| Basic Information | |
|---|---|
| Family ID | F033888 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTDFLRKTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.98 % |
| % of genes near scaffold ends (potentially truncated) | 20.45 % |
| % of genes from short scaffolds (< 2000 bps) | 62.50 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.273 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.818 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (76.705 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF08031 | BBE | 30.11 |
| PF13502 | AsmA_2 | 6.82 |
| PF13489 | Methyltransf_23 | 3.41 |
| PF02585 | PIG-L | 3.41 |
| PF07638 | Sigma70_ECF | 1.70 |
| PF13378 | MR_MLE_C | 1.70 |
| PF13349 | DUF4097 | 1.14 |
| PF04226 | Transgly_assoc | 1.14 |
| PF09900 | DUF2127 | 1.14 |
| PF04519 | Bactofilin | 1.14 |
| PF13365 | Trypsin_2 | 1.14 |
| PF00005 | ABC_tran | 0.57 |
| PF12371 | TMEM131_like_N | 0.57 |
| PF02517 | Rce1-like | 0.57 |
| PF09286 | Pro-kuma_activ | 0.57 |
| PF00082 | Peptidase_S8 | 0.57 |
| PF00069 | Pkinase | 0.57 |
| PF08241 | Methyltransf_11 | 0.57 |
| PF01797 | Y1_Tnp | 0.57 |
| PF04185 | Phosphoesterase | 0.57 |
| PF09685 | DUF4870 | 0.57 |
| PF08543 | Phos_pyr_kin | 0.57 |
| PF02880 | PGM_PMM_III | 0.57 |
| PF13507 | GATase_5 | 0.57 |
| PF13570 | PQQ_3 | 0.57 |
| PF03649 | UPF0014 | 0.57 |
| PF02965 | Met_synt_B12 | 0.57 |
| PF00440 | TetR_N | 0.57 |
| PF13103 | TonB_2 | 0.57 |
| PF00491 | Arginase | 0.57 |
| PF10633 | NPCBM_assoc | 0.57 |
| PF00581 | Rhodanese | 0.57 |
| PF03976 | PPK2 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 30.11 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 3.41 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.27 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.70 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.14 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.14 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.57 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.57 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.57 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.57 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.57 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.57 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.57 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.57 |
| COG0390 | ABC-type iron transport system FetAB, permease component | Inorganic ion transport and metabolism [P] | 0.57 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.57 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.09 % |
| Unclassified | root | N/A | 15.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10000172 | All Organisms → cellular organisms → Bacteria | 48096 | Open in IMG/M |
| 3300000567|JGI12270J11330_10174691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300001082|JGI12664J13189_1009731 | Not Available | 586 | Open in IMG/M |
| 3300001154|JGI12636J13339_1000685 | All Organisms → cellular organisms → Bacteria | 5578 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100076511 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300003220|JGI26342J46808_1031590 | Not Available | 532 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10007824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3359 | Open in IMG/M |
| 3300004080|Ga0062385_10027489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2236 | Open in IMG/M |
| 3300004091|Ga0062387_100058779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1886 | Open in IMG/M |
| 3300004092|Ga0062389_104073136 | Not Available | 549 | Open in IMG/M |
| 3300004152|Ga0062386_100961825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300004152|Ga0062386_101057493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300004631|Ga0058899_12016931 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300005533|Ga0070734_10542494 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005534|Ga0070735_10379291 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300005534|Ga0070735_10388239 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005541|Ga0070733_10006750 | All Organisms → cellular organisms → Bacteria | 7458 | Open in IMG/M |
| 3300005541|Ga0070733_10015051 | All Organisms → cellular organisms → Bacteria | 4855 | Open in IMG/M |
| 3300005541|Ga0070733_10313319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300005541|Ga0070733_10881878 | Not Available | 601 | Open in IMG/M |
| 3300005542|Ga0070732_10810751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300005591|Ga0070761_10010381 | All Organisms → cellular organisms → Bacteria | 5253 | Open in IMG/M |
| 3300005591|Ga0070761_10268935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300005591|Ga0070761_10577592 | Not Available | 698 | Open in IMG/M |
| 3300005591|Ga0070761_11066876 | Not Available | 514 | Open in IMG/M |
| 3300005602|Ga0070762_10009095 | All Organisms → cellular organisms → Bacteria | 4934 | Open in IMG/M |
| 3300005602|Ga0070762_10148579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1400 | Open in IMG/M |
| 3300005712|Ga0070764_10026633 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300006050|Ga0075028_100014811 | All Organisms → cellular organisms → Bacteria | 3313 | Open in IMG/M |
| 3300006050|Ga0075028_100252446 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300006059|Ga0075017_100915071 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300006176|Ga0070765_100003657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9886 | Open in IMG/M |
| 3300006176|Ga0070765_100006381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7903 | Open in IMG/M |
| 3300006176|Ga0070765_100476331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1171 | Open in IMG/M |
| 3300006893|Ga0073928_10027019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5635 | Open in IMG/M |
| 3300006893|Ga0073928_10088389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2634 | Open in IMG/M |
| 3300009523|Ga0116221_1054313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1854 | Open in IMG/M |
| 3300009523|Ga0116221_1142051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1048 | Open in IMG/M |
| 3300009525|Ga0116220_10386550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300009623|Ga0116133_1047543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300009665|Ga0116135_1018055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2438 | Open in IMG/M |
| 3300009665|Ga0116135_1069310 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300009683|Ga0116224_10319199 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300009760|Ga0116131_1018136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 2609 | Open in IMG/M |
| 3300009824|Ga0116219_10207464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300009839|Ga0116223_10094185 | Not Available | 1899 | Open in IMG/M |
| 3300010339|Ga0074046_10203897 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300010341|Ga0074045_10011650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7244 | Open in IMG/M |
| 3300010343|Ga0074044_10003648 | All Organisms → cellular organisms → Bacteria | 13030 | Open in IMG/M |
| 3300010379|Ga0136449_100009374 | All Organisms → cellular organisms → Bacteria | 27405 | Open in IMG/M |
| 3300010379|Ga0136449_100011940 | All Organisms → cellular organisms → Bacteria | 23702 | Open in IMG/M |
| 3300010379|Ga0136449_100014646 | All Organisms → cellular organisms → Bacteria | 20920 | Open in IMG/M |
| 3300010379|Ga0136449_102178981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300010398|Ga0126383_13172988 | Not Available | 537 | Open in IMG/M |
| 3300011074|Ga0138559_1161627 | Not Available | 546 | Open in IMG/M |
| 3300011120|Ga0150983_13053496 | Not Available | 500 | Open in IMG/M |
| 3300011411|Ga0153933_1030877 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300014491|Ga0182014_10015374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6964 | Open in IMG/M |
| 3300014495|Ga0182015_10001872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 26780 | Open in IMG/M |
| 3300014501|Ga0182024_10089294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4546 | Open in IMG/M |
| 3300014501|Ga0182024_10092652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4440 | Open in IMG/M |
| 3300014501|Ga0182024_11030631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 978 | Open in IMG/M |
| 3300014657|Ga0181522_10663835 | Not Available | 635 | Open in IMG/M |
| 3300017822|Ga0187802_10009014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3170 | Open in IMG/M |
| 3300017822|Ga0187802_10043183 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300017823|Ga0187818_10135532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1069 | Open in IMG/M |
| 3300017924|Ga0187820_1075535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300017930|Ga0187825_10166069 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300017933|Ga0187801_10460482 | Not Available | 534 | Open in IMG/M |
| 3300017943|Ga0187819_10455569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300017943|Ga0187819_10471169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300017946|Ga0187879_10031884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3182 | Open in IMG/M |
| 3300018009|Ga0187884_10233782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300018022|Ga0187864_10062276 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300018022|Ga0187864_10194043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300018042|Ga0187871_10098447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1688 | Open in IMG/M |
| 3300020579|Ga0210407_10059704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2855 | Open in IMG/M |
| 3300020579|Ga0210407_10334668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1184 | Open in IMG/M |
| 3300020579|Ga0210407_10679847 | Not Available | 799 | Open in IMG/M |
| 3300020579|Ga0210407_10958549 | Not Available | 654 | Open in IMG/M |
| 3300020580|Ga0210403_10001731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 20306 | Open in IMG/M |
| 3300020580|Ga0210403_10219009 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300020580|Ga0210403_10866327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300020580|Ga0210403_11060592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300020580|Ga0210403_11432949 | Not Available | 522 | Open in IMG/M |
| 3300020582|Ga0210395_10228613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1396 | Open in IMG/M |
| 3300020582|Ga0210395_10374939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300020582|Ga0210395_10557254 | Not Available | 861 | Open in IMG/M |
| 3300020582|Ga0210395_10963701 | Not Available | 633 | Open in IMG/M |
| 3300020583|Ga0210401_10000289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 62756 | Open in IMG/M |
| 3300020583|Ga0210401_10015496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7375 | Open in IMG/M |
| 3300020583|Ga0210401_10314394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1427 | Open in IMG/M |
| 3300020583|Ga0210401_11436125 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300021171|Ga0210405_10042129 | All Organisms → cellular organisms → Bacteria | 3629 | Open in IMG/M |
| 3300021178|Ga0210408_10596623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300021178|Ga0210408_11266027 | Not Available | 561 | Open in IMG/M |
| 3300021180|Ga0210396_10030779 | All Organisms → cellular organisms → Bacteria | 4961 | Open in IMG/M |
| 3300021180|Ga0210396_10184467 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
| 3300021181|Ga0210388_10492260 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300021181|Ga0210388_10906411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300021181|Ga0210388_11062849 | Not Available | 692 | Open in IMG/M |
| 3300021401|Ga0210393_10019882 | All Organisms → cellular organisms → Bacteria | 5213 | Open in IMG/M |
| 3300021401|Ga0210393_10073719 | All Organisms → cellular organisms → Bacteria | 2698 | Open in IMG/M |
| 3300021401|Ga0210393_10130798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2011 | Open in IMG/M |
| 3300021401|Ga0210393_10477623 | Not Available | 1018 | Open in IMG/M |
| 3300021402|Ga0210385_10101485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2008 | Open in IMG/M |
| 3300021402|Ga0210385_10927416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300021407|Ga0210383_10000517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 35554 | Open in IMG/M |
| 3300021420|Ga0210394_10108594 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300021420|Ga0210394_10282534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
| 3300021420|Ga0210394_10448488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
| 3300021432|Ga0210384_10726422 | Not Available | 888 | Open in IMG/M |
| 3300021433|Ga0210391_11376005 | Not Available | 543 | Open in IMG/M |
| 3300021474|Ga0210390_10021551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5245 | Open in IMG/M |
| 3300021478|Ga0210402_10138696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2209 | Open in IMG/M |
| 3300021478|Ga0210402_11322987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300021478|Ga0210402_11830772 | Not Available | 533 | Open in IMG/M |
| 3300021479|Ga0210410_10880064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300021559|Ga0210409_10007358 | All Organisms → cellular organisms → Bacteria | 11343 | Open in IMG/M |
| 3300021559|Ga0210409_10651415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300021559|Ga0210409_11073823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300022523|Ga0242663_1145826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300022557|Ga0212123_10006602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 19195 | Open in IMG/M |
| 3300022557|Ga0212123_10448116 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300022726|Ga0242654_10184120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 717 | Open in IMG/M |
| 3300023030|Ga0224561_1019558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300025434|Ga0208690_1012081 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300027370|Ga0209010_1000113 | All Organisms → cellular organisms → Bacteria | 29891 | Open in IMG/M |
| 3300027570|Ga0208043_1024373 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300027570|Ga0208043_1025506 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300027609|Ga0209221_1086622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300027625|Ga0208044_1205079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300027648|Ga0209420_1008062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3967 | Open in IMG/M |
| 3300027660|Ga0209736_1092323 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300027674|Ga0209118_1000233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 34966 | Open in IMG/M |
| 3300027701|Ga0209447_10070542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300027795|Ga0209139_10068028 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300027824|Ga0209040_10028872 | All Organisms → cellular organisms → Bacteria | 3529 | Open in IMG/M |
| 3300027826|Ga0209060_10361153 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027842|Ga0209580_10101537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
| 3300027854|Ga0209517_10249865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
| 3300027854|Ga0209517_10384503 | Not Available | 793 | Open in IMG/M |
| 3300027854|Ga0209517_10424684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300027867|Ga0209167_10008731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4855 | Open in IMG/M |
| 3300027867|Ga0209167_10017122 | All Organisms → cellular organisms → Bacteria | 3432 | Open in IMG/M |
| 3300027867|Ga0209167_10270011 | Not Available | 916 | Open in IMG/M |
| 3300027884|Ga0209275_10557255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300027894|Ga0209068_10020264 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
| 3300028016|Ga0265354_1018062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300028906|Ga0308309_10003991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8884 | Open in IMG/M |
| 3300028906|Ga0308309_10759417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300029636|Ga0222749_10612480 | Not Available | 595 | Open in IMG/M |
| 3300030494|Ga0310037_10131501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1144 | Open in IMG/M |
| 3300030659|Ga0316363_10140142 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300030659|Ga0316363_10165220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
| 3300031090|Ga0265760_10011218 | All Organisms → cellular organisms → Bacteria | 2562 | Open in IMG/M |
| 3300031090|Ga0265760_10014703 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300031090|Ga0265760_10291596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300031128|Ga0170823_14827581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300031708|Ga0310686_103106600 | All Organisms → cellular organisms → Bacteria | 12108 | Open in IMG/M |
| 3300031708|Ga0310686_104992355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2067 | Open in IMG/M |
| 3300031708|Ga0310686_107814168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8498 | Open in IMG/M |
| 3300031715|Ga0307476_10086391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2196 | Open in IMG/M |
| 3300031718|Ga0307474_10000001 | All Organisms → cellular organisms → Bacteria | 353370 | Open in IMG/M |
| 3300031718|Ga0307474_10075929 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300031718|Ga0307474_10093719 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
| 3300031753|Ga0307477_10127215 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300031823|Ga0307478_10174060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1720 | Open in IMG/M |
| 3300031823|Ga0307478_11003060 | Not Available | 698 | Open in IMG/M |
| 3300032160|Ga0311301_10044630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10468 | Open in IMG/M |
| 3300032160|Ga0311301_10088537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6228 | Open in IMG/M |
| 3300032160|Ga0311301_10603338 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300032160|Ga0311301_11568743 | Not Available | 804 | Open in IMG/M |
| 3300032515|Ga0348332_11333499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300033402|Ga0326728_10181624 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300033887|Ga0334790_021199 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 14.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.39% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.84% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.27% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.70% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.70% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.57% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.57% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.57% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.57% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.57% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003220 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_1000017214 | 3300000567 | Peatlands Soil | MTEFLRKTQASGAVANIAEYVVILFVALMTGVSTLRLLGILP* |
| JGI12270J11330_101746911 | 3300000567 | Peatlands Soil | MTDLAKTRVSNMAANLAEYAVMLFVALMTGVSTLRLLGILP* |
| JGI12664J13189_10097312 | 3300001082 | Forest Soil | MTEFLRKTRASGVVENVAEYVVMLFVTAMTGLSTLRLLGILP* |
| JGI12636J13339_10006852 | 3300001154 | Forest Soil | MIEFLRKTGSHGQLADIAEYVVMLFVTLMTGVSTLRLLGILP* |
| JGIcombinedJ26739_1000765114 | 3300002245 | Forest Soil | MTSFLRKAGAPGLIANVAEYLVMLFVAAMTGVSTLRLLGILP* |
| JGI26342J46808_10315901 | 3300003220 | Bog Forest Soil | MTEFLRKTRASGVVENVAEYVVMLFVAAMTGLSTLRLLGILP* |
| JGIcombinedJ51221_100078243 | 3300003505 | Forest Soil | MTDFLRKTQATGVVANLAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0062385_100274893 | 3300004080 | Bog Forest Soil | MTEFLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP* |
| Ga0062387_1000587793 | 3300004091 | Bog Forest Soil | MTEFLRRTRGTGVVANIAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0062389_1040731361 | 3300004092 | Bog Forest Soil | MTDFLSKTRAAGVVANIAEYVVMLFVALMTGVSTLRLLGILP* |
| Ga0062386_1009618251 | 3300004152 | Bog Forest Soil | MAEFLRKNVSNERVANLAEYVVMLFVTLMTGVSTLRLLGILP* |
| Ga0062386_1010574932 | 3300004152 | Bog Forest Soil | MTDFLRRTQATGVVANVAEYVVMLFVAIMTGVSTLRLLGILP* |
| Ga0058899_120169312 | 3300004631 | Forest Soil | ERDMADFLRKTGAFGVVVRVAEYAVMVFVAVMTGVNTLRLLGILP* |
| Ga0070734_105424941 | 3300005533 | Surface Soil | LELRGGDEMTELLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP* |
| Ga0070735_103792912 | 3300005534 | Surface Soil | LDTAENNSRAAGENEMTELLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP* |
| Ga0070735_103882391 | 3300005534 | Surface Soil | MTELLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP* |
| Ga0070733_100067508 | 3300005541 | Surface Soil | MSEFLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP* |
| Ga0070733_100150516 | 3300005541 | Surface Soil | MADFLHKVKSHGCVADIAEYVVMFFVTLMTGMSTLRLLGILP* |
| Ga0070733_103133191 | 3300005541 | Surface Soil | MTDFLRKTQATGVVANIAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0070733_108818781 | 3300005541 | Surface Soil | MTEFLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP* |
| Ga0070732_108107512 | 3300005542 | Surface Soil | LRKAGAPDMVASVAEYFVMLFVAVMTGVSTLRLLGILP* |
| Ga0070761_100103813 | 3300005591 | Soil | MTEFLRKTRVSGVVENVAEYVVMLFVAAMTGLSTLRLLGILP* |
| Ga0070761_102689352 | 3300005591 | Soil | MTDFLRRTQATGVVANIAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0070761_105775922 | 3300005591 | Soil | MTEFLRKTRATGMIANAAEYFVMLFVALMTGVSTLRLLGILP* |
| Ga0070761_110668762 | 3300005591 | Soil | MTEFLRKTRASCVVENVAEYLVMLFVAAMTAVSTLRLLGILP* |
| Ga0070762_100090953 | 3300005602 | Soil | MTEFLRKTRASGVVENVAEYVVMLFVAAMTGVSTLRLLGILP* |
| Ga0070762_101485792 | 3300005602 | Soil | MTDFLRRTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0070764_100266332 | 3300005712 | Soil | MAEFLRKTRASGVVENVAEYLVMLFVAAMTGVSTLRLLGILP* |
| Ga0075028_1000148112 | 3300006050 | Watersheds | MTEFLRKKGRVADIAEYVVMLLVTLMTGVSTLRLLGILP* |
| Ga0075028_1002524461 | 3300006050 | Watersheds | MASVLEKTQANSVVASIVEYAVMLFVIVMTGVSTLRLLGMLP* |
| Ga0075017_1009150712 | 3300006059 | Watersheds | MASVLEKTQANSVVASIVEYAVMLFVVVMTGVSTLRLLGMLP* |
| Ga0070765_1000036579 | 3300006176 | Soil | TRVSGVVENVAEYVVMLFVAAMTGLSTLRLLGILP* |
| Ga0070765_1000063814 | 3300006176 | Soil | MTAFLRKAGAPAAIASIAEYLVMLFVAVMTGVSTLRLLGILP* |
| Ga0070765_1004763311 | 3300006176 | Soil | AGRRENMTDFLRRTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0073928_100270195 | 3300006893 | Iron-Sulfur Acid Spring | MTELLRKARTTDAIARIAEYVVVTFVAVMTGVSTLRLLGILP* |
| Ga0073928_100883892 | 3300006893 | Iron-Sulfur Acid Spring | MTEFLRKARTSDAIARVAEYVVVTFVAVMTGVSTLRLLGILP* |
| Ga0116221_10543131 | 3300009523 | Peatlands Soil | ENMTDFLRKRQATGVAANIAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0116221_11420512 | 3300009523 | Peatlands Soil | GREDMTDFLRKARASDLIASIAEYVVMMFVTVMTGVSTLRLLGILP* |
| Ga0116220_103865501 | 3300009525 | Peatlands Soil | MTDFLRKTRASDLIASVAEYVLMMFVAVMTGVSTLRLLGILP* |
| Ga0116133_10475432 | 3300009623 | Peatland | MTELLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGLLP* |
| Ga0116135_10180552 | 3300009665 | Peatland | MTEFLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGLLP* |
| Ga0116135_10693101 | 3300009665 | Peatland | MTEFLRKTRASGVVENVAEYAVMLFVTAMTGLSTLRLLG |
| Ga0116224_103191992 | 3300009683 | Peatlands Soil | MPDFLRKARASDLIASIAEYVVMMFVTVMTGVSTLRLLGILP* |
| Ga0116131_10181362 | 3300009760 | Peatland | MTEFLRKTGWYGRVADIAEYVVMLFVTLMTGVSTLRLLGILP* |
| Ga0116219_102074642 | 3300009824 | Peatlands Soil | MTDFLRKARASDLIASVAEYVVMMFVTVMTGVSTLRLLGILP* |
| Ga0116223_100941851 | 3300009839 | Peatlands Soil | TGRRNNMTDLAKTRVSNMAANLAEYAVMLFVALMTGVSTLRLLGILP* |
| Ga0074046_102038972 | 3300010339 | Bog Forest Soil | MSEFVRKAALNDRVANVAEYLVMLFVMLMTGVSTMRLLGILP |
| Ga0074045_100116503 | 3300010341 | Bog Forest Soil | MSEFVRKAALNDRVANVAEYLVMLFVMLMTGVSTMRLLGILP* |
| Ga0074044_100036486 | 3300010343 | Bog Forest Soil | MTDFLRKTRASDLIARVAEYVVMMFVAVMTGVSTLRLLGILP* |
| Ga0136449_1000093742 | 3300010379 | Peatlands Soil | MSEFLRKTVWNDRVANVAEYVVMLFVTLMTGISTLRLLGILP* |
| Ga0136449_1000119407 | 3300010379 | Peatlands Soil | MLGGLKMTEFLRKTGSNGRLADIAEYVVMLFVTLMTGVSTLRLLGILP* |
| Ga0136449_10001464611 | 3300010379 | Peatlands Soil | VTDFLRETRESGVVVKIAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0136449_1021789811 | 3300010379 | Peatlands Soil | MTDFLRKTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP* |
| Ga0126383_131729882 | 3300010398 | Tropical Forest Soil | MASVLQKTQSNDRVASIVEYLVVLFVVVMTGVSTLRLLGMLP* |
| Ga0138559_11616271 | 3300011074 | Peatlands Soil | EDMTDFLRKARASDLIASIAEYVVMMFVTVMTGVSTLRLLGILP* |
| Ga0150983_130534961 | 3300011120 | Forest Soil | KMTEFLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP* |
| Ga0153933_10308771 | 3300011411 | Attine Ant Fungus Gardens | SKARTTDAIARVAEYVVITFVAVMTGVSTLRLLGILP* |
| Ga0182014_100153745 | 3300014491 | Bog | MSEFLRKAALNDRVANLAEYLVMLFVMLMTGVSTMRLLGILP* |
| Ga0182015_1000187226 | 3300014495 | Palsa | MTDFLRKARTTDVIARVAEYVVVTFVTVMTGVSTLRLLGILP* |
| Ga0182024_100892942 | 3300014501 | Permafrost | MTELLRKARTTDAIARIAEYVVVTFVTVMTGVSTLRLLGILP* |
| Ga0182024_100926523 | 3300014501 | Permafrost | MTELLRKARTTDAIARVAEYVVVTFVAVMTGLSTLRLLGILP* |
| Ga0182024_110306312 | 3300014501 | Permafrost | MTELLRKARTTDAIARVAEYVVVTFVAMMTGVSTLRLMGILP* |
| Ga0181522_106638352 | 3300014657 | Bog | MTEFLRKTRASGVVENVAEYAVMLFVTAMTGLSTLRLLGLLP* |
| Ga0187802_100090142 | 3300017822 | Freshwater Sediment | MTDFLRKTRASDLIASVAEYVVMMFVALMTGVSTLRLLGILP |
| Ga0187802_100431832 | 3300017822 | Freshwater Sediment | MTDFLRKTRASDLIARVAEYVVMMFVALMTGVSTLRLLGILP |
| Ga0187818_101355322 | 3300017823 | Freshwater Sediment | MSEFLRKTVSNDRVANVAEYVVMLFVTLMTGISTLRLLGILP |
| Ga0187820_10755352 | 3300017924 | Freshwater Sediment | GREDMTDFLRKARASDLIASVAEYVVMTFVAVMTGVSTLRLLGILP |
| Ga0187825_101660692 | 3300017930 | Freshwater Sediment | MAEFLRKAQATDVIASVAEYAVMLFVAAMTGVSTLRLLGILP |
| Ga0187801_104604822 | 3300017933 | Freshwater Sediment | MTDFLRKTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0187819_104555692 | 3300017943 | Freshwater Sediment | MTDFLRKTKATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0187819_104711691 | 3300017943 | Freshwater Sediment | MADIQPKTQASGVMAKIAEYAVMLFVAVMTGVSTLRLLGILP |
| Ga0187879_100318845 | 3300017946 | Peatland | MTELLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0187884_102337822 | 3300018009 | Peatland | MTEFLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0187864_100622761 | 3300018022 | Peatland | MTDFLRKTGAPAVVANIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0187864_101940431 | 3300018022 | Peatland | QDMSEFLRKTVWNDRVANVAEYVVMLFVTLMTGISTLRLLGILP |
| Ga0187871_100984471 | 3300018042 | Peatland | NMTELLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0210407_100597045 | 3300020579 | Soil | MTDFLRRTQATGVVANIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210407_103346681 | 3300020579 | Soil | MQKERDMAEYLRKTGALGVVASVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210407_106798471 | 3300020579 | Soil | MTEFLRKAGSQGRLADVAEYLVMLFVTLMTGVSTLRLLGILP |
| Ga0210407_109585491 | 3300020579 | Soil | MTEFLRKAGAPGVVANIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210403_1000173114 | 3300020580 | Soil | MTDFLRRTQATGVVANIAEYVVMVFVAVMTGVSTLRLLGILP |
| Ga0210403_102190092 | 3300020580 | Soil | MAEYLRKTGALGVVASVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210403_108663272 | 3300020580 | Soil | MIDFLRKTRAPGVAANIAEYFVMLFVALMTGVSTLRLLGILP |
| Ga0210403_110605921 | 3300020580 | Soil | GRRENMSEFLRKTRASGVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0210403_114329491 | 3300020580 | Soil | MTEFLRKTRASGVVANVAEYVVMLFVAAMTGLSTLRLLGILP |
| Ga0210395_102286132 | 3300020582 | Soil | MTDFLRRTQTTGVVANVAEYVVMLFVAIMTGVSTLRLLGILP |
| Ga0210395_103749392 | 3300020582 | Soil | MSDFLRRTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210395_105572542 | 3300020582 | Soil | VTEFLLKTRESGVVVKIAEYVVMLFVAVMMGVSTLRLLGILP |
| Ga0210395_109637012 | 3300020582 | Soil | MSEFLRKTRASGVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0210401_100002899 | 3300020583 | Soil | MTDFLRKTQATGVVANLAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210401_100154962 | 3300020583 | Soil | MTEFLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP |
| Ga0210401_103143942 | 3300020583 | Soil | MTDFLRKTQATGVVANIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210401_114361251 | 3300020583 | Soil | MTEFLRKTRAPGVVVNVAEYVVMLFVALMTGVSTLRLLGILP |
| Ga0210405_100421292 | 3300021171 | Soil | MTDFLRKTQATAVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210408_105966231 | 3300021178 | Soil | MTEFLRKAGAPGVVANIAEYVVMLLVAVMTGVSTLRLLGILP |
| Ga0210408_112660272 | 3300021178 | Soil | TDFLRKTRESGVVVKIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210396_100307794 | 3300021180 | Soil | VTEFLRKTRESGVVVKIAEYAVMLFVAVMTGVSTLRLLGILP |
| Ga0210396_101844672 | 3300021180 | Soil | MKDFLSKTRASSVFASVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210388_104922602 | 3300021181 | Soil | MTEFLRKTRASCVVENVAEYLVMLFVAAMTAVSTLRLLGILP |
| Ga0210388_109064112 | 3300021181 | Soil | MSDFLRRTQATGVVANVAEYLVMLFVAVMTGVSTLRLLGILP |
| Ga0210388_110628492 | 3300021181 | Soil | MTEFLRRTRATGMIANAAEYFVMLFVALMTGVSTLRLLGILP |
| Ga0210393_100198822 | 3300021401 | Soil | MTEFLRKAGSQGQLAAVAEYLVMLFVTLMTGVSTLRLLGLLP |
| Ga0210393_100737193 | 3300021401 | Soil | MTEFLRKARSQGQMADVAEYVVMLFVTLMTGVSTLRLLGILP |
| Ga0210393_101307984 | 3300021401 | Soil | MTEFLRKTRASGVVENVAEYVVMLFVAAMTGVSTLRLLGILP |
| Ga0210393_104776232 | 3300021401 | Soil | MFEYLRKTGSHGRLADIAEYVVMLFVTLMTGVSTLRLLGILP |
| Ga0210385_101014853 | 3300021402 | Soil | MAEFLRKTRASGVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0210385_109274161 | 3300021402 | Soil | EFLRKTRATGMIANAAEYFVMLFVALMTGVSTLRLLGILP |
| Ga0210383_1000051712 | 3300021407 | Soil | MTESLRRSRETGVVASIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210394_101085941 | 3300021420 | Soil | LLRKARTTDAVARVAEYAVATFVAVMTGVSTLRLLGILP |
| Ga0210394_102825342 | 3300021420 | Soil | VPGGNVTEFLRKTRESGVVVKIAEYAVMLFVAVMTGVSTLRLLGILP |
| Ga0210394_104484882 | 3300021420 | Soil | MTDFLRRTQATGVVANVAEYVVMLFVAIMTGVSTLRLLGILP |
| Ga0210384_107264222 | 3300021432 | Soil | MTEFLRKTGSHGRVADIAEYVVMLFVTLMTGVSTLRLLGLLP |
| Ga0210391_113760052 | 3300021433 | Soil | TEFRRKTRESGVVVKIAEYAVMLFVAVMTGVSTLRLLGILP |
| Ga0210390_100215514 | 3300021474 | Soil | MTNFLRKAGAPAAIASVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210402_101386962 | 3300021478 | Soil | MTELRKTGTADVVANVAEYMVMLFVAVMTGVSTLRLLGILP |
| Ga0210402_113229871 | 3300021478 | Soil | MAEFLRKTRLGGYAGNIADYMVMLFVALMTGVSTLRLLGLLP |
| Ga0210402_118307722 | 3300021478 | Soil | MTSFVQKVRSHSVVANIAEYVVMLFVAVMTGLSTLRLLGMLP |
| Ga0210410_108800642 | 3300021479 | Soil | MTSFLQKVRSNNLVANIAEYAVMLFVVVMTGVSTLRLLGMLP |
| Ga0210409_1000735816 | 3300021559 | Soil | MTDFLRRTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210409_106514152 | 3300021559 | Soil | VTDFLRKTRESGVVVKIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0210409_110738231 | 3300021559 | Soil | MAEFLRKTRASGEVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0242663_11458262 | 3300022523 | Soil | KAAGRRENMTDFLRKTQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0212123_1000660218 | 3300022557 | Iron-Sulfur Acid Spring | MTELLRKARTTDAIARIAEYVVVTFVAVMTGVSTLRLLGILP |
| Ga0212123_104481162 | 3300022557 | Iron-Sulfur Acid Spring | MTELLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP |
| Ga0242654_101841201 | 3300022726 | Soil | MAEFLRKTRATGAVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0224561_10195582 | 3300023030 | Soil | MTEFLSKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0208690_10120813 | 3300025434 | Peatland | MTELLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGLLP |
| Ga0209010_100011310 | 3300027370 | Forest Soil | MTEFLRKTRASGVVENVAEYVVMLFVTAMTGLSTLRLLGILP |
| Ga0208043_10243732 | 3300027570 | Peatlands Soil | MTDFLRKRQATGVAANIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0208043_10255062 | 3300027570 | Peatlands Soil | MTEFLRKTQASGAVANIAEYVVILFVALMTGVSTLRLLGILP |
| Ga0209221_10866222 | 3300027609 | Forest Soil | MTEFLRKTRASGVVENVAEYAVMLFVTAMTGLSTLRLLGILP |
| Ga0208044_12050792 | 3300027625 | Peatlands Soil | LRKARASDLIASVAEYVVMMFVTVMTGVSTLRLLGILP |
| Ga0209420_10080623 | 3300027648 | Forest Soil | MTEFLRKTRVSGVVENVAEYVVMLFVAAMTGLSTLRLLGILP |
| Ga0209736_10923231 | 3300027660 | Forest Soil | MADFLRKTGAFGVVVRVAEYMVMVFVAVMTGVNTLRLLGILP |
| Ga0209118_10002332 | 3300027674 | Forest Soil | MIEFLRKTGSHGQLADIAEYVVMLFVTLMTGVSTLRLLGILP |
| Ga0209447_100705422 | 3300027701 | Bog Forest Soil | MTEFLRKTRASGVVENVAEYVVMLFVAAMTGLSTLRLLGILP |
| Ga0209139_100680281 | 3300027795 | Bog Forest Soil | VLRLPGRSRMTEFLRKAGAPGVVVNVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0209040_100288722 | 3300027824 | Bog Forest Soil | MAEFLRKNVSNERVANLAEYVVMLFVTLMTGLSTLRLLGILP |
| Ga0209060_103611531 | 3300027826 | Surface Soil | LELRGGDEMTELLRKARTTDAIARVAEYVVVTFVAVMTGVSTLRLLGILP |
| Ga0209580_101015371 | 3300027842 | Surface Soil | MNEFLRKTGASGVIASVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0209517_102498652 | 3300027854 | Peatlands Soil | MTDLAKTRVSNMAANLAEYAVMLFVALMTGVSTLRLLGILP |
| Ga0209517_103845032 | 3300027854 | Peatlands Soil | MSEFLRKTVWNDRVANVAEYVVMLFVTLMTGISTLRLLGILP |
| Ga0209517_104246842 | 3300027854 | Peatlands Soil | MLGGLKMTEFLRKTGSNGRLADIAEYVVMLFVTLMTGVSTLRLLGILP |
| Ga0209167_100087312 | 3300027867 | Surface Soil | MADFLHKVKSHGCVADIAEYVVMFFVTLMTGMSTLRLLGILP |
| Ga0209167_100171222 | 3300027867 | Surface Soil | MSEFLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0209167_102700112 | 3300027867 | Surface Soil | MTEFLRKAGSRGRIADVAEYVVMLFVTLMTGVSTLRLLGILP |
| Ga0209275_105572551 | 3300027884 | Soil | GRRENMTEFLRKTRASCVVENVAEYLVMLFVAAMTAVSTLRLLGILP |
| Ga0209068_100202644 | 3300027894 | Watersheds | MTEFLRKKGRVADIAEYVVMLLVTLMTGVSTLRLLGILP |
| Ga0265354_10180621 | 3300028016 | Rhizosphere | MTEFLRKTRASGVVANVAEYVVMLFVAAMTGLSTLRL |
| Ga0308309_100039913 | 3300028906 | Soil | MTAFLRKAGAPAAIASIAEYLVMLFVAVMTGVSTLRLLGILP |
| Ga0308309_107594172 | 3300028906 | Soil | MTEFLRKTRATGMIANAAEYFVMLFVALMTGVSTLRLLGILP |
| Ga0222749_106124802 | 3300029636 | Soil | MADFLRKTGAISVVVRVAEYVVILFVGVMTGVNTLRLLGILP |
| Ga0310037_101315011 | 3300030494 | Peatlands Soil | MTDFLRKARASDLIASVAEYVVMMFVTVMTGVSTLRLLGILP |
| Ga0316363_101401421 | 3300030659 | Peatlands Soil | MTDFLRKTRASDLIASVAEYVVMMFVTVMTGVSTLRLLGILP |
| Ga0316363_101652202 | 3300030659 | Peatlands Soil | TDFLRKARASDLIASVAEYVVMMFVTVMTGVSTLRLLGILP |
| Ga0265760_100112182 | 3300031090 | Soil | MTELLRKTRASCVVENVAEYLVMLFVAAMTAVSTLRLLGILP |
| Ga0265760_100147032 | 3300031090 | Soil | MTAFLRKAGAPAAIASVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0265760_102915961 | 3300031090 | Soil | RNMTEFLRKTRASGVVANVAEYVVMLFVAAMTGLSTLRLLGILP |
| Ga0170823_148275812 | 3300031128 | Forest Soil | AAGRRENMTDFLRKRQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0310686_10310660013 | 3300031708 | Soil | MTAFLRKAGAPAAIASVAEYFVMLFVALMTGVSTLRLLGILP |
| Ga0310686_1049923553 | 3300031708 | Soil | MTDFLRKAGATGAIASVAEYMVMLFVTVMTGVSTLRLLGILP |
| Ga0310686_1078141687 | 3300031708 | Soil | MTDFLRKTQATGVVANVAEYVVLLFVAVMTGVSTLRLLGILP |
| Ga0307476_100863911 | 3300031715 | Hardwood Forest Soil | MTEFLRKAHATDVIARVAEYAVMLFVAAMTGVSTLRLLGILR |
| Ga0307474_1000000184 | 3300031718 | Hardwood Forest Soil | MTEFLRKTGTSGVVLSVAEYVVMLFVTVMTGVSTLRLLGILP |
| Ga0307474_100759293 | 3300031718 | Hardwood Forest Soil | MTNFLRKAGASGVMASVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0307474_100937194 | 3300031718 | Hardwood Forest Soil | MTNFLRKAGAPCVIANIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0307477_101272152 | 3300031753 | Hardwood Forest Soil | MTDFLRKAGAPGVIASVAEYVVMLLVAVMTGVSTLRLLGILP |
| Ga0307478_101740602 | 3300031823 | Hardwood Forest Soil | NFLRKAGAAGVMASIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0307478_110030601 | 3300031823 | Hardwood Forest Soil | MTDFLRKRQATGVVANVAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0311301_1004463016 | 3300032160 | Peatlands Soil | MTDLAKTRVSNMAANLAEYAVMLFVALMTGVSTLRL |
| Ga0311301_100885377 | 3300032160 | Peatlands Soil | MTEFLRKTGSNGRLADIAEYVVMLFVTLMTGVSTLRLLGILP |
| Ga0311301_106033382 | 3300032160 | Peatlands Soil | MTDFLRKARASDLIASIAEYVVMMFVTVMTGVSTLRLLGILP |
| Ga0311301_115687432 | 3300032160 | Peatlands Soil | VTDFLRETRESGVVVKIAEYVVMLFVAVMTGVSTLRLLGILP |
| Ga0348332_113334992 | 3300032515 | Plant Litter | GRRENMTEFLRKTRASCVVENVAEYLVMLFVAAMTGVSTLRLLGILP |
| Ga0326728_101816242 | 3300033402 | Peat Soil | MAEFLRKTVSNERAANVAEYLVMLFVMLMTGVSTMRLLGILP |
| Ga0334790_021199_1082_1210 | 3300033887 | Soil | MTELLRKARTTDAIARVAEYVVVTFVAMMTGVSTLRLMGILP |
| ⦗Top⦘ |