Basic Information | |
---|---|
Family ID | F033802 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 176 |
Average Sequence Length | 42 residues |
Representative Sequence | VKYVDREVVKYDTKFAPGGICEIPKEFIKAHNDAAEAPK |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.60 % |
% of genes near scaffold ends (potentially truncated) | 94.32 % |
% of genes from short scaffolds (< 2000 bps) | 81.82 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (73.295 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (31.818 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.182 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.568 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.34% β-sheet: 0.00% Coil/Unstructured: 68.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 176 Family Scaffolds |
---|---|---|
PF00182 | Glyco_hydro_19 | 3.41 |
PF02867 | Ribonuc_red_lgC | 3.41 |
PF11351 | GTA_holin_3TM | 3.41 |
PF01592 | NifU_N | 2.27 |
PF14235 | DUF4337 | 1.70 |
PF02511 | Thy1 | 1.14 |
PF00565 | SNase | 1.14 |
PF01223 | Endonuclease_NS | 0.57 |
PF02861 | Clp_N | 0.57 |
PF10431 | ClpB_D2-small | 0.57 |
PF01556 | DnaJ_C | 0.57 |
PF09293 | RNaseH_C | 0.57 |
PF13640 | 2OG-FeII_Oxy_3 | 0.57 |
PF00317 | Ribonuc_red_lgN | 0.57 |
COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
---|---|---|---|
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 3.98 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 3.41 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 3.41 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 2.27 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 1.14 |
COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.11 % |
Unclassified | root | N/A | 19.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109629067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300002835|B570J40625_101373568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300002835|B570J40625_101751057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300003277|JGI25908J49247_10082092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300003277|JGI25908J49247_10157695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300003411|JGI25911J50253_10011208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3400 | Open in IMG/M |
3300003411|JGI25911J50253_10119160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300003412|JGI25912J50252_10006815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3860 | Open in IMG/M |
3300004805|Ga0007792_10100797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300005517|Ga0070374_10643594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300005525|Ga0068877_10630954 | Not Available | 580 | Open in IMG/M |
3300005527|Ga0068876_10077499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1997 | Open in IMG/M |
3300005527|Ga0068876_10364309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300005527|Ga0068876_10765741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 512 | Open in IMG/M |
3300005581|Ga0049081_10164207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300005582|Ga0049080_10084067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
3300005582|Ga0049080_10149459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300005582|Ga0049080_10244234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300005583|Ga0049085_10291683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300005585|Ga0049084_10011497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3636 | Open in IMG/M |
3300006484|Ga0070744_10011890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2583 | Open in IMG/M |
3300007544|Ga0102861_1124670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300007548|Ga0102877_1210944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300007562|Ga0102915_1064536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
3300007630|Ga0102903_1162437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300007708|Ga0102859_1180556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300007972|Ga0105745_1227067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300007972|Ga0105745_1261267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300007973|Ga0105746_1225188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300007974|Ga0105747_1282413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300008120|Ga0114355_1109277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
3300008961|Ga0102887_1277837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300009049|Ga0102911_1140892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300009068|Ga0114973_10400204 | Not Available | 719 | Open in IMG/M |
3300009068|Ga0114973_10636131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300009151|Ga0114962_10148033 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
3300009152|Ga0114980_10406632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300009152|Ga0114980_10649880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300009155|Ga0114968_10372082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300009155|Ga0114968_10468206 | Not Available | 680 | Open in IMG/M |
3300009160|Ga0114981_10515184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300009180|Ga0114979_10575976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300009180|Ga0114979_10739703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300009181|Ga0114969_10626304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300009183|Ga0114974_10618530 | Not Available | 595 | Open in IMG/M |
3300010160|Ga0114967_10207535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300010312|Ga0102883_1153872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300010334|Ga0136644_10377034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300010885|Ga0133913_10744983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2559 | Open in IMG/M |
3300010885|Ga0133913_12181153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1367 | Open in IMG/M |
3300010885|Ga0133913_12222398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1351 | Open in IMG/M |
3300011010|Ga0139557_1027960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300011010|Ga0139557_1075532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300011011|Ga0139556_1029841 | Not Available | 799 | Open in IMG/M |
3300011268|Ga0151620_1051752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1353 | Open in IMG/M |
3300012000|Ga0119951_1072590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300012012|Ga0153799_1022930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
3300012663|Ga0157203_1001559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5560 | Open in IMG/M |
3300012665|Ga0157210_1002816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4268 | Open in IMG/M |
3300012667|Ga0157208_10013172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
3300013285|Ga0136642_1179660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300013372|Ga0177922_10165651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2835 | Open in IMG/M |
3300013372|Ga0177922_10581259 | Not Available | 558 | Open in IMG/M |
3300013372|Ga0177922_10732260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300013372|Ga0177922_10817960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300017716|Ga0181350_1020267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1865 | Open in IMG/M |
3300017722|Ga0181347_1010086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3063 | Open in IMG/M |
3300017722|Ga0181347_1064989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1082 | Open in IMG/M |
3300017723|Ga0181362_1043954 | Not Available | 937 | Open in IMG/M |
3300017723|Ga0181362_1057959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300017723|Ga0181362_1112697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300017761|Ga0181356_1183173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300017761|Ga0181356_1216667 | Not Available | 559 | Open in IMG/M |
3300017766|Ga0181343_1132247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
3300017774|Ga0181358_1165295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300017774|Ga0181358_1217670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300017774|Ga0181358_1237379 | Not Available | 579 | Open in IMG/M |
3300017777|Ga0181357_1001260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9992 | Open in IMG/M |
3300017777|Ga0181357_1268938 | Not Available | 587 | Open in IMG/M |
3300017778|Ga0181349_1262684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300017780|Ga0181346_1271398 | Not Available | 585 | Open in IMG/M |
3300017784|Ga0181348_1034351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2123 | Open in IMG/M |
3300017785|Ga0181355_1189086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300017785|Ga0181355_1336154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300019784|Ga0181359_1166310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300020141|Ga0211732_1326653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300020159|Ga0211734_10040998 | Not Available | 611 | Open in IMG/M |
3300020159|Ga0211734_10626616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 913 | Open in IMG/M |
3300020159|Ga0211734_10640500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 899 | Open in IMG/M |
3300020160|Ga0211733_11061961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3306 | Open in IMG/M |
3300020161|Ga0211726_10039118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1498 | Open in IMG/M |
3300020161|Ga0211726_11067905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300020162|Ga0211735_10457885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300020172|Ga0211729_10213538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
3300020205|Ga0211731_11602709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2962 | Open in IMG/M |
3300020527|Ga0208232_1003872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2553 | Open in IMG/M |
3300021519|Ga0194048_10050842 | All Organisms → Viruses → Predicted Viral | 1675 | Open in IMG/M |
3300021519|Ga0194048_10231033 | Not Available | 678 | Open in IMG/M |
3300021961|Ga0222714_10215141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300021962|Ga0222713_10431290 | Not Available | 804 | Open in IMG/M |
3300021962|Ga0222713_10456498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300022190|Ga0181354_1009105 | Not Available | 2858 | Open in IMG/M |
3300022407|Ga0181351_1170376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300024346|Ga0244775_11076195 | Not Available | 631 | Open in IMG/M |
3300024346|Ga0244775_11076435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300024481|Ga0256330_1031014 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
3300024562|Ga0256336_1077697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300024573|Ga0256337_1086142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300027144|Ga0255102_1053005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300027608|Ga0208974_1055756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
3300027621|Ga0208951_1189584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300027649|Ga0208960_1037692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1661 | Open in IMG/M |
3300027656|Ga0209357_1038051 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
3300027679|Ga0209769_1096456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
3300027679|Ga0209769_1102244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300027688|Ga0209553_1129562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300027688|Ga0209553_1156955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300027688|Ga0209553_1204072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300027732|Ga0209442_1000682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19758 | Open in IMG/M |
3300027732|Ga0209442_1332281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300027741|Ga0209085_1073372 | All Organisms → Viruses → Predicted Viral | 1547 | Open in IMG/M |
3300027744|Ga0209355_1012809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4370 | Open in IMG/M |
3300027744|Ga0209355_1123122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1141 | Open in IMG/M |
3300027747|Ga0209189_1184972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300027756|Ga0209444_10014128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4058 | Open in IMG/M |
3300027756|Ga0209444_10092107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300027756|Ga0209444_10223706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300027770|Ga0209086_10017092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4669 | Open in IMG/M |
3300027770|Ga0209086_10132469 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
3300027770|Ga0209086_10352192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300027772|Ga0209768_10062149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1929 | Open in IMG/M |
3300027785|Ga0209246_10000238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25231 | Open in IMG/M |
3300027798|Ga0209353_10390748 | Not Available | 573 | Open in IMG/M |
3300027804|Ga0209358_10202381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
3300027808|Ga0209354_10251592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300027816|Ga0209990_10092889 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
3300027816|Ga0209990_10521731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300027836|Ga0209230_10291932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300027836|Ga0209230_10571229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300027892|Ga0209550_10779546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300027963|Ga0209400_1003371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11642 | Open in IMG/M |
3300027963|Ga0209400_1127189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300027973|Ga0209298_10070579 | All Organisms → Viruses | 1575 | Open in IMG/M |
3300027974|Ga0209299_1110529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1329517 | Not Available | 516 | Open in IMG/M |
3300031857|Ga0315909_10134259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2067 | Open in IMG/M |
3300031857|Ga0315909_10206930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1548 | Open in IMG/M |
3300031857|Ga0315909_10503277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300031951|Ga0315904_10481470 | Not Available | 1100 | Open in IMG/M |
3300032050|Ga0315906_10618077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
3300032092|Ga0315905_10442473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1211 | Open in IMG/M |
3300032093|Ga0315902_10155966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2366 | Open in IMG/M |
3300032093|Ga0315902_10808752 | Not Available | 739 | Open in IMG/M |
3300032116|Ga0315903_10395188 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300033992|Ga0334992_0482004 | Not Available | 540 | Open in IMG/M |
3300033996|Ga0334979_0260339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 999 | Open in IMG/M |
3300034018|Ga0334985_0374803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300034062|Ga0334995_0269788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1133 | Open in IMG/M |
3300034066|Ga0335019_0170091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1425 | Open in IMG/M |
3300034102|Ga0335029_0363185 | Not Available | 888 | Open in IMG/M |
3300034102|Ga0335029_0636716 | Not Available | 590 | Open in IMG/M |
3300034104|Ga0335031_0548486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 693 | Open in IMG/M |
3300034104|Ga0335031_0764007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300034108|Ga0335050_0393882 | Not Available | 625 | Open in IMG/M |
3300034110|Ga0335055_0455133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300034117|Ga0335033_0386359 | Not Available | 694 | Open in IMG/M |
3300034200|Ga0335065_0456140 | Not Available | 773 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 31.82% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.95% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.68% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.11% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.11% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.27% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.27% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.70% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.70% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.14% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.14% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.14% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.14% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1096290671 | 3300002408 | Freshwater | KIVTKTQVIKERGEEIIKYVDKEIVKYDTKFLPGGECEIPKEFIVLHNKAAEVPK* |
B570J40625_1013735683 | 3300002835 | Freshwater | IVRYVDREIIKYDEKFAKGGICEIPQEFIKAHNDAAESVK* |
B570J40625_1017510571 | 3300002835 | Freshwater | AEVIKYIDREIVKYDTKFAPGGICELPKEFFISHNEAAKERR* |
JGI25908J49247_100820923 | 3300003277 | Freshwater Lake | QDVVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNRAAEAPK* |
JGI25908J49247_101576952 | 3300003277 | Freshwater Lake | GQDVVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNKAAEALK* |
JGI25911J50253_100112089 | 3300003411 | Freshwater Lake | VVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNKAAEALK* |
JGI25911J50253_101191603 | 3300003411 | Freshwater Lake | IKYVDREIVKYDTKFAPGGICEIPKEFIKAHNDAAELPK* |
JGI25912J50252_1000681511 | 3300003412 | Freshwater Lake | DVVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNKAAEAXK* |
Ga0007792_101007971 | 3300004805 | Freshwater | IKTRGQDIVKYIDREVVKYDTKFAPGGECEIPKEFIKALNDAAEAPK* |
Ga0070374_106435941 | 3300005517 | Freshwater Lake | VKVRGNDIVKYVDREIVKYDTKFAPGGICEIPKEFIKAHNDSAEVPK* |
Ga0068877_106309542 | 3300005525 | Freshwater Lake | DREIVKYDVKFAPGGQCEIPREFITTINRAAEAPKNETK* |
Ga0068876_100774995 | 3300005527 | Freshwater Lake | VKKEYIKTRGRDIVKYIDKEIVKYDTKFAPGGQCEIPKEFYKALNDAAQEPTK* |
Ga0068876_103643093 | 3300005527 | Freshwater Lake | YITVRGQEIVKYIDREIVKYDEKFAAGGQCEIPKEFIEAHNKAAAQPEQKK* |
Ga0068876_107657412 | 3300005527 | Freshwater Lake | VDREIVKYDTKFAPGGECAIPPEFIKAHNMAAEAPKHESK* |
Ga0049081_101642071 | 3300005581 | Freshwater Lentic | DIVKYVDREVVKYDTKFAPGGQCEIPKEFIKAINDAAEAPK* |
Ga0049080_100840671 | 3300005582 | Freshwater Lentic | KTRGKDIVTYIDKEVVKYDTKFLPGGQCEIPKEFIEAHNKAAEALK* |
Ga0049080_101494593 | 3300005582 | Freshwater Lentic | EVIKYVDREVVKYDTKFAPGGICEIPKEFFIAHNDAAKEPR* |
Ga0049080_102442343 | 3300005582 | Freshwater Lentic | EYITKRGQDIIQYVDREIVKYDTKFAPGGICEIPKEFIEAHNRAAEAPK* |
Ga0049085_102916831 | 3300005583 | Freshwater Lentic | VRVQGAEVIKYVDREVVKYDTKFAPGGICEIPKEFFTAHDDAAKDSR* |
Ga0049084_100114971 | 3300005585 | Freshwater Lentic | IVKQKGQDIVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNRAATK* |
Ga0070744_100118901 | 3300006484 | Estuarine | RELVKYDTKFAAGGQCEIPKEFIKAHNMAAEKIPEDKK* |
Ga0102861_10538671 | 3300007544 | Estuarine | QIVRQYIDREVIKYDTKFLPSGQCEIPQEFIQAHNKSAERTK* |
Ga0102861_11246703 | 3300007544 | Estuarine | RGQDIIQYVDKEVAKYDDRFRPGGQCELPKEFIKAINNASEAPK* |
Ga0102877_12109443 | 3300007548 | Estuarine | DREVVKYDTKFAPGGICELPKEFFIAHNNAAKDSR* |
Ga0102915_10645361 | 3300007562 | Estuarine | DKEIVKYDTKFLPGGECEIPKEFIQVHKKAAEEPK* |
Ga0102903_11624371 | 3300007630 | Estuarine | VIKYVDREVVKYDTKFAPGGICEIPKEFFIAHDDAAKERRDAK* |
Ga0102859_11805561 | 3300007708 | Estuarine | KTEYIKTRGQDVVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNRAAEAPK* |
Ga0105745_12270671 | 3300007972 | Estuary Water | TRRGQDIIQYVDKEVAKYDDRFRPGGQCELPKEFIKAINNASEAPK* |
Ga0105745_12612673 | 3300007972 | Estuary Water | VKYDTKFAPGGICEIPKEFFIAHDDAAKERRDAK* |
Ga0105746_12251881 | 3300007973 | Estuary Water | ITRRGQDIIQYVDKEVAKYDDRFRPGGQCELPKEFIKAINNASEAPK* |
Ga0105747_12824131 | 3300007974 | Estuary Water | QGAEVIKYVDREVVKYDTKFAPGGICEIPKEFFTAHDDAAKDSR* |
Ga0114355_11092774 | 3300008120 | Freshwater, Plankton | QGREVVKYIDREIVKYDTKFAPGGQCEIPKEFIKAHNDAAEAPK* |
Ga0102887_12778371 | 3300008961 | Estuarine | QGAEVIKYVDREVVKYDIKFAPGGICEIPKEFFIAHNDAAKDSR* |
Ga0102831_12079361 | 3300008996 | Estuarine | IVRQYIDREVIKYDTKFLPSGQCEIPQEFIQAHNK* |
Ga0102911_11408923 | 3300009049 | Estuarine | QGNEVIKYVDREVVKYDTKFAPGGICEIPKEFFIAHDDAAKERRDAK* |
Ga0114973_104002041 | 3300009068 | Freshwater Lake | REVVKYDTKFLPGGQCEIPKEFIEAHNKSAERAK* |
Ga0114973_106361313 | 3300009068 | Freshwater Lake | GNEVIKYVDREVVKYDTKFAPGGICEIPKEFFIAHNDAAKEPR* |
Ga0114962_101480331 | 3300009151 | Freshwater Lake | IKYIDREIVRYDEKFAKGGMCEIPQEFIKAHNAAAEQPK* |
Ga0114980_104066321 | 3300009152 | Freshwater Lake | IVKYVDREIVKYDTKFAPGGICEIPQEFITAHNRAAEVPAK* |
Ga0114980_106498801 | 3300009152 | Freshwater Lake | KGQDIIRYVDKEVVKYDTKFAPGGVCEIPKEFIKALNDAAEAPK* |
Ga0114968_103720821 | 3300009155 | Freshwater Lake | KEMAKYDDRFKPGGQCELPKEFIKAINNASEAPK* |
Ga0114968_104682063 | 3300009155 | Freshwater Lake | MKYITRRGQDIIQYVDKEVVKYDTKFAPSGVCELPKEFIKAI |
Ga0114981_105151841 | 3300009160 | Freshwater Lake | IKTKGKDIVKYVDREVVKYDTKFAPGGDCEIPKEFIKALNDASEAPK* |
Ga0114979_105759761 | 3300009180 | Freshwater Lake | KEVVKYDDKFKPTGQCELPKEFIKAINTAAEAPK* |
Ga0114979_107397031 | 3300009180 | Freshwater Lake | KYVDREIVKYDTKFSPGGVCEIPKEFIKAHNDAAEAPK* |
Ga0114969_106263043 | 3300009181 | Freshwater Lake | VDKEMAKYDDRFKPGGQCELPKEFIKAINNASEAPK* |
Ga0114974_106185301 | 3300009183 | Freshwater Lake | RGEEVIKYIDREVVKYDTKFIQGGDCELPNEFFDALNQAAGVGK* |
Ga0114971_104452161 | 3300009185 | Freshwater Lake | TQIVRQYIDREVVRYDTKFLPGGQCEIPQEFIQAHNKSAERTK* |
Ga0114967_102075351 | 3300010160 | Freshwater Lake | DIIQYVDKEVVKYDTKFAPSGVCELPKEFIKAINNAAETPK* |
Ga0102883_11538721 | 3300010312 | Estuarine | IKYVDREVVKYDTKFAPGGICEIPKEFFIAHNDAAKDSR* |
Ga0136644_103770343 | 3300010334 | Freshwater Lake | QVIKTRGEDIIKYVDREIVKYDTKFAPGGECEIPKEFIKAINDAAEAPK* |
Ga0133913_107449831 | 3300010885 | Freshwater Lake | REVVKYDTKFLPGGQCEIPQEFIQAHNKSAERTK* |
Ga0133913_121811534 | 3300010885 | Freshwater Lake | KYIDREIVKYDEKFAKGGVCEIPQEFIDAHNRAAEAPK* |
Ga0133913_122223981 | 3300010885 | Freshwater Lake | KYIDREIVKYDTKFAPGGQCEIPKEFIKAINDAAEAPK* |
Ga0139557_10279604 | 3300011010 | Freshwater | DREVVKYDTKFAPGGQCEIPKEFIKAINDAAEAPK* |
Ga0139557_10755323 | 3300011010 | Freshwater | IIQYVDREVVKYDTKFAPGGVCEIPKEFIKALNDAAEAPK* |
Ga0139556_10298411 | 3300011011 | Freshwater | RRGNDIVTYVDREIVKYDTKFAPGGICEIPKEFIKAHNDAADQPK* |
Ga0151620_10517524 | 3300011268 | Freshwater | KTQIVRVKGDEIVKYIDREIVKYDDKFSKGNQCEIPKEFYQALNKAAEVPK* |
Ga0119951_10725901 | 3300012000 | Freshwater | VQIVKTRGQDIVKYIDREVVKYDTKFAPGGECEIPKEFIKSINDAAEASK* |
Ga0153799_10229301 | 3300012012 | Freshwater | VRTRGEDIVKYVDREVVKYDTKFAPGGICEIPKEFIKAHNDAAEAPK* |
Ga0157203_10015597 | 3300012663 | Freshwater | XIVKTRGEDIVKYVDREVVKYDTKFAPGGICEIPKEFIKAHNDAAEAPK* |
Ga0157210_100281611 | 3300012665 | Freshwater | IIQYVDKEIVKYDTKFLPGGECEIPKEFIYAHNKAAETPK* |
Ga0157210_10064274 | 3300012665 | Freshwater | YIDREVVQHDTKFSPGGQCEIPQEFIQAHDKSAERPK* |
Ga0157208_100131724 | 3300012667 | Freshwater | YIDREVVRYDTKFAPGGVCEISPEFVKAHNSAAQGIVK* |
Ga0136642_11796601 | 3300013285 | Freshwater | RGEDIVKYVDREVVKYDTKFAPGGECEIPKEFIKALNDAAEPPK* |
Ga0177922_101656519 | 3300013372 | Freshwater | VKYVDREVVKYDTKFAPGGICEIPKEFIKAHNDAAEAPK* |
Ga0177922_105812591 | 3300013372 | Freshwater | IIKYVDREVVKYDVKFAPGGVCEIPQEFITAYNRAAEVPSK* |
Ga0177922_107322601 | 3300013372 | Freshwater | IQYVDREVVKYDTKFAPSGVCEMPNEFIKAINTAAEAPQ* |
Ga0177922_108179601 | 3300013372 | Freshwater | KYIDREIVQYDTKFAPGGQCEIPREFIKALNDAAEAPK* |
Ga0177922_110448661 | 3300013372 | Freshwater | QIVRQYIDREVVKYDTKFLPGGQCEIPQEFIQAHNKSTERTK* |
Ga0181350_10202671 | 3300017716 | Freshwater Lake | QIIRTRGETITKYIDREIVKYDTKFAPGGQCEIPQEFIKAINDAAEAPK |
Ga0181350_11345682 | 3300017716 | Freshwater Lake | RQYIDREVIKYDTKFLPGGQCEIPQEFIQAHDKSTERLK |
Ga0181347_10100866 | 3300017722 | Freshwater Lake | VTKTQIIRTRGETITKYIDREIVKYDTKFAPGGQCEIPQEFIKAINDAAEAPK |
Ga0181347_10649891 | 3300017722 | Freshwater Lake | GQDIIQYVDKEVVKYDTKFAPSGQCELPKEFIKAINNAAEIPK |
Ga0181362_10439541 | 3300017723 | Freshwater Lake | REKGDEVIKYIDREIVKYDVKFAPGGQCEIPKEFVEAVNKAAKDGK |
Ga0181362_10579591 | 3300017723 | Freshwater Lake | DIIQYVDREIVKYDTKFAPGGVCEIPKEFIKALNDAAEAPK |
Ga0181362_11126973 | 3300017723 | Freshwater Lake | DREVVKYDTKFLPGGVCEIPKEFVKAHNDAATPVEAKK |
Ga0181356_11831731 | 3300017761 | Freshwater Lake | DREVVKYDTKFAPGGICELPKEFFIAHNDAAKERRDVK |
Ga0181356_12166671 | 3300017761 | Freshwater Lake | TQIIRTRGETITKYIDREIVKYDTKFAPGGQCEIPREFIKVINDAAEAPK |
Ga0181343_11322473 | 3300017766 | Freshwater Lake | YIKTRGRDIVKYIDKEIVKYDTTFMPGGQCEIPKEFYKALNDAAQEPNK |
Ga0181358_11652953 | 3300017774 | Freshwater Lake | VKYVDREVVKYDTKFAPGGVCEIPKEFIKAHNDAAEAPK |
Ga0181358_12176701 | 3300017774 | Freshwater Lake | ITRKGNDVIQYVDREIVKYDTKFATGGQCEIPKEFIKAHNDATEVSK |
Ga0181358_12373793 | 3300017774 | Freshwater Lake | KYKKKIVYEKGDEVIKYIDREIVKYDVKFAPGGMCEIPKEFIDALNKAAE |
Ga0181358_12790362 | 3300017774 | Freshwater Lake | RQYIDREVIKYDTKFLSGGQCEIPQEFIQAHNKSAERPK |
Ga0181357_100126014 | 3300017777 | Freshwater Lake | VVQYIDREVVKYDTKFLPGGVCEIPKEFVKAHNDSATPVEAKK |
Ga0181357_12689381 | 3300017777 | Freshwater Lake | GRTEVVRQYVDREVVKYDTKFMPGGVCEIPREFVKAHNDAAEGPKK |
Ga0181349_12626841 | 3300017778 | Freshwater Lake | VVKYDTKFLPGGVCEIPKEFVKAHNDAATPVEAKK |
Ga0181346_12713981 | 3300017780 | Freshwater Lake | RGEDIVKYIDREIVKYDTKFAAGGVCEIPQEFITAHNRAAEAPPK |
Ga0181348_10343516 | 3300017784 | Freshwater Lake | YIDREVVKYDTKFLPGGVCEIPKEFVKAHNDSATPVEAKK |
Ga0181355_11890861 | 3300017785 | Freshwater Lake | ETITKYIDREIVKYDTKFAPGGQCEIPREFIKAINDAAEAPK |
Ga0181355_13361543 | 3300017785 | Freshwater Lake | DKEIIKYDVKFAPGGQCEIPKEFITIHNKAAEEIK |
Ga0181359_11663101 | 3300019784 | Freshwater Lake | YIDREIIKYDVKFAPGGQCEIPKEFVEAVNKAAKDGK |
Ga0211732_13266533 | 3300020141 | Freshwater | GAEVIKYVDREVVKYDTKFAPGGICELPKEFFIAHNNAAKDSR |
Ga0211734_100409981 | 3300020159 | Freshwater | KYIRGRTEIVREYIDREVVKYDTKFMPGGICEIPREFVKAHNDAAEGPKK |
Ga0211734_106266161 | 3300020159 | Freshwater | QVIRTRGETITKYIDREIVQYDTKFAPGGQCEIPQEFIKAHNSAAEAPK |
Ga0211734_106405001 | 3300020159 | Freshwater | QVIRTRGETITKYIDREIVQYDTKFAPGGQCEIPREFIKAHNDAAEAPK |
Ga0211733_110619618 | 3300020160 | Freshwater | YVDREVVKYDTKFVPGGICEIPREFIKAHNDAAEGPKK |
Ga0211726_100391181 | 3300020161 | Freshwater | EEIVKYVDREVVKYDTKFMPGGICEIPREFIKSHNDAAEAPKK |
Ga0211726_110679051 | 3300020161 | Freshwater | KYIDREIVKYDVKFAPGGQCEIPKEFVESINKAAKDGK |
Ga0211735_104578852 | 3300020162 | Freshwater | EKIQIVRQRGDDIIKYVDREVVKYDDKFAPGAQCELPKEFIQALNKAAEAPSK |
Ga0211729_102135381 | 3300020172 | Freshwater | GEEIVKYVDREVVKYDTKFMPGGICEIPREFIKAHNDAAEAPKK |
Ga0211729_103139471 | 3300020172 | Freshwater | TQIVRQYIDREVVRYDTKFLPGGQCEIPQEFIQAHNKSAERTK |
Ga0211731_116027099 | 3300020205 | Freshwater | KYVDREVVKYDTKFAPGGQCEIPKEFIKAINDAAEAPK |
Ga0208232_10038726 | 3300020527 | Freshwater | YFSDIIQYVDREIVKYDVKFAPGGQCEIPREFITTINRAAEAPKNETK |
Ga0194048_100508421 | 3300021519 | Anoxic Zone Freshwater | YIDREIVKYDTKFAPGGQCEIPKDFIKALNDAAETPK |
Ga0194048_102310331 | 3300021519 | Anoxic Zone Freshwater | VIKYIDKEVVKYDTKFLPGGPCEMPKEFIESINKAAE |
Ga0222714_102151413 | 3300021961 | Estuarine Water | GEEVIKYVDREVVKYDVKFAPGGQCEIPTEFVKAINDASEPPK |
Ga0222713_104312901 | 3300021962 | Estuarine Water | TQIVRQYIDREVVRYDTKFAPGGVCEIPREFVKAHNSAAETPQ |
Ga0222713_104564983 | 3300021962 | Estuarine Water | VQYVDREIVKYDTKFAPGGICEIPKEFIEAHNRAAEAPK |
Ga0181354_10091051 | 3300022190 | Freshwater Lake | RTRGETITKYIDREIVKYDTKFAPGGQCEIPSEFIKAINDAAEAPK |
Ga0181351_11703761 | 3300022407 | Freshwater Lake | KGQDIIQYVDREVVKYDTKFAPSGVCELPNEFIKAINNAAEAPK |
Ga0244775_110761951 | 3300024346 | Estuarine | NIVKYVDREVIKYDTKFAPGGQCELPREFVKAINDAAEAPK |
Ga0244775_110764353 | 3300024346 | Estuarine | YITRRGQDIIQYVDKEVAKYDDRFRPGGQCELPKEFIKAINNASEAPK |
Ga0256330_10310144 | 3300024481 | Freshwater | VKYVDREIVKYDTKFAPGGVCEIPKEFIEAHNKAAEAPK |
Ga0256336_10776971 | 3300024562 | Freshwater | RGQDIVKYEDREIVKYDTKFAPGGVCEIPKEFIEAHNKAAEAPK |
Ga0256337_10861421 | 3300024573 | Freshwater | QDIVKYVDREIVKYDTKFAPGGVCEIPKEFIEAHNKAAEAPK |
Ga0255102_10530051 | 3300027144 | Freshwater | REVVKYDTKFAPGGICELPKEFFIAHNDAAKERRDVK |
Ga0208974_10557561 | 3300027608 | Freshwater Lentic | YVDREVVKYDDRFRPGGQCELPKEFIKAINTAAEAPK |
Ga0208951_11895841 | 3300027621 | Freshwater Lentic | DREVAKYDDRFRPGGQCELPKEFIKAINNASEAPK |
Ga0208960_10376923 | 3300027649 | Freshwater Lentic | IVKQKGQDIVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNRAATK |
Ga0209357_10380511 | 3300027656 | Freshwater Lake | GAEVIKYVDREVVKYDTKFAPGGICEIPKEFFIAHDDAAKERRDAK |
Ga0209769_10964561 | 3300027679 | Freshwater Lake | IIRTRGETITKYIDREIVKYDTKFAPGGQCEIPREFIKAINDAAEAPK |
Ga0209769_11022443 | 3300027679 | Freshwater Lake | VQIVKTRGQDIVKYVDREVVKYDTKFAPGGICEIPKEFIKAHNDAAEAPK |
Ga0209553_11295621 | 3300027688 | Freshwater Lake | IVKYVDREIVKYDTKFAPGGICEIPKEFIKAHNDSAEVPK |
Ga0209553_11569553 | 3300027688 | Freshwater Lake | YIDKEIVKYDTKFLPGGQCEIPKEFIEAHNKAAEAPK |
Ga0209553_12040723 | 3300027688 | Freshwater Lake | EYIKTRGEDIVKYIDREIVKYDTKFAPGGQCELPKEFIQAHNLAAEAPK |
Ga0209442_10006821 | 3300027732 | Freshwater Lake | RGQDIVKYIDREVVKYDTKFTSGGECEIPKEFIKSINDAAEAPK |
Ga0209442_13322811 | 3300027732 | Freshwater Lake | TRRGQDIIQYVDKEVAKYDDRFRPGGQCELPKEFIKAINNASEAPK |
Ga0209085_10733726 | 3300027741 | Freshwater Lake | ITRRGQDIIQYVDKEMAKYDDRFKPGGQCELPKEFIKAINNASEAPK |
Ga0209355_101280910 | 3300027744 | Freshwater Lake | VKYVDREVVRYDTKFAPGGVCEIPKEFIKAHNDAAEAPK |
Ga0209355_11231223 | 3300027744 | Freshwater Lake | IRTRGETITKYIDREIVKYDTKFAPGGQCEIPREFIKVINDAAEAPK |
Ga0209189_11849721 | 3300027747 | Freshwater Lake | ITRRGQDIIQYVDKEVVKYDTKFAPSGVCELPKEFIKAINNAAETPK |
Ga0209444_100141287 | 3300027756 | Freshwater Lake | VQYIDREVVKYDTKFLPGGVCEIPKEFVKAHNDSATPVEAKK |
Ga0209444_100921071 | 3300027756 | Freshwater Lake | VQYIDREVVKYDTKFLPGGVCEIPKEFVKAHNDAATPVEAKK |
Ga0209444_101387111 | 3300027756 | Freshwater Lake | TQIVRQYIDREVIKYDTKFLPGGQCEIPQEFIQAHNKSAERTK |
Ga0209444_102237061 | 3300027756 | Freshwater Lake | IKYIDREIVKYDVKFAPGGQCEIPKEFVEAINKAAKDGK |
Ga0209086_1001709211 | 3300027770 | Freshwater Lake | VDREIVKYDEKFAPGGECEIPREFIKALNDAAEAPK |
Ga0209086_101324691 | 3300027770 | Freshwater Lake | GAEVIKYVDREVVKYDTKFAPGGICEIPKEFFIAHNDAAKDSR |
Ga0209086_103521921 | 3300027770 | Freshwater Lake | IVKYIDREIVKYDTKFAPGGQCEIPKEFIKAINDAAEAPK |
Ga0209768_100621491 | 3300027772 | Freshwater Lake | GENIIKYVDREIVKYDTKFAPGGICEIPKEFIKAHNDAAELPK |
Ga0209246_100002381 | 3300027785 | Freshwater Lake | IVKYIDREVVKYDTKFTSGGECEIPKEFIKSINDAAEAPK |
Ga0209353_103907481 | 3300027798 | Freshwater Lake | IRTRGETITKYIDREIVKYDTKFAPGGQCEIPSEFIKAINDAAEAPK |
Ga0209358_102023814 | 3300027804 | Freshwater Lake | TEYITQYVDREVVKYDVKFAPGGECELPKEFVKSLNLAAERPAK |
Ga0209354_102515921 | 3300027808 | Freshwater Lake | KTRGQDVVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNRAAEAPK |
Ga0209990_100928895 | 3300027816 | Freshwater Lake | IVKQKGQDIVKYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNRAAEAPK |
Ga0209990_105217313 | 3300027816 | Freshwater Lake | QEIVKYIDREIVKYDEKFAAGGQCEIPKEFIEAHNKAAAQPEQKK |
Ga0209230_102919323 | 3300027836 | Freshwater And Sediment | RGQDIIQYVDREVAKYDDRFRPGGQCELPKEFIKAINNASEAPK |
Ga0209230_105712291 | 3300027836 | Freshwater And Sediment | VDREVVKYDTKFASGGICEIPKEFFTTHDDAAKDSR |
Ga0209550_107795463 | 3300027892 | Freshwater Lake | NEVIKYVDREVVKYDTKFAPGGICEIPKEFFIAHNDAAKERRDVK |
Ga0209400_10033711 | 3300027963 | Freshwater Lake | VDKEMVKYDDRFRPGGQCELPKEFIKAINNASEAPK |
Ga0209400_11271891 | 3300027963 | Freshwater Lake | YIDREIVKYDTKFAPGGQCEIPKEFIKAINDAAEAPK |
Ga0209298_100705793 | 3300027973 | Freshwater Lake | RRGNDIVKYVDREIVKYDTKFAPGGICEIPKEFIKAHNDAAEAPRK |
Ga0209299_11105293 | 3300027974 | Freshwater Lake | KTKVIKTKGKDIVKYVDREVVKYDTKFAPGGDCEIPKEFIKALNDASEAPK |
(restricted) Ga0247834_13295172 | 3300027977 | Freshwater | IRTRGENIVKYVDREVVKYNTKFAPGEQCELPQEFVKAINDAAEAPK |
Ga0315909_101342595 | 3300031857 | Freshwater | TIKYIRGRTEIVKQYVDREVIKYDTKFMPGGICEIPREFIKAHNDAAEGPKK |
Ga0315909_102069306 | 3300031857 | Freshwater | EYITQYVDREVVKYDVKFAPGGECEIPKEFVKSLNLAAERPTK |
Ga0315909_105032774 | 3300031857 | Freshwater | YIKTRGEDIVKYVDREVVKYDTKFAPGGQCEIPKEFIKAINDAAEAPK |
Ga0315904_104814701 | 3300031951 | Freshwater | TRRGKDVIQYVDREIVKYDTKFAPGGACEIPREFVTAHNTAAEAPKK |
Ga0315906_106180773 | 3300032050 | Freshwater | EIVKYDTKFAPGGECAIPPEFIKAHNMAAEAPKHESK |
Ga0315905_104424734 | 3300032092 | Freshwater | IQGAEVIKYVDREVVKYDTKFVPGGICELPKEFFIAHNDAAKDSR |
Ga0315902_101559661 | 3300032093 | Freshwater | RRGQDIIQYVDREVAKYDDRFRPGGQCELPKEFIKAINNASEAPK |
Ga0315902_108087521 | 3300032093 | Freshwater | QYVDREIVKYDTKFAPGGACEIPREFVTAHNTAAEAPKK |
Ga0315903_103951884 | 3300032116 | Freshwater | KYIDKEIVKYDTKFLPGGQCEIPKEFIEAHNRAAEAPK |
Ga0334992_0482004_396_539 | 3300033992 | Freshwater | GQDIIQYVDREIVKYDVKFAPGGQCEIPREFITTINRAAEAPKNETK |
Ga0334979_0260339_848_997 | 3300033996 | Freshwater | QVIRTRGADIVKYVDREIVRYDEKFARGGMCEIPQEFIKAHNSAAEAPK |
Ga0334985_0374803_2_115 | 3300034018 | Freshwater | YVDREVVKYDTKFAPGGICEIPKEFFIAHNDAAKEPR |
Ga0334995_0269788_1010_1132 | 3300034062 | Freshwater | ITKYIDREIVKYDEKFAQGSMCEIPQEFIKAHNSAAEAPK |
Ga0335019_0170091_1316_1423 | 3300034066 | Freshwater | DREIVRYDEKFAKGGMCEIPQEFIKAHNSAAEAPK |
Ga0335029_0363185_770_886 | 3300034102 | Freshwater | KYIDREIVRYDEKFAKGGICEIPQEFIQAHNSAAEAPK |
Ga0335029_0636716_438_590 | 3300034102 | Freshwater | TQVIRTRGADIVKYVDREIVRYDEKFAKGGICEIPQEFIKAHNSAAEAPK |
Ga0335031_0548486_583_693 | 3300034104 | Freshwater | IDREIVRYDEKFAKGGMCEIPQEFIKAHNSAAEAPK |
Ga0335031_0764007_1_123 | 3300034104 | Freshwater | VIKYVDKEIVKFDTKFLPGGECEIPKEFIFAHNKAAEAPK |
Ga0335050_0393882_2_124 | 3300034108 | Freshwater | IQYVDREIVRYDTKFAPGGQCEIPREFIKALNQAAEAPPK |
Ga0335055_0455133_372_518 | 3300034110 | Freshwater | VIRTRGADIVKYVDREIVRYDEKFAKGGICEIPQEFIKAHNSAAEAPK |
Ga0335033_0386359_576_692 | 3300034117 | Freshwater | QYVDREVVKYDTKFAPGGTCEIPQEFITAHNRAAEPVK |
Ga0335065_0456140_666_773 | 3300034200 | Freshwater | REIVRYDTKFAPGGQCEIPREFIKALNQAAEAPPK |
⦗Top⦘ |