 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F033822 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RALVAAAPARVDRFPLLPYAAEALGVTEGDSVRAVPLAPADR |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 82.95 % |
| % of genes from short scaffolds (< 2000 bps) | 77.84 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.727 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.523 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 0.00% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF04996 | AstB | 84.66 |
| PF00884 | Sulfatase | 5.68 |
| PF05977 | MFS_3 | 1.70 |
| PF02737 | 3HCDH_N | 1.14 |
| PF00861 | Ribosomal_L18p | 0.57 |
| PF01156 | IU_nuc_hydro | 0.57 |
| PF00496 | SBP_bac_5 | 0.57 |
| PF05593 | RHS_repeat | 0.57 |
| PF01734 | Patatin | 0.57 |
| PF02321 | OEP | 0.57 |
| PF00800 | PDT | 0.57 |
| PF12680 | SnoaL_2 | 0.57 |
| PF04879 | Molybdop_Fe4S4 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG3724 | Succinylarginine dihydrolase | Amino acid transport and metabolism [E] | 84.66 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.70 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.14 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 1.14 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 1.14 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.14 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.14 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.14 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.57 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.57 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.57 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.57 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.57 |
| COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 0.57 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.73 % |
| All Organisms | root | All Organisms | 27.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.27% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.27% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.70% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.70% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.14% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.14% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.14% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.57% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.57% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.57% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.57% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.57% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.57% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.57% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1052516521 | 3300000956 | Soil | APPRVDRFPLRPYVAAALGVAEGDSVRAVPLAPRDR* |
| JGI12635J15846_100518633 | 3300001593 | Forest Soil | AILCPAPLRIAQFPLLPHAALALGVSEAETVRAVPLAPRDRS* |
| Ga0066684_103155601 | 3300005179 | Soil | VILAPAPARIARFPLLPHAASLLGVVADDTVRAVPLAPRDRL* |
| Ga0066676_109074021 | 3300005186 | Soil | KFEEFRVLVAAAPTRVDRFPLLPYAASALGVGEGDSVRAVPLAPRDR* |
| Ga0070690_1014889311 | 3300005330 | Switchgrass Rhizosphere | FADFRAIVVAAPARTDRLPLLPYAADALRVSEGDSVRAVPLAPADR* |
| Ga0070670_1001604543 | 3300005331 | Switchgrass Rhizosphere | DFRVILAHAPSRIDRFPLLPYAASALEVTDGDSVRAVPLSQKDR* |
| Ga0068869_1002017511 | 3300005334 | Miscanthus Rhizosphere | ILCPAPARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0068869_1007579651 | 3300005334 | Miscanthus Rhizosphere | LCPAPARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0070666_102494621 | 3300005335 | Switchgrass Rhizosphere | AFRAILCPAPARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0070660_1019115532 | 3300005339 | Corn Rhizosphere | IVTTAPRRVDRFPLLPHAAAALAVGEGDSVRAVPLSPHDR* |
| Ga0070671_1001576821 | 3300005355 | Switchgrass Rhizosphere | AFRALVTAAPARVDRFPLLPYAAEALGVIEGDSVRAVPLAPGDR* |
| Ga0070688_1005989602 | 3300005365 | Switchgrass Rhizosphere | RRFEGFRAVVTAAPPRCDRFPLLPHAAEALGIHEGDVVRAVALRPVDR* |
| Ga0070714_1003856572 | 3300005435 | Agricultural Soil | AQFRALVVAAPARVDRFPLRPYAAQALGVGEGDSVRVVPLAPRDR* |
| Ga0070711_1016342502 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | CNRQFGGWRALVTAAPARVDRFPLLPFAADALGLREGDSVRAVPLAASDR* |
| Ga0070705_1008076911 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | FRALVTAAPARVDRFPLLPYAAEALGVTEGESVRAVPLAPADR* |
| Ga0070708_1017710161 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AFRAILCPAPVRIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0066689_101086631 | 3300005447 | Soil | FRAVLAPAPARIAQFPLLPHAAAALGVGDGDTVRAVPVSPRDRL* |
| Ga0070662_1011493201 | 3300005457 | Corn Rhizosphere | IVTAAPPRVDRFPLLPYAADALGVREGDSVRAVPLKPADR* |
| Ga0070662_1017822802 | 3300005457 | Corn Rhizosphere | WLVSNRRFADFRALVAAAPARVDRFPLLPYAAAALKVGEGDTVRAVPLRPSER* |
| Ga0070741_107018761 | 3300005529 | Surface Soil | RALVTAAPARADRFPLLPYAAAALGVSEGDSIRAVPLDPDDR* |
| Ga0070679_1016820171 | 3300005530 | Corn Rhizosphere | ALVTAAPARVDRFPLLPFAADALGLREGDSVRAVPLAASDR* |
| Ga0070696_1007460441 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RRFDAFRALVTAAPARVDRFPLLPYAAEALGVTEGDSVRAVPLAPADR* |
| Ga0068854_1012050601 | 3300005578 | Corn Rhizosphere | ASAPSRVDRFPLLAYAAAALGVGEGDSVRAVPLAPRDR* |
| Ga0068856_1006580641 | 3300005614 | Corn Rhizosphere | AFRALVTAAPARVDRFPLLPYAAQALGVTEGDSVRAVPLAPGDR* |
| Ga0070702_1001987151 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AILCPAPARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0068852_1003958921 | 3300005616 | Corn Rhizosphere | ARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0068852_1028590222 | 3300005616 | Corn Rhizosphere | AAAPARVDRFPLLPYAAAALKVGEGDTVRAVPLRPSDR* |
| Ga0068864_1026871922 | 3300005618 | Switchgrass Rhizosphere | TDDVRWLVSNRRFADFRVVLAHAPSRIDRFPLLPYAAAALGVTDEDLVRAVPLSQKDR* |
| Ga0068861_1015028671 | 3300005719 | Switchgrass Rhizosphere | RVVIAHAPSRIDRFPLLPYAAEALGVDDGDTVRAVPLSQKDR* |
| Ga0068861_1022572681 | 3300005719 | Switchgrass Rhizosphere | PSRIDRFPLLPYAAEALGVTDGDTVRAVPLSQKDR* |
| Ga0066903_1066094111 | 3300005764 | Tropical Forest Soil | APAAARISEFPLLPHAAKLLGVSDGDAVRAVPLSART* |
| Ga0068870_103602722 | 3300005840 | Miscanthus Rhizosphere | SNRRFADFRVVLAHAPSRIDRFPLLPYAAAALGVTDEDLVRAVPLSQKDR* |
| Ga0068858_1012219621 | 3300005842 | Switchgrass Rhizosphere | PARVDRFPLLPYAAAQLGVTESDTVRAVPLAPRER* |
| Ga0068858_1021269861 | 3300005842 | Switchgrass Rhizosphere | SRIDRFPLLPYAASALEVTDGDSVRAVPLSQKDR* |
| Ga0068860_1010879761 | 3300005843 | Switchgrass Rhizosphere | IVAAAPARVERFPLLPCAAEALGIGEGDTVRAVPLSPQDR* |
| Ga0068862_1011869871 | 3300005844 | Switchgrass Rhizosphere | VSNRRFEDFRVIVAHAPSRIDRFPLLPYAASALEVTDGDSVRAVPLSQKDR* |
| Ga0075280_100635692 | 3300005904 | Rice Paddy Soil | FATWRALVTAAPARVDRFPLLPYAAEALGVAEGDTVRAVPLAPADR* |
| Ga0066696_104327552 | 3300006032 | Soil | LWLVSNRKFEDFRVLVAAAPSRVDRFPLLPYAASALGVGEGDSVRAVQLAPRDR* |
| Ga0068871_1018490241 | 3300006358 | Miscanthus Rhizosphere | AILATAPARVDRFPLKAYAADALGVREGDSVRAVALRPSDR* |
| Ga0074062_101947622 | 3300006606 | Soil | FRAIIAPAPPRIDRFPLLPYAAQVLGLSDGDRVRAVALAPRDR* |
| Ga0075521_106794291 | 3300006642 | Arctic Peat Soil | NRNFQDFRVLVATAPARADRFPLKAYAAATLGVTEGDTVRAVPLAPADR* |
| Ga0075434_1006564351 | 3300006871 | Populus Rhizosphere | VSNRKFAQFRTLVTAAPARVDRFPLLHYAADALGVTEGDSVRVVPLAPADR* |
| Ga0068865_1001787191 | 3300006881 | Miscanthus Rhizosphere | VVAHAPSRIDRFPLLPYAAEALGVTDGDTVRAVPLSQKDR* |
| Ga0068865_1008859642 | 3300006881 | Miscanthus Rhizosphere | CNRKFAQFRALVTTAPARVDRFPLLPYAAEALGVGEGERVRAVPLAPADR* |
| Ga0075424_1022188921 | 3300006904 | Populus Rhizosphere | VSNRKFDGYRALVTSAPARFDRFPLLPYAASALGVGEGDTVRAVPLAPRDR* |
| Ga0075435_1010170921 | 3300007076 | Populus Rhizosphere | VAAAPPRVDRFPLLPYAADVLGVAEGDSVRVVPFAPADR* |
| Ga0111539_123410671 | 3300009094 | Populus Rhizosphere | PARADRMPLLPYAAEALQVAEGGTVRAVPLSPADR* |
| Ga0075418_112703201 | 3300009100 | Populus Rhizosphere | TAAPARLDRFPLLPYTATALGVGEGDTVRAVPLAPRDR* |
| Ga0066709_1012241881 | 3300009137 | Grasslands Soil | DFRALVAAAPPRVDRFPLRPYVAAALAVGEGDSVRAVPLAPRDR* |
| Ga0075423_110168631 | 3300009162 | Populus Rhizosphere | VLVASAPSRVDRFPLLAYAAAALGIGEGDSVRAVPLAPRDR* |
| Ga0075423_120048621 | 3300009162 | Populus Rhizosphere | KFEDFRVLVATAPSRVDRFPLLPYAASALGVGEGDSVRAVPLAPRDR* |
| Ga0105248_104208921 | 3300009177 | Switchgrass Rhizosphere | PARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0105248_108196671 | 3300009177 | Switchgrass Rhizosphere | RALVAAAPARVDRFPLLPYAAEALGVTEGDSVRAVPLAPADR* |
| Ga0134067_103880802 | 3300010321 | Grasslands Soil | ARIARFPLLPHAATALGVAAGDTVRAVPLSPRDRL* |
| Ga0126370_106669161 | 3300010358 | Tropical Forest Soil | PAPARISEFPLLPHAAKLLGIGDGDVVRAVPLSARS* |
| Ga0134125_104335752 | 3300010371 | Terrestrial Soil | RKFAQFRALIVAAPPRADPFPLLPYAAEALGVGEGDSVRVVPLAPSDR* |
| Ga0134125_124798501 | 3300010371 | Terrestrial Soil | KFGDWRALVAAAPPRVDRFPLMPYAAQALGVAEGDSVRVVPLSPGDR* |
| Ga0126383_136503912 | 3300010398 | Tropical Forest Soil | RATLAKAPARIDRLPLLPFVAAELGVGDGDLVRAVPLSPRDR* |
| Ga0134121_110822882 | 3300010401 | Terrestrial Soil | AHAPSRIDRFPLLPYAASALGVTEGDTVRAVPLSQKDR* |
| Ga0137463_11666681 | 3300011444 | Soil | PARADRLPLLPYAADALRVGEGDTVRAVPLAPGDR* |
| Ga0137376_114180641 | 3300012208 | Vadose Zone Soil | RIAQFPLLPHAALALGVSETDTVRAVPLAPRDRS* |
| Ga0137379_110088401 | 3300012209 | Vadose Zone Soil | APARVAQFPLLPHTAAALGVGDGDTVRAVPLSPRDRL* |
| Ga0137370_106460591 | 3300012285 | Vadose Zone Soil | FEDFRVLVAAAPPRVDRFPLLPYAASALGVGEGDSVRAVPLAPRDR* |
| Ga0137366_106699842 | 3300012354 | Vadose Zone Soil | APSRVDRFPLRPYVAAALGVGEGDSVRAVPLAPRDR* |
| Ga0157288_104241242 | 3300012901 | Soil | APARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR* |
| Ga0157302_104004061 | 3300012915 | Soil | TTSAPSRTDRFPLKPYAATTLGVAEGDTVRAVPLAPADR* |
| Ga0164241_110645382 | 3300012943 | Soil | APRRVDRFPLLPHAAAALAVGEGDSVRAVPLSPHDR* |
| Ga0164300_104416171 | 3300012951 | Soil | NRRFDAFRALVTAAPARVDRFPLLPYAAEALGVTEGESVRAVPLAPADR* |
| Ga0164302_113717581 | 3300012961 | Soil | TAAPARVDRFPLLPYAAEALGVTEGDSVRAVPLAPADR* |
| Ga0157370_100782444 | 3300013104 | Corn Rhizosphere | MAPRRIDRFPLLPHVAQALGVGEGDTVRAVALAPADR* |
| Ga0157374_111159522 | 3300013296 | Miscanthus Rhizosphere | TDEIRWLVSNRRFEDFRVILAHAPSRIDRFPLLPYADSALGVTEGDTVRAVPLSQKDR* |
| Ga0163162_120520982 | 3300013306 | Switchgrass Rhizosphere | ADFRAIVVAAPPRADRLPLLPHAADALRVSEGDVVRAVPLSPADR* |
| Ga0157372_120158832 | 3300013307 | Corn Rhizosphere | SAPSRVDRFPLLAYAAAALGVGEGDSVRAVPLAPRDR* |
| Ga0157372_133980671 | 3300013307 | Corn Rhizosphere | SRVDRFPLLPYAAEALGVAEGDSLRVVPLAPADR* |
| Ga0157375_111692892 | 3300013308 | Miscanthus Rhizosphere | ADYRAILARAPSRVDRFPLLPYAATALGVADGDLVRAVPLSPKDR* |
| Ga0157375_118374951 | 3300013308 | Miscanthus Rhizosphere | ADFRVVVAHAPSRIDRFPLLPYAAEALGVTDGDTVRAVPLSQKDR* |
| Ga0157375_128633561 | 3300013308 | Miscanthus Rhizosphere | TAPARVDRFPLKAYAADALGVREGDSVRAVALRPSDR* |
| Ga0157380_101491251 | 3300014326 | Switchgrass Rhizosphere | AGVRWLVANRKFQDYRAILATAPARIDRFPLRPYAAKALGVREGDSVRAVALRPADR* |
| Ga0182019_101974402 | 3300014498 | Fen | ARADRFPLKAYAASTLRVAEGDTVRAVPLAPSDR* |
| Ga0173480_104342971 | 3300015200 | Soil | VANRRFADFRVVVAHAPSRIDRFPLLPYAAEALGVTDGDTVRAVPLSQKDR* |
| Ga0132258_105996915 | 3300015371 | Arabidopsis Rhizosphere | VGNRKFDGFRALVTAAPARVDRFPLLPYAAAALGVGEGDTVRAVPLAPRDR* |
| Ga0132257_1001280283 | 3300015373 | Arabidopsis Rhizosphere | SNRRFESFRVVLARAPARVDRLPLLPFAASELAVGEGDLVRAVPLVPRDR* |
| Ga0132257_1017499881 | 3300015373 | Arabidopsis Rhizosphere | FRALVTAAPARVDRFPLLPYAAAALRVAEGDSVRAVPLAPADR* |
| Ga0132255_1005112221 | 3300015374 | Arabidopsis Rhizosphere | NRRFADFRALVAAAPARVDRFPLLPYAAEALGVTEGESVRAVPLAPADR* |
| Ga0132255_1007855512 | 3300015374 | Arabidopsis Rhizosphere | ANRQFADYRAILARAPSRVDRFPLLPYAATALGVADGDLVRAVPLSPKDR* |
| Ga0163161_110982421 | 3300017792 | Switchgrass Rhizosphere | PWLVSNRKFEAYRALVAAAPARVDRFPLLPYAAAALGVGEGDTVRAVPLSPRDR |
| Ga0163161_115575302 | 3300017792 | Switchgrass Rhizosphere | AIVVAAPARVDRLPLLAYAADALRVGEGDSVRAVPLAPGDR |
| Ga0184605_105377362 | 3300018027 | Groundwater Sediment | WLVTNRKFAEYRALVAAAPARIDRFPLFPYAAAALGVGEGDTVRAVPLAPGDR |
| Ga0184608_100703221 | 3300018028 | Groundwater Sediment | APARIAQFPLLPHAAAILGVVDGDTVRAVPLSPRDRL |
| Ga0187765_113109591 | 3300018060 | Tropical Peatland | FRAVLVPAPRRVAEFPLLPHAAGALGVSAGATVRAVPLSPRG |
| Ga0184611_11713102 | 3300018067 | Groundwater Sediment | DFRVVLAHAPSRIDRFPLLPYAATALGVADGDLVRAVPLSQKDR |
| Ga0190274_120836591 | 3300018476 | Soil | NRQFADFRAIVVAAPARADRFPLLPYAAEALRVSEGDTVRAVPLSPRDR |
| Ga0193751_10035621 | 3300019888 | Soil | HFRAVLCPAPARIAQLPLLPHAAETLGVADGESVRAVPLSPRDRP |
| Ga0193724_11016551 | 3300020062 | Soil | PAPARIAQFPLLPHAAEALGVRAGDSVRAVPLSARDR |
| Ga0210381_102984882 | 3300021078 | Groundwater Sediment | PARVDRFPLLPYAAEALGVTEGDSVRAVPLAPGDR |
| Ga0182009_101056241 | 3300021445 | Soil | GPARADRFSLLPYAAAALRVDEGDTVRAVPLAPGDR |
| Ga0182009_105341391 | 3300021445 | Soil | AAPARVDRFPLLPYAAEALGVKEGDSVRAVPLAPGDR |
| Ga0126371_136604701 | 3300021560 | Tropical Forest Soil | APPRVDRFPLMPYAAEALGVAEGDSVRVVPLAPADR |
| Ga0207656_101745572 | 3300025321 | Corn Rhizosphere | DVPWLVCNRAFAGFRAIVAAAPPRVDRFPLLPYAAEALGVSEGDTVRAVPLKPADR |
| Ga0209584_104326302 | 3300025878 | Arctic Peat Soil | NRNFQDFRVLVATAPARADRFPLKAYAAATLGVTEGDTVRAVPLAPADR |
| Ga0207682_100491952 | 3300025893 | Miscanthus Rhizosphere | VANRDLQNFRVLVTSAPSRTDRFPLKPYAATTLGVAEGDTVRAVPLAPADR |
| Ga0207710_104514921 | 3300025900 | Switchgrass Rhizosphere | TAFRAILCPAPARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR |
| Ga0207680_103419501 | 3300025903 | Switchgrass Rhizosphere | YRAILARAPSRVDRFPLLPYAATALGVADGDLVRAVPLSPKDR |
| Ga0207707_103213751 | 3300025912 | Corn Rhizosphere | ANRRFGDFRAIVAMAPRRIDRFPLLPHVAQALGVGEGDTVRAVALAPADR |
| Ga0207695_111376682 | 3300025913 | Corn Rhizosphere | PVRIARFPLLPHAAEALGVRAGDSVRAVPLSPRDR |
| Ga0207671_107166981 | 3300025914 | Corn Rhizosphere | NRKSAQFRALIVAAPPRADPFPLLPYAAEALGVREGDSVRVVPLAPSDR |
| Ga0207663_104751411 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PPRVDRFPLMPYAAQALGVAEGDSVRVVPLSPGDR |
| Ga0207663_116881892 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPRRIDRFPLLPHAASALGVGEGDSVRAVPLAPGDR |
| Ga0207657_100149909 | 3300025919 | Corn Rhizosphere | AAPPRVDRFPLLPHAAQALCVGEGDSVRAVPLAPADR |
| Ga0207657_107878562 | 3300025919 | Corn Rhizosphere | IVTTAPRRVDRFPLLPHAAAALAVGEGDSVRAVPLSPHDR |
| Ga0207659_112573442 | 3300025926 | Miscanthus Rhizosphere | PPRADRLPLLPHAADALRVSEGDVVRAVPLSPADR |
| Ga0207700_101618851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AILCPAPVRIAQFPLLPHAALALGVSEADTVRAVPLAPRDRS |
| Ga0207664_105520461 | 3300025929 | Agricultural Soil | AQFRALVVAAPARVDRFPLRPYAAQALRVGEGDSVRVVPLAPRDR |
| Ga0207644_101254551 | 3300025931 | Switchgrass Rhizosphere | VCNRRFDAFRALVTAAPARVDRFPLLPYAAEALGVIEGDSVRAVPLAPGDR |
| Ga0207690_104075311 | 3300025932 | Corn Rhizosphere | KFAEWRSLVTAAPPRVDRFPLLPHAAQALCVGEGDSVRAVPLAPADR |
| Ga0207690_105077631 | 3300025932 | Corn Rhizosphere | AIVTAAPPRVDRFPLLPYAAQALGVGEGDTVRAVPLKPADR |
| Ga0207704_112567932 | 3300025938 | Miscanthus Rhizosphere | QNFRVLVTSAPSRTDRFPLKPYAATTLGVAEGDTVRAVPLAPADR |
| Ga0207689_111140211 | 3300025942 | Miscanthus Rhizosphere | HAPSRIDRFPLLPYAAAALGVTDEDLVRAVPLSQKDR |
| Ga0207661_110790371 | 3300025944 | Corn Rhizosphere | WRALVTAAPARVDRFPLLPFAADALGLREGDSVRAVPLAASDR |
| Ga0207651_100575093 | 3300025960 | Switchgrass Rhizosphere | FRVIVAHAPSRIDRFPLLPYAASALEVTDGDSVRAVPLSQKDR |
| Ga0207651_117056392 | 3300025960 | Switchgrass Rhizosphere | RAIVVAAPPRADRLPLLPYAADALRVSEGDVVRAVPLSPADR |
| Ga0207640_102327051 | 3300025981 | Corn Rhizosphere | RAIVAAAPPRVDRFPLLPYAAEALGVSEGDTVRAVPLKPADR |
| Ga0207658_101016443 | 3300025986 | Switchgrass Rhizosphere | ANRKFEGYRAIVAAAPARVERFPLLPYAAEALGVGEGDTVRAVPLSPQDR |
| Ga0207658_103130761 | 3300025986 | Switchgrass Rhizosphere | CPAPARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR |
| Ga0207677_111763942 | 3300026023 | Miscanthus Rhizosphere | AAPARVDRFPLLPYAAAALKVGEGDTVRAVPLRPSER |
| Ga0207677_114314872 | 3300026023 | Miscanthus Rhizosphere | RKFDGFRALVSAAPARVDRFPLLPYAAAALGVGEGDTVRAVPLAPRDR |
| Ga0207703_108364781 | 3300026035 | Switchgrass Rhizosphere | PARIAQFPLLPHAAEALGVRAGDSVRAVPLSPRDR |
| Ga0207678_109588401 | 3300026067 | Corn Rhizosphere | NRRFADFRALVAAAPARVDRFPLLPYAAAALRVGEGDTVRAVPLRPSDR |
| Ga0207641_117387262 | 3300026088 | Switchgrass Rhizosphere | MLWLVSNRDLQNFRVLVTSAPSRTDRFPLKPYAATTLGVAEGDTVRAVPLAPADR |
| Ga0207641_124042391 | 3300026088 | Switchgrass Rhizosphere | ALLVQASARIDRFPLLPYAAAQLGVAEGDLVRAVPLSPRDR |
| Ga0207676_125937072 | 3300026095 | Switchgrass Rhizosphere | TDDVRWLVSNRRFADFRVVLAHAPSRIDRFPLLPYAAAALGVTDEDLVRAVPLSQKDR |
| Ga0207674_119905481 | 3300026116 | Corn Rhizosphere | SAPSRVDRFPLLAYAAAALGVGEGDSVRAVPLAPRDR |
| Ga0207675_1019857791 | 3300026118 | Switchgrass Rhizosphere | PSRIDRFPLLPYAAEALGVTDGDTVRAVPLSQKDR |
| Ga0209474_101650591 | 3300026550 | Soil | VLWLVSNRKFEDFRVLVAAAPSRVDRFPLLPYAASALGVGEGDSVRAVQLAPRDR |
| Ga0209577_100336221 | 3300026552 | Soil | YRAILCPAPLRIAQFPLLPHAALALGVSETDTVRAVPLAPRDRS |
| Ga0209982_10326121 | 3300027552 | Arabidopsis Thaliana Rhizosphere | RKFAEFRALVTAAPPRVDRFPLLPYAAEALGVTEGDSVRAVPLAPADR |
| Ga0209971_10043831 | 3300027682 | Arabidopsis Thaliana Rhizosphere | AEFRALVTAAPPRVDRFPLLPYAAEALGVTEGDSVRAVPLAPADR |
| Ga0209998_101342652 | 3300027717 | Arabidopsis Thaliana Rhizosphere | LVANRDFADFRAILATAAPRIDRFPLPPHAAAALGVGEGDTVRAVPLATADR |
| Ga0209450_105589971 | 3300027885 | Freshwater Lake Sediment | APPRLDRLPLLPHAARQLGVGEGDTVRAVPLAPRERR |
| Ga0209254_105984371 | 3300027897 | Freshwater Lake Sediment | EGILWLVANRSFAGFRAAIVAASARLDRFPLPPYTARQLGVGDGDTVRAVPLAPRDRR |
| Ga0209705_102959552 | 3300027979 | Freshwater Sediment | LVANRRFEDFRAILAHAPSRVDRMPLLPYAAAQLGVGAGDTVRAVPLAPRDR |
| Ga0268266_100698041 | 3300028379 | Switchgrass Rhizosphere | NRRFADYRAILARAPSRVDRFPLLPYAATALGVADGDLVRAVPLSPKDR |
| Ga0268266_122948771 | 3300028379 | Switchgrass Rhizosphere | NRRFADFRVVVAHAPSRIDRFPLLPYAAEALGVTDGDTVRAVPLSQKDR |
| Ga0302256_100558312 | 3300028741 | Fen | NRSLADFRVLVTAAPARADRFPLKAYAASTLRVAEGDTVRAVPLAPADR |
| Ga0302258_10457502 | 3300028770 | Fen | NRSLADFRVLVTAAPARADRFPLNAYAASTLGVVEGDTVRAVPLSPSDR |
| Ga0302258_10695032 | 3300028770 | Fen | VTSAPARADRFPLKAYAARTLRVAEGDTVRAVPLAPADR |
| Ga0268298_104927182 | 3300028804 | Activated Sludge | VASAPRHVDRFPLRPFAARALGVAEGDTVRAVPLAPADR |
| Ga0302254_103198332 | 3300028870 | Fen | LVANRSLADFRVLVTAAPARPDRFPLKAYAASTLRVAEGDTVRAVPLAPADR |
| Ga0311332_108577372 | 3300029984 | Fen | PARADRFPLKAYAASTLGVAEGDTVRAVPLAPADR |
| Ga0311365_100093241 | 3300029989 | Fen | PARADRFPLNAYAASTLGVVEGDTVRAVPLSPSDR |
| Ga0302299_101877811 | 3300030010 | Fen | APARADRFQLKPYAAATLGVTDGDTVRAVPLAPADR |
| Ga0311348_104927722 | 3300030019 | Fen | VTNRRFEAYRALVVQASARFDRFPLLPHAAAQLGVAEGDLVRAVPLSPRDR |
| Ga0302273_11544191 | 3300030048 | Bog | VAAPARADRFPLKPYAAATLGVAEGGTVRAVPLAPADR |
| Ga0311333_117717292 | 3300030114 | Fen | VLWLVANRSLADFRVLVTAAPARADRFPLKAYAASTLRVAEGDTVRAVPLAPADR |
| Ga0311349_103832742 | 3300030294 | Fen | WLVANRSLADFRVLVTAAPARADRFPLKAYAASTLRVTEGDTVRAVPLAPADR |
| Ga0311349_104264232 | 3300030294 | Fen | AAPARADRFQLKPYAAATLGVTDGDTVRAVPLAPADR |
| Ga0302323_1013510692 | 3300031232 | Fen | LVANRSLADFRVLVTKAPARADRFPLKAYAASTLGVAEGDTVRAVPLAPADR |
| Ga0302323_1025453801 | 3300031232 | Fen | LVANRSLQDFRVLVVAAPARADRFPLKPYAAATLGVAEGDTVRAVPLAPADR |
| Ga0265316_102672821 | 3300031344 | Rhizosphere | NRRFEDFRAIIAPAPPRIDRFPLLPYAAKVLALSDGDRVRAVPLAPRDR |
| Ga0310813_115227591 | 3300031716 | Soil | EFRALVTAAPPRVDRFPLLPYAAEALGVTEGDSVRAVPLAPADR |
| Ga0311351_107022522 | 3300031722 | Fen | VLVTAAPARADRFPLKAYAASTLRVAEGDTVRAVPLAPADR |
| Ga0302321_1024844812 | 3300031726 | Fen | VLVVAAPARADRFQLKPYAAATLGVTDGDTVRAVPLAPADR |
| Ga0318537_103007061 | 3300031763 | Soil | VTTAPSRIDRFPLLPYAATTLGVVEGDLVRAVPLRPADR |
| Ga0310907_105095531 | 3300031847 | Soil | RAVVTAAPPRCDRFPLLPHAAEALGIHEGDVVRAVALRPVDR |
| Ga0306919_114457201 | 3300031879 | Soil | VANRKFDGFRALVAAAPSRADRFALLPYAATALGVGEGDTVRAVPLAPRDR |
| Ga0318520_109502651 | 3300031897 | Soil | FCAMLAPAPARISEFPLLPHAAKALGVREGDAVRAVPLSPRS |
| Ga0307407_101882902 | 3300031903 | Rhizosphere | PAPARSDRLSLMPYAAEALGVVEGDIVRAVPLSARDR |
| Ga0318531_105760122 | 3300031981 | Soil | LAPGPARIAEFPLLPHAAEVLGVRDGDAVRVVPLSPGS |
| Ga0307416_1016775941 | 3300032002 | Rhizosphere | AIIAPAPSRIDAMPLMPHAAEALLVGEGDLVRAVPLSPRDRA |
| Ga0310890_106537292 | 3300032075 | Soil | GFRAVVTAAPPRCDRFPLLPHAAEALGIHEGDVVRAVALRPVDR |
| Ga0310896_107537961 | 3300032211 | Soil | RAIVTAAPPRVDRFPLLPYAAEALGVTEGESVRAVPLAPADR |
| Ga0310810_105027312 | 3300033412 | Soil | WRVLVTAAPPRVDRFPLLPYAAKALGVDEGESVRAVPLAPADR |
| Ga0316601_1016840682 | 3300033419 | Soil | VSNRCFAEFRATIVAAPADADRLVLPPYAAQTLGVGEGELVRAVPLSPRDR |
| Ga0364945_0277684_1_114 | 3300034115 | Sediment | VPASRRIAQFPLLPYAANALGVAAGATVRAVPLSPRE |
| Ga0364943_0183201_2_133 | 3300034354 | Sediment | FRAIVVSGPARVDRLPLLAYAADALRVGEGDTVRAVPLAPGDR |
| Ga0370485_0044478_4_144 | 3300034358 | Untreated Peat Soil | MSNFRALVVAAPARTDRCPLKPYAAATLGVAEGDTVRAVPLSPSDR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |