241 | Open in IMG/M |
| 3300025321|Ga0207656_10475481 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300025912|Ga0207707_10342379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
| 3300025913|Ga0207695_10687753 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300025915|Ga0207693_11220232 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300025921|Ga0207652_11440850 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300025924|Ga0207694_11565597 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300025933|Ga0207706_10725666 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300025934|Ga0207686_10282439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
| 3300025936|Ga0207670_11655865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300025937|Ga0207669_10043330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2635 | Open in IMG/M |
| 3300025939|Ga0207665_10270311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
| 3300025942|Ga0207689_11626179 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300025942|Ga0207689_11718139 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300025951|Ga0210066_1051538 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300025960|Ga0207651_10486461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300025960|Ga0207651_11417816 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300025972|Ga0207668_10122221 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300025981|Ga0207640_11501491 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300025986|Ga0207658_10410837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
| 3300025986|Ga0207658_10881684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300025986|Ga0207658_11229696 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300026035|Ga0207703_10082928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2677 | Open in IMG/M |
| 3300026070|Ga0208423_1031605 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300026088|Ga0207641_10728668 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300026089|Ga0207648_10912806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300026089|Ga0207648_11858891 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026281|Ga0209863_10245935 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300026550|Ga0209474_10398145 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300028381|Ga0268264_10586741 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300028652|Ga0302166_10160379 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300028743|Ga0302262_10297110 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300028865|Ga0302291_10321488 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300028868|Ga0302163_10069310 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300028869|Ga0302263_10301363 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300029984|Ga0311332_10030354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3699 | Open in IMG/M |
| 3300029984|Ga0311332_10451027 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300029989|Ga0311365_10036385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4211 | Open in IMG/M |
| 3300029989|Ga0311365_10641970 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300029989|Ga0311365_10645628 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300029990|Ga0311336_10157142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1835 | Open in IMG/M |
| 3300030000|Ga0311337_10546617 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300030000|Ga0311337_11250660 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300030047|Ga0302286_10691445 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300030048|Ga0302273_1106803 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300031232|Ga0302323_101142209 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300031546|Ga0318538_10575871 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300031562|Ga0310886_10829833 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031716|Ga0310813_10723192 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300031722|Ga0311351_10273986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1276 | Open in IMG/M |
| 3300031731|Ga0307405_11209629 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031771|Ga0318546_10010040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4990 | Open in IMG/M |
| 3300031784|Ga0315899_11380624 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031784|Ga0315899_11714132 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031793|Ga0318548_10254670 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300031819|Ga0318568_10783661 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031834|Ga0315290_10560025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300031858|Ga0310892_11169240 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031873|Ga0315297_10647426 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031879|Ga0306919_10237249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1368 | Open in IMG/M |
| 3300031902|Ga0302322_103119884 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031918|Ga0311367_10239208 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300031938|Ga0308175_100242783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1802 | Open in IMG/M |
| 3300031943|Ga0310885_10020926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2437 | Open in IMG/M |
| 3300031997|Ga0315278_11098350 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031997|Ga0315278_11883519 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300032000|Ga0310903_10765409 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032008|Ga0318562_10242970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300032053|Ga0315284_10543430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1400 | Open in IMG/M |
| 3300032075|Ga0310890_10092157 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300032143|Ga0315292_10305709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300032177|Ga0315276_12350671 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300032205|Ga0307472_102100080 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300032256|Ga0315271_11400731 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032256|Ga0315271_11559308 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300032261|Ga0306920_101992530 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300032397|Ga0315287_11950290 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300032516|Ga0315273_10124756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3528 | Open in IMG/M |
| 3300032516|Ga0315273_12371371 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300033408|Ga0316605_10212100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1637 | Open in IMG/M |
| 3300033414|Ga0316619_10904172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 762 | Open in IMG/M |
| 3300033414|Ga0316619_12058698 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300033419|Ga0316601_101517368 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300033419|Ga0316601_102280262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 545 | Open in IMG/M |
| 3300033475|Ga0310811_11156067 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300033480|Ga0316620_10300966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1404 | Open in IMG/M |
| 3300033482|Ga0316627_100077232 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300033557|Ga0316617_102234092 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300034115|Ga0364945_0226522 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300034127|Ga0370489_0222585 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300034149|Ga0364929_0095878 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300034176|Ga0364931_0181485 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300034354|Ga0364943_0260713 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300034354|Ga0364943_0408531 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300034358|Ga0370485_0124632 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 10.23% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.27% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.70% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.70% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 1.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.14% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.14% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.14% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.14% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.57% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.57% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.57% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.57% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.57% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
| 2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012044 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ852 (21.06) | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026070 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWAnN_05560300 | 2088090009 | Freshwater Sediment | AESQPPAIVTVQDSTGAPDKSANGEKILALLKEQLK |
| LWAnN_02536770 | 2088090009 | Freshwater Sediment | VEKVEQYRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK |
| 4ZMR_04883350 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | AEADPRSLVTVQDAAGAPDKSPASEKILTLLKDQLK |
| Ga0031654_100446951 | 3300003861 | Freshwater Lake Sediment | PEQYRITVAAADPRSLVTVQDPNGAPLKSANGEKILSLLKDQLK* |
| Ga0055485_101190802 | 3300004067 | Natural And Restored Wetlands | GILDKLQFWKTDVEKVEQYRITVAEANPRSLVTVQDPSGAPDKSATGEKILSLLRDQLK* |
| Ga0066600_101161171 | 3300004155 | Freshwater | TTEKPEQYRIKVVDTPPTSIVTVQDPKGEPDRSPSAEKILGLLRDQLK* |
| Ga0062590_1004193132 | 3300004157 | Soil | EKPEQYRIVVAEADPRSLVTVQDAAGAPDKSPASEKILTLLKDQLK* |
| Ga0066675_106097221 | 3300005187 | Soil | SKDEKPEQYRITIAQSDPRSVVTVQDPGGAPDKSVTGEKILTLLKDQLK* |
| Ga0070658_107567651 | 3300005327 | Corn Rhizosphere | KDKPEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK* |
| Ga0070676_101452581 | 3300005328 | Miscanthus Rhizosphere | DEKDKPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK* |
| Ga0070676_103956242 | 3300005328 | Miscanthus Rhizosphere | IKISEVAPQSVVSVQDATGAPEVSKNSEKILALLKEQLK* |
| Ga0068869_1017791782 | 3300005334 | Miscanthus Rhizosphere | KPEQYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK* |
| Ga0070682_1020173732 | 3300005337 | Corn Rhizosphere | RIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK* |
| Ga0068868_1005911492 | 3300005338 | Miscanthus Rhizosphere | GEKPEQYRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK* |
| Ga0068868_1010907951 | 3300005338 | Miscanthus Rhizosphere | TDEKDKPEQYRIKVAEFAPASVVSVQDPNGSPDKTQNSEKILALLKDQLK* |
| Ga0070689_1012286231 | 3300005340 | Switchgrass Rhizosphere | PNIEQYRITVAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK* |
| Ga0070674_1016758782 | 3300005356 | Miscanthus Rhizosphere | EKPEQYRIAVVESSPRSLVTVQDPKGVPDKTPASDRILALLKDQLK* |
| Ga0070705_1016337251 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TDVEKPEQYRITVAQADPNSLVTVEDPNGAPDKSANSEKILALLKDQLK* |
| Ga0070681_105025083 | 3300005458 | Corn Rhizosphere | EQYRIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK* |
| Ga0070681_107338641 | 3300005458 | Corn Rhizosphere | PEQYRIKIIETSPQSTVSVQDPTGNPDKSPASDRILALLRDQLK* |
| Ga0070679_1006952161 | 3300005530 | Corn Rhizosphere | KDKPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK* |
| Ga0070672_1012904272 | 3300005543 | Miscanthus Rhizosphere | QYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK* |
| Ga0070696_1016552772 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DEKDKPEQFQIVIAGAAQNSVVSVQDPGGVPDRTATSEKILALLKDQLK* |
| Ga0070665_1000702891 | 3300005548 | Switchgrass Rhizosphere | WKTDDKGKPEQYQIMVAEATPISVVSVQDPGGVPDKSATSEKILTMLKDQLK* |
| Ga0066695_103871421 | 3300005553 | Soil | PEQYRITIAQSDPRSVVTVQDPGGAPDKSVTGEKILTLLKDQLK* |
| Ga0068855_1019510252 | 3300005563 | Corn Rhizosphere | IKIVETAPQSTVSVQDPAGNPDKSQASERILALLREQLK* |
| Ga0068857_1016046642 | 3300005577 | Corn Rhizosphere | PEQYRIKVAQETTPQSTVSVQDPSGNPDKTQASERILALLRDQLK* |
| Ga0066903_1027973172 | 3300005764 | Tropical Forest Soil | KPEQYKISVAQSDPRSIVTVQDPNGKPDKTPTGEKILSLLKDQLK* |
| Ga0068863_1000969546 | 3300005841 | Switchgrass Rhizosphere | PEQYQIVVAESAQTSVVSVQDPGGAPDRTPTSEKILALLKDQLK* |
| Ga0068860_1006667143 | 3300005843 | Switchgrass Rhizosphere | AEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK* |
| Ga0068860_1007178242 | 3300005843 | Switchgrass Rhizosphere | YRIKVVEVAPTSVVSVQDPNGTPDRTQNSDKILALLKDQLK* |
| Ga0068862_1016808571 | 3300005844 | Switchgrass Rhizosphere | KPEQYRITVAQADPNSLVTVQDPEGAPDKSANGEKILALLKDQLK* |
| Ga0075024_1000851551 | 3300006047 | Watersheds | VAEASPISVVSVQDPGGIPDKSATSEKILTMLKDQLK* |
| Ga0070712_1009544722 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KDKPEQYRIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK* |
| Ga0075021_110990882 | 3300006354 | Watersheds | DKDKPEQYQIVVAETQQVSVVSVQDPGGIPDRTSASEKILSLLRDQLK* |
| Ga0068871_1021998312 | 3300006358 | Miscanthus Rhizosphere | TDEKDKPEQYQIVVAESAQNSVVSVQDPGGIPDRTATSEKILALLKDQLK* |
| Ga0074059_118326411 | 3300006578 | Soil | VVAETAQTSVVSVQDPGGGPDKTPASEKILSLLKDQLK* |
| Ga0068865_1006364251 | 3300006881 | Miscanthus Rhizosphere | DKLMFWKSDAPNIEQYRITVAEANPRSLVTVQDPNGSPDKSATGEKILSLLRDQLK* |
| Ga0068865_1019072602 | 3300006881 | Miscanthus Rhizosphere | DKLMFWKTDTEKVEQYRIYIAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK* |
| Ga0111539_127804281 | 3300009094 | Populus Rhizosphere | VAEASPRSLVTVQDPNGSPDKSATGEKILSLLRDQLK* |
| Ga0079224_1045585801 | 3300009095 | Agricultural Soil | KDEVEKPEQYRIAVVEAAPTSLVTVQDPSGAPDKSPTSDRILALLKDQLK* |
| Ga0075418_105791151 | 3300009100 | Populus Rhizosphere | KPEQYRIKVVEEAPTSVVSVQDPNGAPDKTQNSEKILALLKDQLK* |
| Ga0115026_115931481 | 3300009111 | Wetland | TGERPEQYRILVAESAPPALVTVQDSNGAPDKTANGEKILSLLKDQLK* |
| Ga0115027_112905351 | 3300009131 | Wetland | KDKTGDKPEQYRIFVAESPPPSIVTVHDPNGATDKSPNSEKILSLLRDQLK* |
| Ga0075423_104018111 | 3300009162 | Populus Rhizosphere | EKDKPEQFQIVIAEAAQSSVVSVQDPGGVPDRTSTSEKILALLKDQLK* |
| Ga0115028_116937661 | 3300009179 | Wetland | YRILVAESAPPALVTVQDSNGAPDKTANGEKILSLLKDQLK* |
| Ga0133939_10772411 | 3300010051 | Industrial Wastewater | EAARTSLVSVQDPKGAPDKSPTSDRILALLKEQLK* |
| Ga0134128_130844352 | 3300010373 | Terrestrial Soil | QYRIKIIETSPQSTVSVQDPTGNPDKSPASDRILALLRDQLK* |
| Ga0134126_111677942 | 3300010396 | Terrestrial Soil | IKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK* |
| Ga0134124_106118911 | 3300010397 | Terrestrial Soil | PEQYRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK* |
| Ga0134122_105472351 | 3300010400 | Terrestrial Soil | MFWKTDVEKPEQYRITVAQADPNSLVTVEDPNGAPDKSANSEKILALLKDQLK* |
| Ga0136636_102234482 | 3300012044 | Polar Desert Sand | AESAQASVVSVQDPGGAPDRTANSEKILGLLKEQLK* |
| Ga0137399_115941771 | 3300012203 | Vadose Zone Soil | RITVAQADPNSLVTVQDPDGAPDKSANGEKILALLKDQLK* |
| Ga0157350_10516513 | 3300012499 | Unplanted Soil | FWKDKGEKPEQYKITVAQSDPRSIVTVQDPSGAPDKTATGEKILTLLKDQLK* |
| Ga0157352_10639521 | 3300012519 | Unplanted Soil | TKLMFWKDKGEKPEQYKITVAQSDPRSIVTVQDPSGAPDKTATGEKILTLLKDQLK* |
| Ga0138256_101936164 | 3300012533 | Active Sludge | SEKPEQYRIAVVEAPPSSVVTVQDTKGAPDKSPASDRILALLKDQLK* |
| Ga0136614_100377486 | 3300012684 | Polar Desert Sand | VAETAQTSVVSVQNPSGAPDRTPASERILSLLKDQLK* |
| Ga0136614_111914002 | 3300012684 | Polar Desert Sand | YQIVVAETAQTSVVSVQNPSGAPDRTPASERILSLLKDQLK* |
| Ga0157289_104124771 | 3300012903 | Soil | QYRIYIAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK* |
| Ga0157306_104203151 | 3300012912 | Soil | ASPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK* |
| Ga0137410_110876371 | 3300012944 | Vadose Zone Soil | KDEKDKPEQYRIKIVETAPQSTVSVQDPAGNPDRSPASERILALLRDQLK* |
| Ga0164303_107036582 | 3300012957 | Soil | WKTDEKDKPEQYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK* |
| Ga0126369_123919502 | 3300012971 | Tropical Forest Soil | EQYKITVAQSDPRSIVTVQDPNGAPDKTATGEKILTLLKDQLK* |
| Ga0164309_108394331 | 3300012984 | Soil | QYQIMVAEATPISVVSVQDPGGVPDKSATSEKILTMLKDQLK* |
| Ga0164308_106620372 | 3300012985 | Soil | LMFWKTGDTEKVEQYRINIAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK* |
| Ga0164304_106940241 | 3300012986 | Soil | RIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK* |
| Ga0157378_115498362 | 3300013297 | Miscanthus Rhizosphere | PAPQSTCSVHYPSVNPYKSQASERILALLREQLK* |
| Ga0163162_110730662 | 3300013306 | Switchgrass Rhizosphere | NIEQYRITVAEASPRSLVTVQDPNGTPDKSAAGEKILSLLRDQLK* |
| Ga0157375_103628731 | 3300013308 | Miscanthus Rhizosphere | EQYRITVAQADPNSLVTVQDPEGAPDKSANGEKILALLKDQLK* |
| Ga0157375_134262531 | 3300013308 | Miscanthus Rhizosphere | YRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK* |
| Ga0075307_11505681 | 3300014260 | Natural And Restored Wetlands | AAQNSVVVVQDPGGVPDRSPTSEKILALLKEQLK* |
| Ga0075346_10678072 | 3300014306 | Natural And Restored Wetlands | FWKTDVEKVEQYRITVAESNPRSLVTVQDPSGAPDKSATGEKILSLLRDQLK* |
| Ga0182008_109260452 | 3300014497 | Rhizosphere | KVAEASPQSAVTVEDTTGKPDRSPASERILALLRDQLK* |
| Ga0157379_125933831 | 3300014968 | Switchgrass Rhizosphere | KLMFWKPDAPNVEQYRITVAEASPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK* |
| Ga0167650_10027131 | 3300015203 | Glacier Forefield Soil | DVEKVEQYRIAIADAVPRSFVSVQDPNGAPDKSAASEKILSLLRDQLK* |
| Ga0132257_1002915302 | 3300015373 | Arabidopsis Rhizosphere | MFWKSKDEKPEQYRITIAQSDPRSVVTVQDPGGAPDKSATGEKILTLLKDQLK* |
| Ga0132255_1037383331 | 3300015374 | Arabidopsis Rhizosphere | LAKLMFWKDTTEKPEQYRILVAESAPPALVTVQDVNGAPDKTPNSEKILALLKDQLK* |
| Ga0173479_104021671 | 3300019362 | Soil | EGEKPEQYRIAVVESSPRSLVTVQDPKGTPDKTPASDRILALLKDQLK |
| Ga0206353_117546321 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | QYRIKVAQETAPQSTVSVQDPSGNPDKTQASERILALLRDQLK |
| Ga0222622_110102361 | 3300022756 | Groundwater Sediment | KPEQYQIVVAETAQASVISVQDPGGTPDRTATSEKILSMLKDQLK |
| Ga0247746_12110561 | 3300022886 | Soil | KPEQYRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK |
| Ga0207656_100300721 | 3300025321 | Corn Rhizosphere | YRIKVVEVAPNSVVSVQDNTGQPEKSQNGEKILALLKDQLK |
| Ga0207656_104754811 | 3300025321 | Corn Rhizosphere | KPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK |
| Ga0207707_103423793 | 3300025912 | Corn Rhizosphere | IKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK |
| Ga0207695_106877532 | 3300025913 | Corn Rhizosphere | SKITNLFRKDDEKDKPEQYRIKVAETSPQSAVTVQDTTGKPDHSPASERILTLLRDQLK |
| Ga0207693_112202322 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KPEQYRIKVVETAPQSTVSVQDPKGEPDRSQASDRILALLRDQLK |
| Ga0207652_114408502 | 3300025921 | Corn Rhizosphere | VEVAPNSVVSVQDTTGQPEKTQTGEKILALLKDQLK |
| Ga0207694_115655972 | 3300025924 | Corn Rhizosphere | QYRIKVAEVAPNSVVSVQDTTGAPEKSQNSEKILALLKEQLK |
| Ga0207706_107256661 | 3300025933 | Corn Rhizosphere | QIVIAEAAQSSVVSVQDPGGVPDRTSTSEKILALLKDQLK |
| Ga0207686_102824391 | 3300025934 | Miscanthus Rhizosphere | EQYRINVAEAVPRSLISVQDPNGAPDKSATSEKILSLLRDQLK |
| Ga0207670_116558652 | 3300025936 | Switchgrass Rhizosphere | LLDKLMFWKSDTPNIEQYRITVAEANPRSLVTVQDPNGTPDKSATGEKILSLLRDQLK |
| Ga0207669_100433305 | 3300025937 | Miscanthus Rhizosphere | EATPISVVSVQDPGGVPDKSATSEKILTMLKDQLK |
| Ga0207665_102703113 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DKPEQYRIKVAEAAPQSVVSVQDAAGAPEVSKNGEKILALLKEQLK |
| Ga0207689_116261792 | 3300025942 | Miscanthus Rhizosphere | TVAEATPRSLVTVQDPNGAPDKSATSEKILSLLRDQLK |
| Ga0207689_117181391 | 3300025942 | Miscanthus Rhizosphere | EKDKPEQYRIKVVETAPQSTVSVQDPNGAPDRTQASDKILALLRDQLK |
| Ga0210066_10515381 | 3300025951 | Natural And Restored Wetlands | GILDKLQFWKTDVEKVEQYRITVAEANPRSLVTVQDPSGAPDKSATGEKILSLLRDQLK |
| Ga0207651_104864611 | 3300025960 | Switchgrass Rhizosphere | PEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK |
| Ga0207651_114178161 | 3300025960 | Switchgrass Rhizosphere | KPEQYRIKVVEATPTSVVSVQDPKGEPDRTQNSEKILALLKDQLK |
| Ga0207668_101222211 | 3300025972 | Switchgrass Rhizosphere | EQYQIVVAESAQNSIVSVQDPGGIPDRTATSEKILALLKDQLK |
| Ga0207640_115014912 | 3300025981 | Corn Rhizosphere | RIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK |
| Ga0207658_104108371 | 3300025986 | Switchgrass Rhizosphere | WKTDEKDKPEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK |
| Ga0207658_108816842 | 3300025986 | Switchgrass Rhizosphere | DKLAFWKSDAPNIEQYRITVAEASPRSLVTVQDPNGTPDKSAAGEKILSLLRDQLK |
| Ga0207658_112296962 | 3300025986 | Switchgrass Rhizosphere | IKIVETAPQSTVSVQDPAGNPDKSQASERILALLREQLK |
| Ga0207703_100829284 | 3300026035 | Switchgrass Rhizosphere | ETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK |
| Ga0208423_10316052 | 3300026070 | Natural And Restored Wetlands | EQYRIIVADKSTKSFVSVEDPNGAPDKSQNGEKILSLLQGQLK |
| Ga0207641_107286681 | 3300026088 | Switchgrass Rhizosphere | YRIAVVESSPRSLVTVQDPKGAPDKTPASDRILALLKDQLK |
| Ga0207648_109128061 | 3300026089 | Miscanthus Rhizosphere | PEQYQIVVAESAQNSVVSVQDPGGVPDRTATSEKILALLKDQLK |
| Ga0207648_118588912 | 3300026089 | Miscanthus Rhizosphere | VAEATPRSLVTVQDPNGAPDKSATSEKILSLLRDQLK |
| Ga0209863_102459351 | 3300026281 | Prmafrost Soil | NKPEQYQILVAEASPISVVSVQDPGGIPDKSATSEKILTLLKDQLK |
| Ga0209474_103981451 | 3300026550 | Soil | EKDKPEQYRIKVVEIAPASIVSVQDPQGQPDRTQNSEKILALLKDQLK |
| Ga0268264_105867411 | 3300028381 | Switchgrass Rhizosphere | YRIKVVEVAPTSVVSVQDPNGTPDRTQNSDKILALLKDQLK |
| Ga0302166_101603791 | 3300028652 | Fen | MVAEATPISVVSVQDPGGIPDKTATGEKILTMLKDQLK |
| Ga0302262_102971102 | 3300028743 | Fen | WKTDEKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK |
| Ga0302291_103214881 | 3300028865 | Fen | YQIMVAEATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK |
| Ga0302163_100693101 | 3300028868 | Fen | MVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK |
| Ga0302263_103013632 | 3300028869 | Fen | YQIMVAEATPISVVSVQDPGGIPDKSANGEKILTMLKDQLK |
| Ga0311332_100303541 | 3300029984 | Fen | KGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK |
| Ga0311332_104510272 | 3300029984 | Fen | IMVAEATPISVVSVQDPGGIPDKSANGEKILTMLKDQLK |
| Ga0311365_100363857 | 3300029989 | Fen | WKTDDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKTATGEKILTMLKDQLK |
| Ga0311365_106419702 | 3300029989 | Fen | DDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKTATGEKILTMLKDQLK |
| Ga0311365_106456282 | 3300029989 | Fen | PEQYQIMVAEATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK |
| Ga0311336_101571421 | 3300029990 | Fen | DDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKTANGEKILTMLKDQLK |
| Ga0311337_105466171 | 3300030000 | Fen | TNDKDKPEQYQIVVAETQQTSVVSVQDPGGIPDRTSASEKILSLLRDQLK |
| Ga0311337_112506602 | 3300030000 | Fen | EATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK |
| Ga0302286_106914451 | 3300030047 | Fen | VAEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK |
| Ga0302273_11068032 | 3300030048 | Bog | DKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGQKILTMLKDQLK |
| Ga0302323_1011422091 | 3300031232 | Fen | LVAEASPISVVSVQDPGGITDKTATSEKILTMLKDQLK |
| Ga0318538_105758712 | 3300031546 | Soil | EQYRITVAEANPNSLVTVQDPDGAPDKSVNGEKILALLKDQLK |
| Ga0310886_108298331 | 3300031562 | Soil | KVVEEAPASIVSVQDPNGAPDKTQTGEKILALLKDQLK |
| Ga0310813_107231921 | 3300031716 | Soil | IETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK |
| Ga0311351_102739861 | 3300031722 | Fen | YQILVAEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK |
| Ga0307405_112096291 | 3300031731 | Rhizosphere | IVVAESAQNSVVSVQDPGGIPDRTATSEKILALLKDQLK |
| Ga0318546_100100401 | 3300031771 | Soil | LMFWKKDDKEKVENYRIKIAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK |
| Ga0315899_113806242 | 3300031784 | Freshwater | YRIAVAQADPRSVVTVEAPNGAPDKSPTGEKILGLLKDQLK |
| Ga0315899_117141321 | 3300031784 | Freshwater | ADATPRSLVTVQDTNGAPDKSATGEKILSLLRDQLK |
| Ga0318548_102546702 | 3300031793 | Soil | KDDKEKVENYRIKIAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK |
| Ga0318568_107836611 | 3300031819 | Soil | IAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK |
| Ga0315290_105600251 | 3300031834 | Sediment | PEQYQIVIAEAAQTSVVSVQDPGGTPDRTATSEKILTMLKDQLK |
| Ga0310892_111692401 | 3300031858 | Soil | DEKDKPEQYRIKIVETSPQSTVSVQDPSGNPDRTQASDRILALLRDQLK |
| Ga0315297_106474262 | 3300031873 | Sediment | KTDVEKVEQYRITVADATPRSLVTVQDPSGAPDKSAIGEKILSLLRDQLK |
| Ga0306919_102372493 | 3300031879 | Soil | KLMFWKKDDKEKVENYRIKIAEAQQQSVVSVQDTNGSPDKSQTSERILALLKDQLK |
| Ga0302322_1031198842 | 3300031902 | Fen | DDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATGEKILTMLKDQLK |
| Ga0311367_102392083 | 3300031918 | Fen | KDKPEQYQILVAEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK |
| Ga0308175_1002427831 | 3300031938 | Soil | IKVAEASPQSTVVVEDTTGKPDRSPASERILALLRDQLK |
| Ga0310885_100209265 | 3300031943 | Soil | ADKPEQYRIAVVEAAPSSLVTVQDPKGAPDKTPASDRILALLKDQLK |
| Ga0315278_110983502 | 3300031997 | Sediment | AETPPPSVVVVQDPNGVTDTTANGEKILALLKDQLK |
| Ga0315278_118835191 | 3300031997 | Sediment | AEAAPISVVSVQDPGGITDKSATSEKILTMLKDQLK |
| Ga0310903_107654091 | 3300032000 | Soil | EEADKPEQYRIAVVEAAPSSLVTVQDPKGAPDKTPASDRILALLKDQLK |
| Ga0318562_102429703 | 3300032008 | Soil | TTTEKVEQYRITITEVDPKSVVTVQDPNGAPDKSQNGEKILALLKDQLQ |
| Ga0315284_105434301 | 3300032053 | Sediment | KGFLDKLQFWKTDAEKVEQYRITVADATPRSLVTVQDPSGAPDKSAIGEKILSLLRDQLK |
| Ga0310890_100921574 | 3300032075 | Soil | EQYRIAVVEAAPSSLVTVQDPKGAPDKTPASDRILALLKDQLK |
| Ga0315292_103057091 | 3300032143 | Sediment | KPEQFQIVVAEAAPNSVVSVQDPGGTPDRTATSEKILALLKDQLK |
| Ga0315276_123506711 | 3300032177 | Sediment | TVADATPRSLVTVQDPNGAPDKSAIGEKILSLLRDQLK |
| Ga0307472_1021000801 | 3300032205 | Hardwood Forest Soil | TPEQYQITVAQADPNSLVTVQDPNGAPDKSANGEKILALLKDQLK |
| Ga0315271_114007312 | 3300032256 | Sediment | KLQFWKTDVEKVEQYRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK |
| Ga0315271_115593082 | 3300032256 | Sediment | EQYQILVAEAAPISVVSVQDPGGVTDKSATSERILTMLKDQLK |
| Ga0306920_1019925301 | 3300032261 | Soil | QYKITVAQSDPRSIVTVQDPNGAPDKTATGEKILTLLKDQLK |
| Ga0315287_119502901 | 3300032397 | Sediment | DKLQFWKTDVEKVEQYRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK |
| Ga0315273_101247565 | 3300032516 | Sediment | YRIFMAETPPPSVVVVQDPNGVTDTTANGEKILALLKDQLK |
| Ga0315273_123713712 | 3300032516 | Sediment | YRITVADATPRSLVTVQDPNGAPDKSATGEKILSLLRDQLK |
| Ga0316605_102121001 | 3300033408 | Soil | RILVAESAPPALVTVQDNNGAPDKTPNGEKILSLLKDQLK |
| Ga0316619_109041722 | 3300033414 | Soil | KDTTEKPEQYRILVAQADPRSVVSVQDPNGAPDKSANGGKILGLLKDQLK |
| Ga0316619_120586982 | 3300033414 | Soil | TEKVEQYRISIAESAPPTVVVVQDVNGAPDRTPNADRILALLKDQLK |
| Ga0316601_1015173682 | 3300033419 | Soil | TEKPEQYRIKVEESPPASLVTVQDPKGVPDKAPSAERILGLLRDQLK |
| Ga0316601_1022802621 | 3300033419 | Soil | MFWKDTGERPEQYRILVAESAPPALVTVQDTNGAPDKTPNGEKILSLLKDQLK |
| Ga0310811_111560671 | 3300033475 | Soil | KTDEKDKPEQYRIKVIETAPQSTVSVQDPNGAPDRTQASEKILALLRDQLK |
| Ga0316620_103009661 | 3300033480 | Soil | ISIVETASRSVVSVLDPDGKPDRTQASEKILGLLQEQLK |
| Ga0316627_1000772324 | 3300033482 | Soil | YQIVVAEAAPNSVVSVQDPGGTPDRTATSEKILALLKDQLK |
| Ga0316617_1022340921 | 3300033557 | Soil | KDKTGDKPEQYRIFIAESPPPSIVTVQDPNGAPDKSPNSEKILALLKDQLK |
| Ga0364945_0226522_9_125 | 3300034115 | Sediment | MVAEATPISVVSVQDPGGIPDKSATSEKILTMLKDQLK |
| Ga0370489_0222585_437_562 | 3300034127 | Untreated Peat Soil | YQIVVAEVAQTSVVSVQDPGGVPDRSTNGEKILGLLKDQLK |
| Ga0364929_0095878_1_165 | 3300034149 | Sediment | QFWKTDDKGKPEQYQIMVAEATPISVVSVQDPGGIPDKSATSEKILTMLKDQLK |
| Ga0364931_0181485_2_151 | 3300034176 | Sediment | DTAEKPEQYRILVAESAPPALVTVQDANGAPDKTPNSEKILALLKDQLK |
| Ga0364943_0260713_499_648 | 3300034354 | Sediment | ETTEKPEQYQITVAQADPRSLVTVQDPSGAPDKTANGEKILSLLKDQLK |
| Ga0364943_0408531_2_145 | 3300034354 | Sediment | TEKIEQYQITVAQADPRSLVTVQDPTGAPDKTANGEKILSLLKDQLK |
| Ga0370485_0124632_612_758 | 3300034358 | Untreated Peat Soil | EKDKPDQYQIVVAEVAQTSVVSVQDPGGAPDRSTNSEKILGLLKDQLK |
| ⦗Top⦘ |