| Basic Information | |
|---|---|
| Family ID | F033845 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MFDSLADRIREDEHKEVKNSERILRWVAIAVVSVVLFGGLYYGVRMIE |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.15 % |
| % of genes near scaffold ends (potentially truncated) | 51.14 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.023 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.568 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.591 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.53% β-sheet: 0.00% Coil/Unstructured: 39.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF01832 | Glucosaminidase | 54.55 |
| PF00575 | S1 | 6.82 |
| PF00691 | OmpA | 1.14 |
| PF11999 | Ice_binding | 0.57 |
| PF16095 | COR | 0.57 |
| PF08734 | GYD | 0.57 |
| PF02371 | Transposase_20 | 0.57 |
| PF00216 | Bac_DNA_binding | 0.57 |
| PF03450 | CO_deh_flav_C | 0.57 |
| PF00115 | COX1 | 0.57 |
| PF00578 | AhpC-TSA | 0.57 |
| PF04405 | ScdA_N | 0.57 |
| PF13517 | FG-GAP_3 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.57 |
| COG2846 | Iron-sulfur cluster repair protein YtfE, RIC family, contains ScdAN and hemerythrin domains | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.02 % |
| Unclassified | root | N/A | 3.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02HFW7V | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 518 | Open in IMG/M |
| 3300003321|soilH1_10201310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1126 | Open in IMG/M |
| 3300003938|Ga0063230_11106949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1021 | Open in IMG/M |
| 3300004099|Ga0058900_1320297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 547 | Open in IMG/M |
| 3300004099|Ga0058900_1422448 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300004100|Ga0058904_1008833 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300004120|Ga0058901_1534064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 998 | Open in IMG/M |
| 3300004137|Ga0058883_1507208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 710 | Open in IMG/M |
| 3300004139|Ga0058897_11058397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 566 | Open in IMG/M |
| 3300004139|Ga0058897_11156800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 512 | Open in IMG/M |
| 3300004468|Ga0068977_1255704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 686 | Open in IMG/M |
| 3300004476|Ga0068966_1441073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 751 | Open in IMG/M |
| 3300004606|Ga0068962_1177600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 665 | Open in IMG/M |
| 3300004631|Ga0058899_11670151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 582 | Open in IMG/M |
| 3300004631|Ga0058899_12025059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 511 | Open in IMG/M |
| 3300004631|Ga0058899_12110925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 508 | Open in IMG/M |
| 3300004631|Ga0058899_12161630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1044 | Open in IMG/M |
| 3300004631|Ga0058899_12229283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 576 | Open in IMG/M |
| 3300004798|Ga0058859_10032151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 669 | Open in IMG/M |
| 3300004798|Ga0058859_10522257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 798 | Open in IMG/M |
| 3300004799|Ga0058863_11926975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 595 | Open in IMG/M |
| 3300004801|Ga0058860_11675252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 677 | Open in IMG/M |
| 3300004803|Ga0058862_12031995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 531 | Open in IMG/M |
| 3300005332|Ga0066388_104819058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 686 | Open in IMG/M |
| 3300005334|Ga0068869_100372055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1169 | Open in IMG/M |
| 3300005367|Ga0070667_101281348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 686 | Open in IMG/M |
| 3300005439|Ga0070711_101783243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 540 | Open in IMG/M |
| 3300005531|Ga0070738_10013903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6720 | Open in IMG/M |
| 3300005532|Ga0070739_10055973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2507 | Open in IMG/M |
| 3300005548|Ga0070665_101039651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 831 | Open in IMG/M |
| 3300005575|Ga0066702_10627162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 644 | Open in IMG/M |
| 3300005577|Ga0068857_101381110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005598|Ga0066706_10773588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 759 | Open in IMG/M |
| 3300005841|Ga0068863_102023172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 586 | Open in IMG/M |
| 3300005944|Ga0066788_10003645 | All Organisms → cellular organisms → Bacteria | 3045 | Open in IMG/M |
| 3300006028|Ga0070717_11432259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 627 | Open in IMG/M |
| 3300006162|Ga0075030_101213133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 592 | Open in IMG/M |
| 3300006237|Ga0097621_101527726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 634 | Open in IMG/M |
| 3300006806|Ga0079220_11531410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 574 | Open in IMG/M |
| 3300006860|Ga0063829_1481537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 613 | Open in IMG/M |
| 3300006861|Ga0063777_1506368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 515 | Open in IMG/M |
| 3300009176|Ga0105242_12984482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 524 | Open in IMG/M |
| 3300009520|Ga0116214_1358892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 565 | Open in IMG/M |
| 3300009521|Ga0116222_1060634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1640 | Open in IMG/M |
| 3300009521|Ga0116222_1121421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 1125 | Open in IMG/M |
| 3300009824|Ga0116219_10077143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1955 | Open in IMG/M |
| 3300010048|Ga0126373_11642776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 707 | Open in IMG/M |
| 3300010366|Ga0126379_11384693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300010379|Ga0136449_100991013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1354 | Open in IMG/M |
| 3300010399|Ga0134127_11045537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300010400|Ga0134122_11742234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 652 | Open in IMG/M |
| 3300010403|Ga0134123_10449501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1197 | Open in IMG/M |
| 3300011029|Ga0138551_106314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 743 | Open in IMG/M |
| 3300011064|Ga0138525_1134582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 515 | Open in IMG/M |
| 3300011078|Ga0138565_1047623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 670 | Open in IMG/M |
| 3300011078|Ga0138565_1162323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 803 | Open in IMG/M |
| 3300011079|Ga0138569_1086336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 784 | Open in IMG/M |
| 3300011088|Ga0138576_1292054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 639 | Open in IMG/M |
| 3300011120|Ga0150983_10781216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 805 | Open in IMG/M |
| 3300011120|Ga0150983_12652301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 760 | Open in IMG/M |
| 3300011120|Ga0150983_13087126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 562 | Open in IMG/M |
| 3300011120|Ga0150983_13110829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 738 | Open in IMG/M |
| 3300011120|Ga0150983_13895143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 548 | Open in IMG/M |
| 3300011120|Ga0150983_14122144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 535 | Open in IMG/M |
| 3300011120|Ga0150983_15339341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 586 | Open in IMG/M |
| 3300011120|Ga0150983_15942801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 836 | Open in IMG/M |
| 3300011120|Ga0150983_16293288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 656 | Open in IMG/M |
| 3300011120|Ga0150983_16330083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 553 | Open in IMG/M |
| 3300011332|Ga0126317_10585015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 675 | Open in IMG/M |
| 3300011332|Ga0126317_10596293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 521 | Open in IMG/M |
| 3300011332|Ga0126317_10661362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 712 | Open in IMG/M |
| 3300011340|Ga0151652_12550291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 611 | Open in IMG/M |
| 3300011340|Ga0151652_13441756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 994 | Open in IMG/M |
| 3300012212|Ga0150985_101610570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 701 | Open in IMG/M |
| 3300012212|Ga0150985_106133040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 788 | Open in IMG/M |
| 3300012212|Ga0150985_106631628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 542 | Open in IMG/M |
| 3300012212|Ga0150985_108622872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 567 | Open in IMG/M |
| 3300012212|Ga0150985_111570098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 667 | Open in IMG/M |
| 3300012212|Ga0150985_113903828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 739 | Open in IMG/M |
| 3300012212|Ga0150985_114954524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 614 | Open in IMG/M |
| 3300012212|Ga0150985_116290597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 562 | Open in IMG/M |
| 3300012212|Ga0150985_116725469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 911 | Open in IMG/M |
| 3300012212|Ga0150985_122529055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 614 | Open in IMG/M |
| 3300012212|Ga0150985_122642094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 760 | Open in IMG/M |
| 3300012469|Ga0150984_100453810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 704 | Open in IMG/M |
| 3300012469|Ga0150984_101689456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 775 | Open in IMG/M |
| 3300012469|Ga0150984_105592612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 519 | Open in IMG/M |
| 3300012469|Ga0150984_106975729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 670 | Open in IMG/M |
| 3300012469|Ga0150984_110446811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 618 | Open in IMG/M |
| 3300012469|Ga0150984_111768121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 569 | Open in IMG/M |
| 3300012532|Ga0137373_10476982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 956 | Open in IMG/M |
| 3300013297|Ga0157378_10407771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1341 | Open in IMG/M |
| 3300013297|Ga0157378_11516607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300013297|Ga0157378_11943918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 638 | Open in IMG/M |
| 3300015371|Ga0132258_10507761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3016 | Open in IMG/M |
| 3300016750|Ga0181505_10057912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 540 | Open in IMG/M |
| 3300017823|Ga0187818_10182852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 915 | Open in IMG/M |
| 3300017934|Ga0187803_10028491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2222 | Open in IMG/M |
| 3300017970|Ga0187783_10101403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2122 | Open in IMG/M |
| 3300017970|Ga0187783_10857751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 655 | Open in IMG/M |
| 3300017972|Ga0187781_10069301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2428 | Open in IMG/M |
| 3300017972|Ga0187781_10371254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1020 | Open in IMG/M |
| 3300018468|Ga0066662_10073697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2300 | Open in IMG/M |
| 3300018476|Ga0190274_13167308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 553 | Open in IMG/M |
| 3300019229|Ga0180116_1282591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 514 | Open in IMG/M |
| 3300019230|Ga0181501_1141753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 773 | Open in IMG/M |
| 3300019248|Ga0180117_1105216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 543 | Open in IMG/M |
| 3300019278|Ga0187800_1520548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 894 | Open in IMG/M |
| 3300020068|Ga0184649_1512923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 881 | Open in IMG/M |
| 3300020069|Ga0197907_10578716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 537 | Open in IMG/M |
| 3300020069|Ga0197907_10607524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 792 | Open in IMG/M |
| 3300020070|Ga0206356_10054362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 623 | Open in IMG/M |
| 3300020070|Ga0206356_11279838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 553 | Open in IMG/M |
| 3300020070|Ga0206356_11304223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 625 | Open in IMG/M |
| 3300020075|Ga0206349_1142090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 721 | Open in IMG/M |
| 3300020078|Ga0206352_11194918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 602 | Open in IMG/M |
| 3300021407|Ga0210383_10217328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1637 | Open in IMG/M |
| 3300021861|Ga0213853_10473884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 626 | Open in IMG/M |
| 3300022467|Ga0224712_10660737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 513 | Open in IMG/M |
| 3300022501|Ga0242645_1022854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 563 | Open in IMG/M |
| 3300022504|Ga0242642_1028301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 798 | Open in IMG/M |
| 3300022509|Ga0242649_1079735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 503 | Open in IMG/M |
| 3300022525|Ga0242656_1131525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 515 | Open in IMG/M |
| 3300022525|Ga0242656_1142385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 501 | Open in IMG/M |
| 3300022527|Ga0242664_1142938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 523 | Open in IMG/M |
| 3300022531|Ga0242660_1069060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 810 | Open in IMG/M |
| 3300022532|Ga0242655_10170248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 650 | Open in IMG/M |
| 3300022711|Ga0242674_1069289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 514 | Open in IMG/M |
| 3300022717|Ga0242661_1102586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 600 | Open in IMG/M |
| 3300022718|Ga0242675_1118704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 527 | Open in IMG/M |
| 3300022724|Ga0242665_10341460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 534 | Open in IMG/M |
| 3300022726|Ga0242654_10447964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 503 | Open in IMG/M |
| 3300025942|Ga0207689_10843161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 773 | Open in IMG/M |
| 3300025960|Ga0207651_11177250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 688 | Open in IMG/M |
| 3300026078|Ga0207702_10989900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300026215|Ga0209849_1012224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1408 | Open in IMG/M |
| 3300027706|Ga0209581_1016094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4175 | Open in IMG/M |
| 3300027773|Ga0209810_1091774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1392 | Open in IMG/M |
| 3300027854|Ga0209517_10104821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1895 | Open in IMG/M |
| 3300028379|Ga0268266_11037400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 793 | Open in IMG/M |
| 3300030706|Ga0310039_10162488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 897 | Open in IMG/M |
| 3300030829|Ga0308203_1070431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 561 | Open in IMG/M |
| 3300030902|Ga0308202_1099175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 600 | Open in IMG/M |
| 3300030905|Ga0308200_1070740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 693 | Open in IMG/M |
| 3300030905|Ga0308200_1086543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 647 | Open in IMG/M |
| 3300030905|Ga0308200_1148061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 540 | Open in IMG/M |
| 3300031058|Ga0308189_10156836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 787 | Open in IMG/M |
| 3300031058|Ga0308189_10295351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 631 | Open in IMG/M |
| 3300031091|Ga0308201_10297402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 574 | Open in IMG/M |
| 3300031093|Ga0308197_10241996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 636 | Open in IMG/M |
| 3300031093|Ga0308197_10456286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 514 | Open in IMG/M |
| 3300031096|Ga0308193_1078349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 539 | Open in IMG/M |
| 3300031231|Ga0170824_105472967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 680 | Open in IMG/M |
| 3300031231|Ga0170824_118986749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 538 | Open in IMG/M |
| 3300031446|Ga0170820_10247526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 666 | Open in IMG/M |
| 3300031999|Ga0315274_10952774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 885 | Open in IMG/M |
| 3300032515|Ga0348332_10060815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 587 | Open in IMG/M |
| 3300032515|Ga0348332_13120970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 501 | Open in IMG/M |
| 3300032770|Ga0335085_10004331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 23658 | Open in IMG/M |
| 3300032770|Ga0335085_10047920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5802 | Open in IMG/M |
| 3300032770|Ga0335085_11990693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 590 | Open in IMG/M |
| 3300032783|Ga0335079_10236084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2016 | Open in IMG/M |
| 3300032783|Ga0335079_10284136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1810 | Open in IMG/M |
| 3300032805|Ga0335078_10072858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5015 | Open in IMG/M |
| 3300032895|Ga0335074_10052254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5620 | Open in IMG/M |
| 3300032898|Ga0335072_10178486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2554 | Open in IMG/M |
| 3300033134|Ga0335073_11077187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 822 | Open in IMG/M |
| 3300033134|Ga0335073_11156312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 782 | Open in IMG/M |
| 3300033158|Ga0335077_11783080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 6.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 5.11% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 3.98% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 3.41% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.41% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.27% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.27% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.70% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.57% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.57% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.57% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.57% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.57% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003938 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011029 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 32 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011064 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 2 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019229 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019230 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_06147590 | 2170459013 | Grass Soil | MFDSLADRIREDEHKEVTNTERYIRWAAVVVISIVLFGACIWASGS |
| soilH1_102013102 | 3300003321 | Sugarcane Root And Bulk Soil | MFDSLADRIREDEHKEVNNTERIVRWVVIAVSSVVIFGGLYYGVRMLG* |
| Ga0063230_111069493 | 3300003938 | Wetland | RIREDEHKEVSTTERTIRWVAYVVLAFLAFGGLYYGVRMLE* |
| Ga0058900_13202971 | 3300004099 | Forest Soil | SMFDSLADRIREDEHKEVNTRERMFRWALIVVVSVVMFGGLYYAVRMLE* |
| Ga0058900_14224481 | 3300004099 | Forest Soil | GGSMFDSLADRIREDEHKEVKNSERILRWLAITVVSIVLFGGLYYGVRMIE* |
| Ga0058904_10088331 | 3300004100 | Forest Soil | MFDSLADRIREDEHKEVKNSERILRWLAITVVSIVLFGGLYYGVRMIE* |
| Ga0058901_15340641 | 3300004120 | Forest Soil | IGEVSMFDSLADRIREDEHKEVKNSERILRWVAIAVVSVVLFGGLYYGVRMIE* |
| Ga0058883_15072082 | 3300004137 | Forest Soil | SMFDSLADRIREDEHKEVKNSERILRWVAIAVVSVVLFGGLYYGVRMIE* |
| Ga0058897_110583971 | 3300004139 | Forest Soil | IGEVSMFDSLADRIREDEHKEVKNSERILRWLAITVVSIVLFGGLYYGVRMIE* |
| Ga0058897_111568001 | 3300004139 | Forest Soil | IREDEHKEVNNTERILRWVAITVVSIVVFGGLYYGVRMIE* |
| Ga0068977_12557042 | 3300004468 | Peatlands Soil | SMFDSLADRIREDEHNEENSTTRAIRWVVTALIAVLLFGGLYYGVRMLG* |
| Ga0068966_14410732 | 3300004476 | Peatlands Soil | EVSMFDSLADRIREDEHNEENSTTRAIRWVVTALIAVLLFGGLYYGVRMLG* |
| Ga0068962_11776001 | 3300004606 | Peatlands Soil | VSMFDSLADRIREDEHREVKNSERILRWLAITVVSIVLFGGLYYGVRMIE* |
| Ga0058899_116701512 | 3300004631 | Forest Soil | MFDSLADRIREDEHKEVNQTERIVRWLVVALLSILIFGGLYMGIRMLE* |
| Ga0058899_120250592 | 3300004631 | Forest Soil | MFDSLADRIREDEHKEVTSSERILRWVAITVVSIVLFGGLYYGVRLME* |
| Ga0058899_121109251 | 3300004631 | Forest Soil | SMFDSLADRIREDEHKEVKNSERILRWLAITVVSIVLFGGLYYGVRMIE* |
| Ga0058899_121616302 | 3300004631 | Forest Soil | MFDSLADRIREDEHKEVKNSERILRWVAIAVVSVVLFGGLYYGVRMIE* |
| Ga0058899_122292831 | 3300004631 | Forest Soil | MFDSLADRIREDEHKEVNTRERMFRWALIVVVSVVMFGGLYYAVRMLE* |
| Ga0058859_100321511 | 3300004798 | Host-Associated | MFDSLADRIRQDEHNEVKPTERVLRWVAVGLISVALFGGLYYGVRLLG* |
| Ga0058859_105222572 | 3300004798 | Host-Associated | MFDSLADRIRADEHREVDNKERIIRYLAIVVLSVLLFGGLYYGVRMME* |
| Ga0058863_119269752 | 3300004799 | Host-Associated | DSLADRIRQDDHAEVNNTERIVRYLIVLVVAVLLFGGLYYGVKMLD* |
| Ga0058861_100186861 | 3300004800 | Host-Associated | FTAYESRFFHNGLLGGFMFDSLADRIREDEHRDVGSKERAFRYVAIVVLSVLLFGGLYFGVRMLE* |
| Ga0058860_116752522 | 3300004801 | Host-Associated | RVLTSQEVNMFDSLADRIRQDEHAEVSNKERLVRYLAIVVVSCLLFGGLYYGVRMLEG* |
| Ga0058862_100418642 | 3300004803 | Host-Associated | NRSEHSDFTAYESRFFHNGLLGGFMFDSLADRIREDEHRDVGSKERAFRYVAIVVLSVLLFGGLYFGVRMLE* |
| Ga0058862_120319952 | 3300004803 | Host-Associated | DSLADRIREDEHRDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMVE* |
| Ga0066388_1048190582 | 3300005332 | Tropical Forest Soil | MFDSLADRIKQDEHQSVNNTERMIRWIIVAVVSVLAFGGLYYAVRMFEG* |
| Ga0068869_1003720552 | 3300005334 | Miscanthus Rhizosphere | MFDSLADRIREDEHKEVNNTERIVRWVVIAVTSVVIFGGLYYGVRMLG* |
| Ga0070667_1012813482 | 3300005367 | Switchgrass Rhizosphere | MFDSLADRIREDEHKDVGNKERIIRYLAIVVLSVLLFGGLYYGVRMME* |
| Ga0070711_1017832432 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDSLADRIREDEHKEVKTTERILRWVAVAVVSVALFGGLYYGVKMLG* |
| Ga0070738_100139034 | 3300005531 | Surface Soil | MFESLADRIREDEQREINRTERIVRWVVIAGISIVLFGGLYFGIRMLGA* |
| Ga0070739_100559732 | 3300005532 | Surface Soil | MFESLADRIREDEQREINRTERIVRWVVIAGVSIVLFGGLYFGIRMLGA* |
| Ga0070665_1010396512 | 3300005548 | Switchgrass Rhizosphere | MFDSLADRIREDEHRDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMVE* |
| Ga0066702_106271622 | 3300005575 | Soil | MFDSLADRIREDEHKEETSTARMVRWLVTAVVAFLLFGGLYYGVRMLG* |
| Ga0068857_1013811102 | 3300005577 | Corn Rhizosphere | MFDSLADRIREDEHKEVKTTERILRWVAVAVVSVALFGGLYYGV |
| Ga0066706_107735881 | 3300005598 | Soil | MFDSLADRIREDEHKEVNTTERVIRWVVIVVLSVVIFGGLYYGVRMLD* |
| Ga0068863_1020231721 | 3300005841 | Switchgrass Rhizosphere | MFDSLADRIREDEHKEVKTTERVLRWVAVAVVSVALFGGLYYGVKMLG* |
| Ga0066788_100036452 | 3300005944 | Soil | MFDSLADRIREDEHKEVNSTERYIRWAAVIVLSLVVFGGLYMGVHLLE* |
| Ga0070717_114322592 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QSMFDSLADRIREDEHKEVNTKERMFRYVLIAVVSVVLFGGLYYAVRMFD* |
| Ga0075030_1012131331 | 3300006162 | Watersheds | EDEHKEVKTTERILTWVAIAVVSIVLFGGLYYGVRMME* |
| Ga0097621_1015277262 | 3300006237 | Miscanthus Rhizosphere | MFDSLADRIREDEHKEVKTTERVLRWVAVAVVSVALFGGLYYG |
| Ga0079220_115314102 | 3300006806 | Agricultural Soil | MFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME* |
| Ga0063829_14815372 | 3300006860 | Peatlands Soil | MFDSLADRIREDEHNEENSTTRAIRWVVTALIAVLLFGGLYYGVRMLG* |
| Ga0063777_15063682 | 3300006861 | Peatlands Soil | REDEHKEVKNSERILRWLAIAVVSVVLFGGLYYGVRMIE* |
| Ga0105242_129844821 | 3300009176 | Miscanthus Rhizosphere | MFDSLADRIREDEHKEVKTTERVLRWVAVAVVSVALFGGLYY |
| Ga0116214_13588921 | 3300009520 | Peatlands Soil | MFDSLADRIREDEHREVKNSERILRWLAITVVSIVLFGGLYYGVRMIE* |
| Ga0116222_10606341 | 3300009521 | Peatlands Soil | MFDSLTDRIREDDHQEVNSTERMVRWVLIAVLSLILFGGLYYG |
| Ga0116222_11214211 | 3300009521 | Peatlands Soil | FRRFPMFDSLPGRIREDDHQGVNSTERMVRWVLIPVLSLILFGGLYYGVRMLE* |
| Ga0116219_100771434 | 3300009824 | Peatlands Soil | RIREDEHNEENSTTRAIRWVVTALIAVLLFGGLYYGVRMLG* |
| Ga0126373_116427761 | 3300010048 | Tropical Forest Soil | SLADRIREDEHNTVNRTERLVRWVVLAVLSVLLFGGLYFGIRMLEG* |
| Ga0126379_113846931 | 3300010366 | Tropical Forest Soil | MFDSLAERIREDEHREVNTTERIIRWIVVAVLTVLIFGGLYYGVQMLEG* |
| Ga0136449_1009910131 | 3300010379 | Peatlands Soil | MFDSLADRIREDEHKEVKNSERILRWLAIAVVSVVLFGGLYYGVRMIE* |
| Ga0134127_110455371 | 3300010399 | Terrestrial Soil | MFDSLADRIREDTHKEENTSERITRWVVIAVISAGIFGVIYVGYRLLA* |
| Ga0134122_117422341 | 3300010400 | Terrestrial Soil | IREDDHKEVNNTERIVRWVVIAVTSVVIFGGLYYGVRMLG* |
| Ga0134123_104495013 | 3300010403 | Terrestrial Soil | MFDSLADRIREDEHKEVNTTERIIRRVVIVVVSVAVFGGLYYGVRMMQ* |
| Ga0138551_1063141 | 3300011029 | Peatlands Soil | MFDILADRVREDEHNEVNSTERAIRWVAIAVISVLLFGGLYYGVRMLG* |
| Ga0138525_11345821 | 3300011064 | Peatlands Soil | EVSMFDSLADRIREDEHKEVKNSERILRWLAIAVVSVVLFGGLYYGVRMIE* |
| Ga0138565_10476231 | 3300011078 | Peatlands Soil | EVSMFDSLADRIREDEHREVKNSERILRWLAITVVSIVLFGGLYYGVRMIE* |
| Ga0138565_11623232 | 3300011078 | Peatlands Soil | MFDSLADRIREDEHNEENSTTRVIRWVVTALIAVLLFGGLYYGVRMLG* |
| Ga0138569_10863362 | 3300011079 | Peatlands Soil | VSMFDSLADRIREDEHNEENSTTRAIRWVVTALIAVLLFGGLYYGVRMLG* |
| Ga0138576_12920541 | 3300011088 | Peatlands Soil | VSMFDSLADRIREDEHKEVKNSERILRWLAIAVVSVVLFGGLYYGVRMIE* |
| Ga0150983_107812162 | 3300011120 | Forest Soil | SVFIWPFRLGRVSMFDSLADRIREDEHKEVKSTERILRWVAITVISIVFFGGLYYGVRLME* |
| Ga0150983_126523012 | 3300011120 | Forest Soil | MFDSLADRIREDEHKEEDATTRAIRWVVTAVVAVLLFGGLYYGVRMLG* |
| Ga0150983_130871261 | 3300011120 | Forest Soil | EVSMFDSLADRIKEDEHKEVTTSERILRWVAITVVSIVLFGGLYYGVRMME* |
| Ga0150983_131108292 | 3300011120 | Forest Soil | REDEHKEVNSTERIIRWVAIAVISVAVFGGLYYGVRMLG* |
| Ga0150983_138951431 | 3300011120 | Forest Soil | SLADRIREDEHKEVKNTERIIRWVAITVVSIVLFGGLYYGVRMME* |
| Ga0150983_141221441 | 3300011120 | Forest Soil | MFDSLADRIREDEHRSINNTERVIRWVVITVVSVAIFGGIYYGVRLLE* |
| Ga0150983_153393412 | 3300011120 | Forest Soil | AFYRRSQSMFDSLADRIREDEHKEVNTRERMFRWALIVVVSVVMFGGLYYAVRMLE* |
| Ga0150983_159428011 | 3300011120 | Forest Soil | DRIREDEHKEVNNTERIIRWVAITVVSIVLFGGLYYGVRMME* |
| Ga0150983_162932881 | 3300011120 | Forest Soil | MFDSLADRIREDEHKEVKSTERILRWVAITLVSIVLFGGLYYGVRMME* |
| Ga0150983_163300832 | 3300011120 | Forest Soil | MFDSLADRIREDEHKEVTSSERILRWVAITVVSIVLFGRLYYGVRLME* |
| Ga0126317_105850152 | 3300011332 | Soil | FHKGLLGGFMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME* |
| Ga0126317_105962931 | 3300011332 | Soil | STVLYRPVRRYPMFDSLADQIRADEHKAVNTTERIIRGVVIAVVSIVVFGGLYYGVSMLQ |
| Ga0126317_106613622 | 3300011332 | Soil | GLLGGLSMFESLADRIREDEHKEVNTTERVIRWALMLVITSGVLGGLYYGIRMVE* |
| Ga0151652_111810273 | 3300011340 | Wetland | EGRMFDSLSDRIREDEHKEETTKARVIRWVVTGVAALLLFGGLYMGVRMLE* |
| Ga0151652_119509152 | 3300011340 | Wetland | IREDEHKEESTRARLIRWAVTGVAALLVFGGLYMGVRMLG* |
| Ga0151652_125502912 | 3300011340 | Wetland | MFDSLADRIREDEQKEVNSKERAVRYVAVAVLTLLLFGGLYYGVRMLQ* |
| Ga0151652_129966741 | 3300011340 | Wetland | SDRIREDEQKEESSTARWIRWAVTGVAALLLFGGLYMGVRMLE* |
| Ga0151652_134417562 | 3300011340 | Wetland | MFDSLSDRIREDEHKEVSTTERTIRWVAYVVLAFLAFGGLYYGVRMLE* |
| Ga0150985_1016105702 | 3300012212 | Avena Fatua Rhizosphere | MFDSLADRIRQDEHNEVSNNERIVRYVAVLVISLLLFGGLYFGVRMLEG* |
| Ga0150985_1061330401 | 3300012212 | Avena Fatua Rhizosphere | MFDSLADRIREDEHKEETSTARMVRWLITAVVALALFGGLYYGVRMLG* |
| Ga0150985_1066316282 | 3300012212 | Avena Fatua Rhizosphere | FMFDSLADRIREDEHRDVDSKERIIRYVAIVVLSILLFGGLYFGVRMME* |
| Ga0150985_1086228722 | 3300012212 | Avena Fatua Rhizosphere | PMFDSLADKIREDEHNEVKPTERIIRWVAIAVVSVALFGGLYYGVRMLG* |
| Ga0150985_1115700982 | 3300012212 | Avena Fatua Rhizosphere | EVSMFDSLADRIKEDEHKEVNRTQRIIQWVAITVVSFVLFGGLYYGVRMME* |
| Ga0150985_1139038282 | 3300012212 | Avena Fatua Rhizosphere | HKGLLGGFMFDSLADRIREDEHQAVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME* |
| Ga0150985_1149545241 | 3300012212 | Avena Fatua Rhizosphere | IRQDEHNEVNTTERVVKWIAIAVISVVLFGGLYLGVRMLEG* |
| Ga0150985_1162905972 | 3300012212 | Avena Fatua Rhizosphere | MFDSLADRIREDDHKEVTQTQRIIQWTVVGVLSVLIFVGIYMGVRMLE* |
| Ga0150985_1167254693 | 3300012212 | Avena Fatua Rhizosphere | MFDSLADRIREDEHKEVNTTERVVRGVVIAVASVVFFGALYYGVRMLQ* |
| Ga0150985_1225290551 | 3300012212 | Avena Fatua Rhizosphere | GLLGGFMFDSLADRIREDEHKDVGNKERLIRYLAIVVLSVLLFGGLYFGVRMME* |
| Ga0150985_1226420942 | 3300012212 | Avena Fatua Rhizosphere | MFDSLADRIREDEHNEVKTTERILRWVAVAVVSVVLFGGLYYGVKMLG* |
| Ga0150984_1004538101 | 3300012469 | Avena Fatua Rhizosphere | GGLMFDSLADRIREDEHREVDNKERMIRYLVIVILSVVLFGGLYYGVRMME* |
| Ga0150984_1016894562 | 3300012469 | Avena Fatua Rhizosphere | CFHKGLLGGFMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME* |
| Ga0150984_1055926121 | 3300012469 | Avena Fatua Rhizosphere | SMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMVE* |
| Ga0150984_1069757292 | 3300012469 | Avena Fatua Rhizosphere | MFDSLADRIREDEHKDVGNKERLIRYLAIVVLSVLLFGGLYFGVRMME* |
| Ga0150984_1104468111 | 3300012469 | Avena Fatua Rhizosphere | MFDSLADRIRQDEHNEVSNNERIVRYVAVVVISLLLFGGLYFGVRMLEG* |
| Ga0150984_1117681212 | 3300012469 | Avena Fatua Rhizosphere | LADRIRQDEPQKTTERIIRWVAVAVVSVALFGGLYYGVKMLG* |
| Ga0137373_104769821 | 3300012532 | Vadose Zone Soil | MFDSLADRMKEDDNREVNSTERIIRWAAVILLSVLLFSGLYYGVRMLE* |
| Ga0157378_104077713 | 3300013297 | Miscanthus Rhizosphere | MFDSLADRIKEDAHKEVNTKERMFRWALIVVVSVVAVAVQNYAVRMME* |
| Ga0157378_115166071 | 3300013297 | Miscanthus Rhizosphere | MFDSLADRIREDEHKEVNTTERVIRWVAIAVISVALFGGLYYGVRML |
| Ga0157378_119439182 | 3300013297 | Miscanthus Rhizosphere | FMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME* |
| Ga0132258_105077611 | 3300015371 | Arabidopsis Rhizosphere | MFDSLADRIREDEHRDVGNRERIIRYLAITILSVLLFGGLYFGVRMME* |
| Ga0181505_100579121 | 3300016750 | Peatland | FDSLADRIREDEHKEVKSTERILRWVAITLVSVVLFGGLYYGVRMME |
| Ga0187818_101828522 | 3300017823 | Freshwater Sediment | MFDSLADRIREDEHNEENSTTRAIRWVVTALIAVLLFGGLYYG |
| Ga0187803_100284912 | 3300017934 | Freshwater Sediment | MFDSLADRIREDEHNEENSTTRAIRWVVTALIAVLLFGGLYYGVRMLG |
| Ga0187783_101014032 | 3300017970 | Tropical Peatland | MFDSLSDQIREDEHKQVNQTERIVRWVVVGVLSIVLFGGLYMGIRLLQ |
| Ga0187783_108577512 | 3300017970 | Tropical Peatland | MFDSLTDRIREDEHKEVNQTERVVRWLVVAVLSILIFGGLYMGIRMLE |
| Ga0187781_100693012 | 3300017972 | Tropical Peatland | MFDSLTDQIREDEHKQVDQTERIVRWVVVGVLSIVLFGGLYMGIRLLQ |
| Ga0187781_103712542 | 3300017972 | Tropical Peatland | MFDSLSDRIREDEHKEVNTTERMLRLVLIAVVSVVLFGGLYYAVRMIE |
| Ga0066662_100736973 | 3300018468 | Grasslands Soil | MFESLADRIREDDHKEVNNTERVIRWVVVAVVSVLLFSGLYFGVRMLEG |
| Ga0190274_131673082 | 3300018476 | Soil | MFDSLADQIRADEHKAVNTKERIIRAVVIAVVSVVLFGGLYYGVSMME |
| Ga0180116_12825912 | 3300019229 | Groundwater Sediment | GTMFDSLADRIREDEHKEVNNTERAIRWLVIAVVSVAIFGGLYYGVRMMQ |
| Ga0181501_11417531 | 3300019230 | Peatland | EKFQEVPMFDSLADRIREDERKEANPTERIVRWVVIAMVSIVFFGGLYYGVRMLQG |
| Ga0180117_11052162 | 3300019248 | Groundwater Sediment | MFDSLADRIREDEHKEVNNTERAIRWLVIAVVSVAIFGGLYYGVRMMQ |
| Ga0187800_15205481 | 3300019278 | Peatland | MFDSLTDQIRADEHKEVNQTERVVRWVVVGVLSILLFGGLYMGIRLIE |
| Ga0184649_15129233 | 3300020068 | Groundwater Sediment | MFESLADRMRADDHAEVKNTERVVRWIAVVVLSVLLFGGLYFGVRMLE |
| Ga0197907_105787162 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | HKGLLGGFMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME |
| Ga0197907_106075242 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME |
| Ga0206356_100543621 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | NTLFLGGSMFDSLADRIRQDDHAEVKNTERIVRYLIVLVVAALLFGGLYYGVKMLD |
| Ga0206356_112798382 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | FMFDSLADRIRADEHREVDNKERIIRYLAIVVLSVLLFGGLYYGVRMME |
| Ga0206356_113042232 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDSLADRIREDEHKEVKTTERVLRWVAVAVVSVALFGGLYYGVKMLG |
| Ga0206349_11420902 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | DSLADRIRQDDHAEVNNTERIIRYLIVLVVAVLLFGGLYYGVKMLD |
| Ga0206352_111949181 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDSLADRIREDEHKEVNTKERMFRYVLIAVVSVVLFGGLYYAVRMFD |
| Ga0206354_110301341 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | FRLIFILRCHKGLLGGFMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME |
| Ga0210383_102173282 | 3300021407 | Soil | MFDSLADRIREDEHKEVKNSERILRWVAIAVVSVVLFGGLYYGVRMIE |
| Ga0213853_104738842 | 3300021861 | Watersheds | MFDSLADRIREDEHKEVKSTERILRWVAITVVSFVLFGGLYYGVRMME |
| Ga0224712_106607371 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | YRNPWEVCMFDSLADRIRQDEHAEVNNTERIIRYLVVFLLAMLLFGGLYYGVKMLD |
| Ga0242645_10228542 | 3300022501 | Soil | MFDSLADRIREDDHKEVNQTERILRWVLVAVLSVLIFGGLYMGIRMLE |
| Ga0242642_10283012 | 3300022504 | Soil | MFDSLADRIREDEHKEVKNSERILRWLAITVVSIVLFGGLYYGVRMIE |
| Ga0242649_10797351 | 3300022509 | Soil | EVSMFDSLADRIREDEHKEVNQTERIVRWLVVAVLSILIFGGLYMGIRMLE |
| Ga0242656_11315252 | 3300022525 | Soil | FDSLADRIREDEHRSINNTERVIRWVVITVVSVAIFGGIYYGVRLLE |
| Ga0242656_11423852 | 3300022525 | Soil | VSMFDSLADRIREDEHKEVKNSERILRWLAITVVSIVLFGGLYYGVRMIE |
| Ga0242664_11429382 | 3300022527 | Soil | DSLADRIREDEHKEVNSTERVIRWVVIAVVSVVVFGGLYYGVRMLG |
| Ga0242660_10690602 | 3300022531 | Soil | MFDSLADRIREDEHRSINKTERVIRWVVITVVSVAIFGGIYYGVRLLE |
| Ga0242655_101702481 | 3300022532 | Soil | SLADRIREDEHKEVKNTERIIRWVAITVVSIVLFGGLYYGVRMME |
| Ga0242674_10692891 | 3300022711 | Soil | SMFDSLADRIREDEHKEVNQTERIVRWLVVALLSILIFGGLYMGIRMLE |
| Ga0242661_11025862 | 3300022717 | Soil | FDSLADRIREDERKEVKNSERILRWVAITVVSIVLFGGLYYGVRMIE |
| Ga0242675_11187042 | 3300022718 | Soil | MFECLADRIREDEHKEVNSTERAIRWVAIAVISVALFGGLYYGVRMLG |
| Ga0242665_103414601 | 3300022724 | Soil | EVSMFDRLADRIREDEHKEVKNTERILRWVAITVVSIVLFGGLYYGVRMME |
| Ga0242654_104479642 | 3300022726 | Soil | EVSMFDSLADRIREDEHRSINNTERVIRWVVITVVSVAIFGGIYYGVRLLE |
| Ga0207689_108431611 | 3300025942 | Miscanthus Rhizosphere | MFDSLADRIREDEHKEVNNTERIVRWVVIAVTSVVIFGGLYYGVRMLG |
| Ga0207651_111772501 | 3300025960 | Switchgrass Rhizosphere | MFDSLADRIREDEHKDVGNKERIIRYLAIVVLSVLLFGGL |
| Ga0207702_109899002 | 3300026078 | Corn Rhizosphere | MFDSLADRIRQDEQQNTTERYLRWAVVAVVSVVLFG |
| Ga0209849_10122241 | 3300026215 | Soil | MFDSLADRIREDEHKEVNSTERYIRWAAVIVLSLVVFGGLYMGVHLLE |
| Ga0209581_10160945 | 3300027706 | Surface Soil | MFESLADRIREDEQREINRTERIVRWVVIAGISIVLFGGLYFGIRMLGA |
| Ga0209810_10917741 | 3300027773 | Surface Soil | MFESLADRIREDEQREINRTERIVRWVVIAGVSIVLFGGLYFGIRMLGA |
| Ga0209517_101048212 | 3300027854 | Peatlands Soil | MFDSLADRIREDEHQGTNTTQRVIQWVAIAVISILLFGG |
| Ga0268266_110374002 | 3300028379 | Switchgrass Rhizosphere | MFDSLADRIREDEHRDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMVE |
| Ga0310039_101624882 | 3300030706 | Peatlands Soil | MFDSLADRVREDEHNEVNSTERAIRWVAIAVISVLLFGGLYYGVRMLG |
| Ga0308203_10704311 | 3300030829 | Soil | IFFWHFKEVPMFDSLADRIREDEHKEVNNTERIVRWVVIAVTSVVIFGGLYYGVRMLG |
| Ga0308202_10991752 | 3300030902 | Soil | FMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME |
| Ga0308200_10707401 | 3300030905 | Soil | GGSMFDSLADRIREDEHKDVGNKERIIRYLAIVVLSFLLFGGLYFGVRMME |
| Ga0308200_10865432 | 3300030905 | Soil | LLGGFMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME |
| Ga0308200_11480611 | 3300030905 | Soil | MFDSLADRIRQDEHAEVSNKERMVRYLAIVVVSCLLFGGLYYGVRMLEG |
| Ga0308189_101568362 | 3300031058 | Soil | DLYVATHNGLLGGSMFDSLADRIREDEHKDVGNKERIIRYLAIVVLSFLLFGGLYFGVRMME |
| Ga0308189_102953512 | 3300031058 | Soil | SMFDSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMVE |
| Ga0308201_102974021 | 3300031091 | Soil | ITTHNGLLGGSMFDSLADRIREDEHKDVGNKERIIRYLAIVVLSFLLFGGLYFGVRMME |
| Ga0308197_102419962 | 3300031093 | Soil | SMFDSLADRIREDEHKDVGNKERIIRYLAIVVLSFLLFGGLYFGVRMME |
| Ga0308197_104562862 | 3300031093 | Soil | FDSLADRIKEDEHQAVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME |
| Ga0308193_10783491 | 3300031096 | Soil | DSLADRIREDEHKDVGNKERVIRYLAIVVLSVLLFGGLYFGVRMME |
| Ga0170824_1054729672 | 3300031231 | Forest Soil | TFDSLADRIREDEHKEVKTSERILRWVAITVISIVLFGGLYYGVRMME |
| Ga0170824_1189867492 | 3300031231 | Forest Soil | LADRIREDEHKEVNTTERVLRWVAIVVISIVLFGGLYYGVRMME |
| Ga0170820_102475262 | 3300031446 | Forest Soil | LADRIREDEHKEVKTSERILRWVAITVISIVLFGGLYYGVRMME |
| Ga0315274_109527741 | 3300031999 | Sediment | MFDNLGDRIREDDHKEVSRSERVIRLAAIIVVLSILLFGGLFFGIRMLE |
| Ga0348332_100608151 | 3300032515 | Plant Litter | EVSMFDSLADRIREDEHKEVKSTERILRWVAITFVSVVLFGGLYYGVRMME |
| Ga0348332_131209702 | 3300032515 | Plant Litter | FDSLADRIREDEHKEVKNSERILRWLAIAVVSVVLFGGLYYGVRMIE |
| Ga0335085_100043318 | 3300032770 | Soil | MFDSLTDRIREDDHKEVNQTERVIRWVVVAVLSILIFGGLYMGIRLLE |
| Ga0335085_100479206 | 3300032770 | Soil | MFDSLADRIREDDQKESNSTERIVRWVIVVVVSVVVFGGIYWGMHLLQG |
| Ga0335085_119906931 | 3300032770 | Soil | MFDSLADRIREDEHKEVGSKERIIRYVAIAVLSILLFGGLYFGVRMIE |
| Ga0335079_102360841 | 3300032783 | Soil | MFDSLADRIKEDEQKEVDTKHRIVQWVAIAVVSVVLFGGLYYGIRMLE |
| Ga0335079_102841361 | 3300032783 | Soil | MFDSLADRIREDERTGESRTVLIVRWLAVAVLSILLFGGLYYGVRMLE |
| Ga0335078_100728586 | 3300032805 | Soil | MFDSLTDRIREDEHKEVNQTERVVRWVVVAVLSILIFGGLYMGIRMLE |
| Ga0335074_100522542 | 3300032895 | Soil | MFDSLADKIREDEHKEVNQTERIVRWVVVALLSIVLFGGLYMGIRMIQ |
| Ga0335072_101784863 | 3300032898 | Soil | MFDSLADRIRADDQKESNSTERIVRWVIVVVVSVVVFGGIYWGMHLLQG |
| Ga0335084_102148401 | 3300033004 | Soil | MFDSLADRIKADDHQEVNTTERVIRYVAVAVLSVLLFGGLYFGVRMLQ |
| Ga0335073_110771872 | 3300033134 | Soil | MFDSLTDRIREDEHKEVNQTERIIRWAVVAVLSIVIFGGLYLGIRMLE |
| Ga0335073_111563122 | 3300033134 | Soil | MFDSLADKIREDDHKEVNQTERVIRWVVVALLSIVLFGGLYMGIRLLQ |
| Ga0335077_117830801 | 3300033158 | Soil | MFDSLADRIREDDHKEVNQTERVVRWVVVGVASIVIFGGLYMGIRLLQ |
| ⦗Top⦘ |