NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033830

Metagenome / Metatranscriptome Family F033830

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033830
Family Type Metagenome / Metatranscriptome
Number of Sequences 176
Average Sequence Length 46 residues
Representative Sequence MPKANLGDVEIYYEEKGQGEAVLLAPPSWWPSDTWNVGVVPFLSKR
Number of Associated Samples 160
Number of Associated Scaffolds 176

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.45 %
% of genes near scaffold ends (potentially truncated) 99.43 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 156
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.864 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.523 % of family members)
Environment Ontology (ENVO) Unclassified
(32.955 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.523 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.11%    β-sheet: 10.81%    Coil/Unstructured: 81.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 176 Family Scaffolds
PF02515CoA_transf_3 11.36
PF09084NMT1 11.36
PF03070TENA_THI-4 6.25
PF06041DUF924 3.98
PF14518Haem_oxygenas_2 3.41
PF00561Abhydrolase_1 3.41
PF04828GFA 2.84
PF12697Abhydrolase_6 2.27
PF01717Meth_synt_2 1.70
PF00691OmpA 1.70
PF05534HicB 1.14
PF13193AMP-binding_C 1.14
PF02518HATPase_c 1.14
PF13620CarboxypepD_reg 1.14
PF16868NMT1_3 1.14
PF00293NUDIX 0.57
PF02371Transposase_20 0.57
PF028262-Hacid_dh_C 0.57
PF01740STAS 0.57
PF06808DctM 0.57
PF12146Hydrolase_4 0.57
PF00528BPD_transp_1 0.57
PF02452PemK_toxin 0.57
PF08402TOBE_2 0.57
PF01797Y1_Tnp 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 176 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 11.36
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 11.36
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 11.36
COG3803Uncharacterized conserved protein, DUF924 familyFunction unknown [S] 3.98
COG3791Uncharacterized conserved proteinFunction unknown [S] 2.84
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.70
COG1598Antitoxin component HicB of the HicAB toxin-antitoxin systemDefense mechanisms [V] 1.14
COG4226Predicted nuclease of the RNAse H fold, HicB familyGeneral function prediction only [R] 1.14
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.57
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.57
COG3547TransposaseMobilome: prophages, transposons [X] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.86 %
UnclassifiedrootN/A1.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2209111006|2214775819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium779Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101120099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300000550|F24TB_10348125All Organisms → cellular organisms → Bacteria → Proteobacteria857Open in IMG/M
3300000789|JGI1027J11758_12989538All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10115156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria563Open in IMG/M
3300002407|C687J29651_10079564All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300003999|Ga0055469_10008609All Organisms → cellular organisms → Bacteria1998Open in IMG/M
3300004052|Ga0055490_10292718All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300004114|Ga0062593_101693766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria690Open in IMG/M
3300004266|Ga0055457_10212937All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300004267|Ga0066396_10011789All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300004463|Ga0063356_105774468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300004778|Ga0062383_10576413All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium569Open in IMG/M
3300004782|Ga0062382_10209400All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium856Open in IMG/M
3300004808|Ga0062381_10207453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300005294|Ga0065705_11079935All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005295|Ga0065707_10450385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium801Open in IMG/M
3300005327|Ga0070658_10341391All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300005332|Ga0066388_104594012All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300005337|Ga0070682_100227745All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300005366|Ga0070659_101159256All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005444|Ga0070694_101275656All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005447|Ga0066689_10746318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300005450|Ga0066682_10057045All Organisms → cellular organisms → Bacteria2383Open in IMG/M
3300005455|Ga0070663_101422763All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005468|Ga0070707_101651677All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005530|Ga0070679_101802518All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005536|Ga0070697_101390170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora hirsuta627Open in IMG/M
3300005617|Ga0068859_101128259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium863Open in IMG/M
3300005713|Ga0066905_101380187All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300005713|Ga0066905_101446295All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005764|Ga0066903_100686979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales1800Open in IMG/M
3300005878|Ga0075297_1013230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium825Open in IMG/M
3300005879|Ga0075295_1022602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium747Open in IMG/M
3300006031|Ga0066651_10438592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium694Open in IMG/M
3300006047|Ga0075024_100644525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300006049|Ga0075417_10056604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1707Open in IMG/M
3300006049|Ga0075417_10699254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300006354|Ga0075021_11129625All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300006755|Ga0079222_11850165All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006847|Ga0075431_100085509All Organisms → cellular organisms → Bacteria3255Open in IMG/M
3300006852|Ga0075433_10310181All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300006852|Ga0075433_11076029All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300006871|Ga0075434_101501051All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300006904|Ga0075424_102102888All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria595Open in IMG/M
3300009012|Ga0066710_100722770All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1520Open in IMG/M
3300009094|Ga0111539_11288736All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium848Open in IMG/M
3300009094|Ga0111539_11312187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria840Open in IMG/M
3300009100|Ga0075418_10674521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1114Open in IMG/M
3300009137|Ga0066709_103220808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria595Open in IMG/M
3300009147|Ga0114129_12153432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300009157|Ga0105092_10783813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria558Open in IMG/M
3300009162|Ga0075423_10037742All Organisms → cellular organisms → Bacteria4927Open in IMG/M
3300009171|Ga0105101_10549130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300009176|Ga0105242_11375735All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium732Open in IMG/M
3300009545|Ga0105237_10997442All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300009609|Ga0105347_1003996All Organisms → cellular organisms → Bacteria5474Open in IMG/M
3300009809|Ga0105089_1075505All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria563Open in IMG/M
3300010045|Ga0126311_11590012All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300010166|Ga0126306_11722683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300010326|Ga0134065_10029433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1603Open in IMG/M
3300010336|Ga0134071_10304604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300010358|Ga0126370_10126108All Organisms → cellular organisms → Bacteria1824Open in IMG/M
3300010359|Ga0126376_12023425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria618Open in IMG/M
3300010360|Ga0126372_11499923All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300010360|Ga0126372_12897650Not Available532Open in IMG/M
3300010361|Ga0126378_11234372All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300010371|Ga0134125_12860315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300010375|Ga0105239_10146576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2633Open in IMG/M
3300010391|Ga0136847_12665040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2072Open in IMG/M
3300010391|Ga0136847_12821067All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2488Open in IMG/M
3300011271|Ga0137393_10425486All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300011402|Ga0137356_1076750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300011439|Ga0137432_1255843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300011445|Ga0137427_10140832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria989Open in IMG/M
3300012199|Ga0137383_11198074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300012207|Ga0137381_10605785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium954Open in IMG/M
3300012226|Ga0137447_1050246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium752Open in IMG/M
3300012231|Ga0137465_1254353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300012354|Ga0137366_10238376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1351Open in IMG/M
3300012355|Ga0137369_10571029Not Available790Open in IMG/M
3300012474|Ga0157356_1025654All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300012496|Ga0157353_1033738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300012510|Ga0157316_1057732All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria554Open in IMG/M
3300012532|Ga0137373_10375803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1109Open in IMG/M
3300012532|Ga0137373_10553387All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium873Open in IMG/M
3300012923|Ga0137359_10073042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3001Open in IMG/M
3300012929|Ga0137404_10758370All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300012930|Ga0137407_10745205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium924Open in IMG/M
3300012931|Ga0153915_10647774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1218Open in IMG/M
3300012944|Ga0137410_10383435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1130Open in IMG/M
3300012944|Ga0137410_11651106All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012948|Ga0126375_11790764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300012975|Ga0134110_10014810All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2981Open in IMG/M
3300013102|Ga0157371_10594335All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium823Open in IMG/M
3300013297|Ga0157378_11088698All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300013308|Ga0157375_11782344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300014154|Ga0134075_10354662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium643Open in IMG/M
3300014157|Ga0134078_10302596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300014262|Ga0075301_1107851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria610Open in IMG/M
3300015255|Ga0180077_1024045All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300015256|Ga0180073_1126432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300015358|Ga0134089_10261257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium710Open in IMG/M
3300015359|Ga0134085_10019946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2549Open in IMG/M
3300015372|Ga0132256_100020912All Organisms → cellular organisms → Bacteria5810Open in IMG/M
3300016371|Ga0182034_10122039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1910Open in IMG/M
3300017654|Ga0134069_1301052All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300017944|Ga0187786_10135812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria872Open in IMG/M
3300018000|Ga0184604_10090905All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium929Open in IMG/M
3300018053|Ga0184626_10375047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300018056|Ga0184623_10006879All Organisms → cellular organisms → Bacteria4844Open in IMG/M
3300018056|Ga0184623_10346496All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria666Open in IMG/M
3300018056|Ga0184623_10513297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300018063|Ga0184637_10435490All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300018074|Ga0184640_10357182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria662Open in IMG/M
3300018074|Ga0184640_10426186All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300018075|Ga0184632_10110073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1209Open in IMG/M
3300018081|Ga0184625_10413203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300018084|Ga0184629_10089413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1489Open in IMG/M
3300018422|Ga0190265_12825687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria580Open in IMG/M
3300018469|Ga0190270_10737338All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria983Open in IMG/M
3300018469|Ga0190270_11249435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300019360|Ga0187894_10292051All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria756Open in IMG/M
3300020034|Ga0193753_10381118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300021063|Ga0206227_1027935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria962Open in IMG/M
3300021073|Ga0210378_10184323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300021081|Ga0210379_10056577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1573Open in IMG/M
3300021432|Ga0210384_10463417All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1141Open in IMG/M
3300021560|Ga0126371_11174725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium905Open in IMG/M
3300025160|Ga0209109_10448088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria595Open in IMG/M
3300025167|Ga0209642_10387872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria783Open in IMG/M
3300025289|Ga0209002_10082005All Organisms → cellular organisms → Bacteria2159Open in IMG/M
3300025313|Ga0209431_10981357All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria599Open in IMG/M
3300025313|Ga0209431_11093310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria555Open in IMG/M
3300025318|Ga0209519_10327528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria885Open in IMG/M
3300025319|Ga0209520_10587548All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria642Open in IMG/M
3300025325|Ga0209341_10161565All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300025791|Ga0210115_1021123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1475Open in IMG/M
3300025792|Ga0210143_1076881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300025912|Ga0207707_10493780All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300025936|Ga0207670_11260817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium626Open in IMG/M
3300025938|Ga0207704_10761887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria806Open in IMG/M
3300026045|Ga0208535_1013850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium763Open in IMG/M
3300026075|Ga0207708_11612655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300026089|Ga0207648_12120939All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300026111|Ga0208291_1075902All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300026116|Ga0207674_10648736All Organisms → cellular organisms → Bacteria1019Open in IMG/M
3300026307|Ga0209469_1003957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6498Open in IMG/M
3300026327|Ga0209266_1039149All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2432Open in IMG/M
3300026328|Ga0209802_1027755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3012Open in IMG/M
3300026329|Ga0209375_1008332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6621Open in IMG/M
3300027277|Ga0209846_1027194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria922Open in IMG/M
3300027654|Ga0209799_1100851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium655Open in IMG/M
3300027873|Ga0209814_10000509All Organisms → cellular organisms → Bacteria12826Open in IMG/M
3300027873|Ga0209814_10200031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium863Open in IMG/M
3300027886|Ga0209486_10802590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria616Open in IMG/M
3300027907|Ga0207428_10328157All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300027956|Ga0209820_1050727All Organisms → cellular organisms → Bacteria → Proteobacteria1096Open in IMG/M
3300029636|Ga0222749_10650731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300031720|Ga0307469_10623648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium967Open in IMG/M
3300031912|Ga0306921_12461170All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300031962|Ga0307479_10055473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3815Open in IMG/M
3300032005|Ga0307411_12148954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300032013|Ga0310906_10885315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300032144|Ga0315910_10116024All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1974Open in IMG/M
3300032180|Ga0307471_100008094All Organisms → cellular organisms → Bacteria6836Open in IMG/M
3300032180|Ga0307471_103852536All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria530Open in IMG/M
3300032421|Ga0310812_10171405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium931Open in IMG/M
3300032782|Ga0335082_10905226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria745Open in IMG/M
3300032828|Ga0335080_10905670All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300032828|Ga0335080_12015531All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria559Open in IMG/M
3300032829|Ga0335070_10816111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria867Open in IMG/M
3300033433|Ga0326726_10101497All Organisms → cellular organisms → Bacteria2575Open in IMG/M
3300034115|Ga0364945_0005918All Organisms → cellular organisms → Bacteria3213Open in IMG/M
3300034149|Ga0364929_0050655All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300034150|Ga0364933_202281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.11%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.41%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.27%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.70%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.70%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.70%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.70%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.70%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment1.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.14%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.14%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.14%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.14%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.14%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.14%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.14%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.14%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.14%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.14%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.57%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.57%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.57%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.57%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.57%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.57%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.57%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2209111006Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0Host-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004052Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004266Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025792Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026045Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026111Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
22137969482209111006Arabidopsis RhizosphereMPSAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVSVVPFLSKRYRTIIFDCR
INPhiseqgaiiFebDRAFT_10112009913300000364SoilMPKANLGDVEIYYEEQGKGEPILLAPASWWPSDTWNVTVVPFLSQSFKT
F24TB_1034812513300000550SoilMPKANLGDIEIYYEEQGQGEPILLAPASWWSLETW
JGI1027J11758_1298953823300000789SoilMPKANLGDVEIYYEEQGKGEPILLAPASWWPSXTWXVTVVPFLSXXFKT
AF_2010_repII_A001DRAFT_1011515623300000793Forest SoilMPTADLGDLRIYYETQGEGEAILLVPPSWWPSDTWNVG
C687J29651_1007956433300002407SoilMPTAALKDIELYYEEHGRGEPVLLVPPSWWPCDAWKVVVLSVVSQ
Ga0055469_1000860933300003999Natural And Restored WetlandsMPAAKIGDIDIYYEEQGQGEPVLLAPPSWWPCDTWKVGVVPFLSKRFRTILFDC
Ga0055490_1029271823300004052Natural And Restored WetlandsMAKANLGDVEIYYEEQGKGEPILLAPASWWPSDAWNVGVV
Ga0062593_10169376623300004114SoilMPAADLGEVTIYYESAGAGEAVLLCPPSWWPCDTWNVGVVPFLSQKFRTIIFDCRGTGYSSK
Ga0055457_1021293713300004266Natural And Restored WetlandsMPTAELGDVTIYYESQGTGDAVLLCPPSWWPCDTWNVGVVPFLA
Ga0066396_1001178913300004267Tropical Forest SoilMPTADLGDLKIYYETQGEGEAVLLVQPSWWPSDTWNVGVTQRLSQ
Ga0063356_10577446813300004463Arabidopsis Thaliana RhizosphereMPTAKIGDVDIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVP
Ga0062383_1057641323300004778Wetland SedimentMPTANLADIEIYYEERGSGDTVLLCPPSWWPCDTWNVGVVPF
Ga0062382_1020940023300004782Wetland SedimentMPTANLADIEIYYEERGSGDTVLLCPPSWWPCDTWNVGVV
Ga0062381_1020745323300004808Wetland SedimentMATAKLADLEIYYEVQGNGEPVLLAPASWWPAATWNVGVVPFLSQRFKTIVF
Ga0065705_1107993513300005294Switchgrass RhizosphereMPKTNLGDIEIYYEERGQGESILLAPASWWPSDTWNVGVVP
Ga0065707_1045038513300005295Switchgrass RhizosphereMATATLNGVDTYYEVQGQGEPVLLVPASWWPSDTWNVGAVPFLSQRFKTIVFDCRGTG
Ga0070658_1034139113300005327Corn RhizosphereMPTALLNDVEVYYETEGNGETVLLVPPSWWPSDTWKVGVVP
Ga0066388_10459401223300005332Tropical Forest SoilVPKVNLRAIEIYYEEQGKGEPILLVPASWWPSDTWNVSVVPFLSKRFTTIT
Ga0070682_10022774523300005337Corn RhizosphereMPTALLNDVELYCETEGNGEPVLLVPPSWWPSATWKVGVVPALSKRYR
Ga0070659_10115925613300005366Corn RhizosphereMPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPALSKRYR
Ga0070694_10127565613300005444Corn, Switchgrass And Miscanthus RhizosphereMPTADLGDVKIYYESQGGGEAVLLCPPSWWPSDTWNVGVVPFLAKRFRTII
Ga0066689_1074631813300005447SoilMPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRF
Ga0066682_1005704533300005450SoilMPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTI
Ga0070663_10142276323300005455Corn RhizosphereMPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPAL
Ga0070707_10165167713300005468Corn, Switchgrass And Miscanthus RhizosphereVPKAQLAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPF
Ga0070679_10180251813300005530Corn RhizosphereMPTAKIGDVEIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVPFLSK
Ga0070697_10139017013300005536Corn, Switchgrass And Miscanthus RhizosphereMPTADLGDLKLYYETQGEGEAVLLVPPSWWPSDTWNVGVTQRLS
Ga0068859_10112825923300005617Switchgrass RhizosphereMPTAKIGDVEIYHEEQGQGEPVLLAPPSWWPSDTWKVGVVP
Ga0066905_10138018723300005713Tropical Forest SoilMPTADLGDLKIYYETHGEGEAILLVPPSWWPGDTWNVGVTQRLSQRYRT
Ga0066905_10144629523300005713Tropical Forest SoilMPKANLGDVEIYYEQRGKGEPILLVPASWWPSDTWNVAVVPFLSKRFTTI
Ga0066903_10068697913300005764Tropical Forest SoilMPTADLGDLKIYYETQGEGEAILLVPPSWWPSDTWN
Ga0075297_101323023300005878Rice Paddy SoilMPAAKIGDIDIYYEEQGQGEPVLLAPPSWWPCDTWKVGVVPFLSKR
Ga0075295_102260223300005879Rice Paddy SoilMPSGKIGDIDIYFEEHGGGEPILLAPPSWWPSDTWKVGVVPFLSKRYRTIIFDCR
Ga0066651_1043859223300006031SoilMTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVG
Ga0075024_10064452523300006047WatershedsMPTAKLAELELYYEVQGNGEPLLLAPASWWPSATWNVGVVPTLSKRFKTITFD
Ga0075417_1005660433300006049Populus RhizosphereMPTANLGDVSLCYEETGQGEPVLLVPPSWWPAATWNVGVVPVLSQRYRTIIFDC
Ga0075417_1069925423300006049Populus RhizosphereMPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWN
Ga0075021_1112962513300006354WatershedsVPLANLGDLQIYYEERGGGEVVLLGPPSWWPCDTWSVRVVPSLSSRYRTIIFDCRGTG
Ga0079222_1185016513300006755Agricultural SoilMPTALLNDVELYYETKGNGEAVLLVPPSWWPSDTWKIGVVPALSKRY
Ga0075431_10008550933300006847Populus RhizosphereMPTANLNDVQIYYEDSGEGEVVLLAPPSWWPCDTWKI
Ga0075433_1031018123300006852Populus RhizosphereMPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWK
Ga0075433_1107602913300006852Populus RhizosphereMPKAKIGEIEIYYEQRGSGEPVLLVPPSWWPSDTW
Ga0075434_10150105113300006871Populus RhizosphereMPTANLGDLKIYYETQGEGEAILLVPPSWWPSDTWNVG
Ga0075424_10210288813300006904Populus RhizosphereMPTADLGDLKIYYETQGEGEVILLVPPSWWPSDTW
Ga0066710_10072277033300009012Grasslands SoilMPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVP
Ga0111539_1128873613300009094Populus RhizosphereMPSVKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVSVVPFL
Ga0111539_1131218713300009094Populus RhizosphereMPTANLGDVQLYYEDSGEGEAVLLSQPSWWPCDTWKINV
Ga0075418_1067452133300009100Populus RhizosphereMAKATLNGVEIYYEAEGRGEAVLLVPASWWPSDTWN
Ga0066709_10322080813300009137Grasslands SoilMAKATLNGVEIYYETQGQGEPVLLVPASWWPSDTWNVGVVPFLSRRFKTIV
Ga0114129_1215343223300009147Populus RhizosphereMAKATLNGVEIYYEAEGRGEAMLLAPASWWPSDTWNVGVVPFLS
Ga0105092_1078381313300009157Freshwater SedimentMPTADLDDVKIYYESEGDGEPVLLAPPSWWPCDTWK
Ga0075423_1003774213300009162Populus RhizosphereMPKAKIGEIEIYYEQRGSGEPVLLVPPSWWPSDTWNVAVVPFLSKRYRSIIFD
Ga0105101_1054913013300009171Freshwater SedimentMPTAKIGEIEIHYEERGEGEPVLLAPPSWWPSDTWKVGVVPF
Ga0105242_1137573513300009176Miscanthus RhizosphereMPKEKLADLELYYEDHGSGEAVLLTPASWWPSDTWNVGVVPFLSRR
Ga0105237_1099744213300009545Corn RhizosphereMPTALLNDVEVYYETEGNGETVLLVPPSWWPSDTWKVGVVPALAKRYRTII
Ga0105347_100399673300009609SoilMPIANLGDVSLYYEGSGQGEPVLLVPPSWWPAATWNVGVVPALIQRYRAIIFDC
Ga0105089_107550523300009809Groundwater SandMPKAQIGEVEIYYEERGNGDPVLLVPPSWWPSDTWN
Ga0126311_1159001213300010045Serpentine SoilMAIAELASLKMYYEVQGSGEPVLLAPASWWPSGTWNVGVVPYLSKSFKTIV
Ga0126306_1172268313300010166Serpentine SoilMAIAELASLKIYYEAHGSGEPVLLAPASWWPSSTWN
Ga0134065_1002943333300010326Grasslands SoilMPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFK
Ga0134071_1030460423300010336Grasslands SoilMPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWNVGVVPFLSKRYRTI
Ga0126370_1012610813300010358Tropical Forest SoilMPTAHMGDVSLYFEEKGQGEPVLLVPPSWWPAATWNVG
Ga0126376_1202342523300010359Tropical Forest SoilMPTAHIGDISLYYEATGQGEPVLLVPPSWWPAATW
Ga0126372_1149992313300010360Tropical Forest SoilMPTADLGDLKIYYETPGEGEAILLVPPSWWPSDTWNVGVTPRLSQRYRTI
Ga0126372_1289765013300010360Tropical Forest SoilMPTADLGDLKIYYETQSEGEAVLLVQPSWWPSDTWNVGVTQRLS
Ga0126378_1123437213300010361Tropical Forest SoilVPKTNLGEIEIYYEQQGKGEPILLVPASWWPSDTWN
Ga0134125_1286031513300010371Terrestrial SoilMLNEVEIYFEENGQGDPVLLVPASWWPSDTWNVGAVPFLS
Ga0105239_1014657613300010375Corn RhizosphereMPTALLNDVEVYYETEGNGETVLLVPPSWWPSDTWKVGVVPA
Ga0136847_1266504013300010391Freshwater SedimentMTVAKLGDLDLYYEVKSSGEAILLAPASWWPSDTWN
Ga0136847_1282106713300010391Freshwater SedimentLIIIGLGGRVKVPLANLGDIQIYYEERGSGEAVLLAPPSWWPCDTWNVGVVPFLSRRYRT
Ga0137393_1042548623300011271Vadose Zone SoilMPTADLGDLKIYYETQGEGEAILLVPPSWWPSTTWNVGVVPVLAKKYRTIIF
Ga0137356_107675013300011402SoilMQSMGCVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPFLSKRFKTIT
Ga0137432_125584323300011439SoilMQSMGWVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPFMSKRFRT
Ga0137427_1014083223300011445SoilMPTADLGEVKIYYESQGGGEAVLLCPPSWWPSDTWNVSFVPFLAKRFRTIIFD
Ga0137383_1119807413300012199Vadose Zone SoilVPKTQLAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPF
Ga0137381_1060578513300012207Vadose Zone SoilMPTAKIGAVDIYYEEQGQGDPVLLAPPSWWPCDTWKVSVVPFLSKR
Ga0137447_105024613300012226SoilMPIAKLAELEMYYEAQGRGDAVLLAPASWWPSDTWNVGVVPF
Ga0137465_125435313300012231SoilMQSMGWVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPFLSKRF
Ga0137366_1023837613300012354Vadose Zone SoilMTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGV
Ga0137369_1057102923300012355Vadose Zone SoilMPKAKLSEIEIYYEVAGSGEPILLVPPSWWPSDTW
Ga0157356_102565423300012474Unplanted SoilMPSAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVSVVPFLSKHYR
Ga0157353_103373823300012496Unplanted SoilMPSAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKV
Ga0157316_105773213300012510Arabidopsis RhizosphereMPSAKIDDINIYYEEQGQGEPVLLAPPSWWPSDT*
Ga0137373_1037580313300012532Vadose Zone SoilMPKANLSDVEIYYEEQGQGEPILLAPASWWPSDTWKVSVVPFLSKRFKTII
Ga0137373_1055338713300012532Vadose Zone SoilMPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWNV
Ga0137359_1007304243300012923Vadose Zone SoilVPKAELAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPFLSRRF
Ga0137404_1075837013300012929Vadose Zone SoilVPKAELAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPFLSRRFKTIVFDCRGTG
Ga0137407_1074520513300012930Vadose Zone SoilVPKAELAGIDIYYEENGQGEPVLLVPASWWPSDTWNVGVVPFLSRRFKTIVFDCRGT
Ga0153915_1064777423300012931Freshwater WetlandsLPKANLSDVEIYYEEEGQGDPVLIAPPSWWPCDTWKVGVVPTLSRRYRTIIF
Ga0137410_1038343513300012944Vadose Zone SoilMPSAKIGDIDIYYEEHGQGEPVLLAPPSWWPCDTWNVKAVPFLSKRY
Ga0137410_1165110623300012944Vadose Zone SoilMPKANLGDVEIYYEVQGEGEPVLFAPASWWPSDTWNVTVV
Ga0126375_1179076413300012948Tropical Forest SoilMPKADVGDIEIYYEERGSGEAVLLVPASWWRSDTWNVG
Ga0134110_1001481013300012975Grasslands SoilMPKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTII
Ga0157371_1059433513300013102Corn RhizosphereMPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPA
Ga0157378_1108869823300013297Miscanthus RhizosphereMPLAKLNDIELYYEDNGSGEAVLLCPPSWWPSDAWNVAVVPFLSRRFRTI
Ga0157375_1178234423300013308Miscanthus RhizosphereMAKATLNGIEIYYEAEGRGEAVLLVPASWWPSDTWNDGAVPFLSQRFKTIVFDCRGTGR
Ga0134075_1035466213300014154Grasslands SoilMPKANLGDVEIYYEEKGQGEAVLLAPPSWWPSDTWNVGVVPFLSKR
Ga0134078_1030259623300014157Grasslands SoilMTKANLGNVEIYYEEKGQGEAVLLAPPSWWPSDTWNVGVVPFLSKRFKT
Ga0075301_110785113300014262Natural And Restored WetlandsMPTAELADVKIYYESQGDGEAVLLCPPSWWPSDTWNVAIVPRLSKRFRT
Ga0180077_102404513300015255SoilMPKANLDDVEIYYEEQGEGEPILLAPASWWPSDTWNV
Ga0180073_112643223300015256SoilMQSMGWVMAIARLAELEIYYEVQGSGEPVLLTPASWWPSATWNVGVVPILSKRFKTITFDCR
Ga0134089_1026125723300015358Grasslands SoilMPKANLGEIEIYYEEKGQGEAVLLAPPSWWPCDTWNVGVVPFLSKRFKTIIFDCRGTGR
Ga0134085_1001994613300015359Grasslands SoilMPKANLGEIEIYYEEKGQGEAVLLVPPSWWPSDTWN
Ga0132256_10002091283300015372Arabidopsis RhizosphereMPKANLADFEIYYEVQGEGEPVLLAPASWWPSDTWNVSVVPFLSKRF
Ga0182034_1012203953300016371SoilMPTALLNDVELYYEENGNGDTILLVPPSWWPSDTWKVGVGPFLS
Ga0134069_130105223300017654Grasslands SoilMPKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTI
Ga0187786_1013581213300017944Tropical PeatlandMAKTNLTDLEMYYEEKGNGEALLLCPPSWWPCDAWNVGVVPFLSKRFRTIIFDCRG
Ga0184604_1009090513300018000Groundwater SedimentMPTTKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVP
Ga0184626_1037504713300018053Groundwater SedimentMPKAQLENLDMYYEEHGSGEAVLLAPASWWPSNTWNVGVVPFL
Ga0184623_1000687913300018056Groundwater SedimentMPIASVNGIEIYFEEQGSGEAVLLVPASWWPGATWNVGVVPVLSPRYRTIVFD
Ga0184623_1034649613300018056Groundwater SedimentMPKAKLCDLEFYYEEEGQGEPVLLAPPSWWPCDTWNIAVVPFLSKQYRTII
Ga0184623_1051329723300018056Groundwater SedimentMPNAKIGDIEIYYEEQGQGEPVLLAPPSWWPCDTWNVGVVPFLSKRFRTI
Ga0184637_1043549013300018063Groundwater SedimentMPTADLDDVKIYYESQGDGEAVLLCPPSWWPSDTWNVAVVPFLSKRFRTIIFDCRGT
Ga0184640_1035718223300018074Groundwater SedimentMPKANLGDQEIYYEEEGQGEPVLLAPPSWWPCDTWNVGVVPFLSKRFRTIIFDC
Ga0184640_1042618623300018074Groundwater SedimentMPSAKIGDIDIYYEEQGRGEPVLLAPPSWWPSDTWKVSV
Ga0184632_1011007313300018075Groundwater SedimentMPKANLGDQEIYYEEEGQGEPVLLAPPSWWPSDTWNVGVVPYLSK
Ga0184625_1041320313300018081Groundwater SedimentMPKANLGDVEIYYEVQGEGDPVLFAPASWWPSDTWNVTVVPFLEQRFR
Ga0184629_1008941333300018084Groundwater SedimentVPLANLGDIQIFYEELGSGEVVLLAPPSWWPCDTWNVGVVPFLS
Ga0190265_1282568713300018422SoilMPMASLNGIELYFEEQGNGEAVLLIPASWWPSDTWKVGVVPVLSRHYRT
Ga0190270_1073733823300018469SoilMPTAELGSVTIYYESQGEGEAVLLCPPSWWPCDTWNVGVVPFLSKNFRTIIFDCRGTGNS
Ga0190270_1124943523300018469SoilMPTAKIGDVEIYYEEQGQGEPVLLAPPSWWPSDTWKVGVVPFLSKRYRT
Ga0187894_1029205123300019360Microbial Mat On RocksMPNANLGDVSLYFEETGRGEPVLLVPPSWWPAATWN
Ga0193753_1038111813300020034SoilMPTSKIGDVEIYHEEQGQGEAVLLAPPSWWPSDTWKVGVVPFLSKRYRT
Ga0206227_102793523300021063Deep Subsurface SedimentMATADLGDVKIYYESQGDGEALLLCPPSWWPSDTWNVAVVPFLSKRFRTIIFDCRGT
Ga0210378_1018432323300021073Groundwater SedimentMPNAKIGDIEIYYEEQGQGEPVLLAPPSWWPCDTWNVD
Ga0210379_1005657733300021081Groundwater SedimentMPTADLGDVKIYFESQGSGEAVLLCPPSWWPSDTWNVA
Ga0210384_1046341713300021432SoilMPTTELGDLKLYYETQGEGEAILLVPPSWWPSDTWN
Ga0126371_1117472523300021560Tropical Forest SoilMPKADLGDIEMYYEERGSGEAVLLVPASWWPSDTW
Ga0209109_1044808813300025160SoilMPLLNLGDIQIYYEERGSGEAVLLAPPSWWPCDTWNVGVVPFLSQRYRTII
Ga0209642_1038787213300025167SoilMPSANLDGIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTII
Ga0209002_1008200513300025289SoilMPSANLDDIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTI
Ga0209431_1098135713300025313SoilMPSANLDGIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTIIF
Ga0209431_1109331013300025313SoilMPSANLDDIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRT
Ga0209519_1032752823300025318SoilMPSANLDDIQIYYEERGDGETLLLAPPSWWPCDTWNVA
Ga0209520_1058754813300025319SoilMPSANLDDIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTIIFD
Ga0209341_1016156543300025325SoilMPSANLDGIQIYYEERGDGETILLAPPSWWPCDTWNVGVVPFLSQRYRTIIFDCRG
Ga0210115_102112333300025791Natural And Restored WetlandsMPAAKIGDIDIYYEEQGQGEPVLLAPPSWWPCDTWKVGVVPFLSKRFR
Ga0210143_107688123300025792Natural And Restored WetlandsMPTAKIGDVDIYYEEQGQGEPVLLAPPSWWPSDTWKVGV
Ga0207707_1049378013300025912Corn RhizosphereMPTALLNDVEVYYETEGNGETVLLVPPSWWPSDNWKV
Ga0207670_1126081723300025936Switchgrass RhizosphereMPTAMLNEVEIYFEENGQGDPVLLVPASWWPSDTWNVGAVPFLSRRFKTITL
Ga0207704_1076188723300025938Miscanthus RhizosphereMPTVDLGEVKIYYESQGGGEAVLLCPPSWWPSDTWNVAVVPFLAKRFRTIIFDCRGTGHS
Ga0208535_101385023300026045Natural And Restored WetlandsMPNTNIDDIEIYYEEHGQGEPVLLAPPSWWPSDTWKVSVVP
Ga0207708_1161265513300026075Corn, Switchgrass And Miscanthus RhizosphereMATATLNGVDTYYEVQGQGEPVLLVPASWWPSDTWNVGV
Ga0207648_1212093913300026089Miscanthus RhizosphereMPTALLNDVELHYETEGNGEPVLLVPLSSWPTDAWKVGVVPAL
Ga0208291_107590213300026111Natural And Restored WetlandsMPKANLGDVEIYYEVQGEGEPILLAPASWWPSDTWNVAVVPLLSQRFRTIAF
Ga0207674_1064873613300026116Corn RhizosphereMPTALLNDVELYYETEGNGEPVLLVPPSWWPSDTWKVGVVPALSKRY
Ga0209469_100395713300026307SoilMTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSK
Ga0209266_103914933300026327SoilMTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTIV
Ga0209802_102775513300026328SoilMPKANLGEIEIYYEEKGQGEPVLLAPPSWWPCDTWN
Ga0209375_100833263300026329SoilMTKANLGNVEIYYEEKGQGEAVLLVPPSWWPSDTWNVGVVPFLSKRFKTIVFDCRGTGR
Ga0209846_102719413300027277Groundwater SandMPKANLGEVEIYYEEQGNGEPILLAPASWWPSDTWNV
Ga0209799_110085113300027654Tropical Forest SoilMPKADVGDIEIYYEERGSGEAVLLVPASWWPSDTWNVGVVPF
Ga0209814_10000509113300027873Populus RhizosphereMPTANLGDVSLCYEETGQGEPVLLVPPSWWPAATWNG
Ga0209814_1020003123300027873Populus RhizosphereMPKAQIGEIEIYYEQRGNGEPVLLVPPSWWPSDTWKVSVVPFLSKRFKTI
Ga0209486_1080259023300027886Agricultural SoilMPTANLNDVQIYYEDSGEGKVVLFASPSWWPCDTWKINVVPFLSRRYRTIIFDCRGTG
Ga0207428_1032815723300027907Populus RhizosphereMQTALLNGVELYYETEGNGEPVLLVPPSWWPSATWKVGVVPALAKRYQ
Ga0209820_105072733300027956Freshwater SedimentMPKANLGDVEIYYEEHGKGEPILLAPASWWPSDAWKVSVVQFLSKR
Ga0222749_1065073123300029636SoilMPKADLCDIEMYYEEKGSGEAVLLVPASWWPSDTWNVSIV
Ga0307469_1062364813300031720Hardwood Forest SoilMPIAKLGDIEMYYEEKGSGEAVLLVPASWWPSDTWKVGVVPFLS
Ga0306921_1246117013300031912SoilMPKANLGDVEIYYEVQGEGEPVLLAPASWWPSHTWN
Ga0307479_1005547323300031962Hardwood Forest SoilMPTADLGDLKLYYETQGEGEAILLVPPSWWPSDTWNVGVTQRLSQRYRT
Ga0307411_1214895423300032005RhizosphereVPTAELGNVKIYYESQGEGDAVLLCPPSWWPCDTWNVGVVPFLSKNFR
Ga0310906_1088531523300032013SoilMAKATLNGVEIYYEAEGRGEAVLLVPASWWPSDTWNVGVVPFL
Ga0315910_1011602433300032144SoilMPTAKIGDIDIYYEEQGQGEPVLLAPPSWWPSDTWKVAVVPFLA
Ga0307471_10000809413300032180Hardwood Forest SoilMPKAKLGDIEMYYEEKGSGEAVLLVAASWWPSDTW
Ga0307471_10385253613300032180Hardwood Forest SoilVPTADLGDLKLYYETQGEGQVILMVPPSWWPSDTWNVGITQRLSQRYRTIIFDCRGT
Ga0310812_1017140523300032421SoilMPSAKIGDIDMYYEEAGQGEPVLLAPPSWWPSDTWKVGVVPFL
Ga0335082_1090522613300032782SoilMPTADLGDLKIYYETQGAGEAILLVPPSWWPSDTWNIGVTQ
Ga0335080_1090567013300032828SoilMPIADLGDLKIYYETQGEGEAILLVPPSWWPSDTWNIGVTQRLSQRYR
Ga0335080_1201553113300032828SoilMPTADLGDLKIYYATQGAGEAILLVPPSWWPSDTWNIGVTQR
Ga0335070_1081611123300032829SoilVPVANLSDVEIYYEDQGEGEPVFLAPPSWWPCDTWKVGVVPALSRRYRTIIFDPRGT
Ga0326726_1010149743300033433Peat SoilMPIAKLAGLEIYYEAQGSGEPVLLAPASWWPSDTWNVGVVPFLSKRFRTIV
Ga0364945_0005918_3049_32133300034115SedimentMPKANLGDIEIYHEEQGEGEPILLVPASWWPSDTWNVTVVPFFSRRFKTIIFDCR
Ga0364929_0050655_3_1343300034149SedimentMPRAAVNGVEIYFEENGQGEPVLLVPASWWPSNTWNVGAVPFLS
Ga0364933_202281_1_1143300034150SedimentMPTAAVNGCEIYFEENGQGEPVLLVPASWWPSNTWNVG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.