NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F033801

Metagenome Family F033801

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033801
Family Type Metagenome
Number of Sequences 176
Average Sequence Length 45 residues
Representative Sequence MKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG
Number of Associated Samples 113
Number of Associated Scaffolds 176

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 18.18 %
% of genes from short scaffolds (< 2000 bps) 72.16 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (77.841 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(20.454 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.89%    β-sheet: 25.00%    Coil/Unstructured: 61.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 176 Family Scaffolds
PF12705PDDEXK_1 14.77
PF00692dUTPase 9.09
PF01520Amidase_3 3.98
PF01555N6_N4_Mtase 1.14
PF05105Phage_holin_4_1 1.14
PF02511Thy1 0.57
PF04765DUF616 0.57
PF01507PAPS_reduct 0.57
PF13392HNH_3 0.57
PF01832Glucosaminidase 0.57
PF04586Peptidase_S78 0.57
PF05065Phage_capsid 0.57
PF01041DegT_DnrJ_EryC1 0.57
PF04466Terminase_3 0.57
PF04002RadC 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 176 Family Scaffolds
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 9.09
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 9.09
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 3.98
COG4824Phage-related holin (Lysis protein)Mobilome: prophages, transposons [X] 1.14
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.14
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.14
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.14
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.57
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.57
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 0.57
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.57
COG2003DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motifReplication, recombination and repair [L] 0.57
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 0.57
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 0.57
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.57
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.57
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.57
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.77 %
UnclassifiedrootN/A10.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001533|MLSed_10002036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage30357Open in IMG/M
3300001533|MLSed_10060556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2366Open in IMG/M
3300002296|B570J29587_1002075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis1816Open in IMG/M
3300002390|B570J29645_101752All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1431Open in IMG/M
3300002408|B570J29032_109135682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage607Open in IMG/M
3300002408|B570J29032_109245738All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300002835|B570J40625_100004108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage27278Open in IMG/M
3300002835|B570J40625_100155494All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2596Open in IMG/M
3300003393|JGI25909J50240_1059064Not Available786Open in IMG/M
3300005525|Ga0068877_10366486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300005527|Ga0068876_10179145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1236Open in IMG/M
3300005528|Ga0068872_10094118All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300005528|Ga0068872_10359622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300005528|Ga0068872_10420217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage726Open in IMG/M
3300005581|Ga0049081_10005725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4695Open in IMG/M
3300005581|Ga0049081_10334952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300005739|Ga0076948_1016700All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300005739|Ga0076948_1016701Not Available1293Open in IMG/M
3300005758|Ga0078117_1002045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage41370Open in IMG/M
3300005805|Ga0079957_1008821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7781Open in IMG/M
3300006484|Ga0070744_10012557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2513Open in IMG/M
3300006484|Ga0070744_10068031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1035Open in IMG/M
3300006484|Ga0070744_10227615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300006802|Ga0070749_10112162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1606Open in IMG/M
3300006802|Ga0070749_10144090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1388Open in IMG/M
3300006802|Ga0070749_10317950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage870Open in IMG/M
3300006805|Ga0075464_10222408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300007708|Ga0102859_1058908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1073Open in IMG/M
3300007708|Ga0102859_1105811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300007708|Ga0102859_1276371Not Available506Open in IMG/M
3300007960|Ga0099850_1251873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300008114|Ga0114347_1006166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6483Open in IMG/M
3300008122|Ga0114359_1055801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis1427Open in IMG/M
3300008266|Ga0114363_1021930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2800Open in IMG/M
3300008266|Ga0114363_1061820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis1452Open in IMG/M
3300008339|Ga0114878_1039175All Organisms → cellular organisms → Bacteria2073Open in IMG/M
3300008450|Ga0114880_1009508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4846Open in IMG/M
3300008450|Ga0114880_1020920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3048Open in IMG/M
3300008450|Ga0114880_1043156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1945Open in IMG/M
3300009009|Ga0105105_11012516Not Available517Open in IMG/M
3300009081|Ga0105098_10033770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2022Open in IMG/M
3300009081|Ga0105098_10400596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300009081|Ga0105098_10616580Not Available567Open in IMG/M
3300009081|Ga0105098_10672274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300009082|Ga0105099_10321159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage911Open in IMG/M
3300009082|Ga0105099_11057334All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300009085|Ga0105103_10222618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1014Open in IMG/M
3300009146|Ga0105091_10154731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1076Open in IMG/M
3300009149|Ga0114918_10266360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage969Open in IMG/M
3300009149|Ga0114918_10367726All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis790Open in IMG/M
3300009157|Ga0105092_10413049Not Available769Open in IMG/M
3300009158|Ga0114977_10048051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae2647Open in IMG/M
3300009165|Ga0105102_10120028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1254Open in IMG/M
3300009165|Ga0105102_10140608Not Available1169Open in IMG/M
3300009165|Ga0105102_10361821Not Available764Open in IMG/M
3300009165|Ga0105102_10786228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300009168|Ga0105104_10205065All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1071Open in IMG/M
3300009168|Ga0105104_10291121Not Available896Open in IMG/M
3300009169|Ga0105097_10014023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4172Open in IMG/M
3300009169|Ga0105097_10068065Not Available1930Open in IMG/M
3300009170|Ga0105096_10097470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1466Open in IMG/M
3300009170|Ga0105096_10293137All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300009170|Ga0105096_10649424All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300009183|Ga0114974_10010800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6613Open in IMG/M
3300009184|Ga0114976_10026243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3525Open in IMG/M
3300009450|Ga0127391_1108074All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300009451|Ga0127402_1100072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300009484|Ga0127411_1168778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300010354|Ga0129333_10689498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300010370|Ga0129336_10323470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage853Open in IMG/M
3300011009|Ga0129318_10209150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage626Open in IMG/M
3300012013|Ga0153805_1001795All Organisms → Viruses → Predicted Viral4154Open in IMG/M
3300012013|Ga0153805_1005161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2309Open in IMG/M
3300012013|Ga0153805_1010851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1566Open in IMG/M
3300012017|Ga0153801_1025774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1042Open in IMG/M
3300012348|Ga0157140_10003210All Organisms → Viruses → Predicted Viral1805Open in IMG/M
3300013004|Ga0164293_10132592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1873Open in IMG/M
3300013004|Ga0164293_10329214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1049Open in IMG/M
3300013004|Ga0164293_10496555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage806Open in IMG/M
3300013004|Ga0164293_10883787Not Available563Open in IMG/M
3300013004|Ga0164293_10883789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage563Open in IMG/M
(restricted) 3300013128|Ga0172366_10584169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
(restricted) 3300013129|Ga0172364_10066651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis2559Open in IMG/M
(restricted) 3300013130|Ga0172363_10946946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis532Open in IMG/M
(restricted) 3300013131|Ga0172373_10761897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis567Open in IMG/M
(restricted) 3300013132|Ga0172372_10348801All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1032Open in IMG/M
3300013372|Ga0177922_10837809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300013372|Ga0177922_10913236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1893Open in IMG/M
3300017722|Ga0181347_1123747All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis721Open in IMG/M
3300017761|Ga0181356_1198209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300017774|Ga0181358_1004822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5778Open in IMG/M
3300017774|Ga0181358_1043011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1730Open in IMG/M
3300017784|Ga0181348_1330410Not Available502Open in IMG/M
3300017785|Ga0181355_1228192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300019784|Ga0181359_1001486Not Available6301Open in IMG/M
3300019784|Ga0181359_1083397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1194Open in IMG/M
3300019784|Ga0181359_1095216Not Available1099Open in IMG/M
3300019784|Ga0181359_1225908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300019784|Ga0181359_1240987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300020048|Ga0207193_1025110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7192Open in IMG/M
3300020048|Ga0207193_1792230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300020205|Ga0211731_10498748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1160Open in IMG/M
3300020505|Ga0208088_1000317All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8084Open in IMG/M
3300020527|Ga0208232_1000265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11600Open in IMG/M
3300020530|Ga0208235_1024694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300020536|Ga0207939_1019455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage960Open in IMG/M
3300020551|Ga0208360_1004446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2222Open in IMG/M
3300022190|Ga0181354_1033318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1691Open in IMG/M
3300022407|Ga0181351_1035625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2110Open in IMG/M
3300022407|Ga0181351_1203931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage658Open in IMG/M
3300024346|Ga0244775_10040157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4123Open in IMG/M
3300024346|Ga0244775_10147764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1984Open in IMG/M
3300024348|Ga0244776_10283697Not Available1138Open in IMG/M
3300024348|Ga0244776_10392177Not Available923Open in IMG/M
3300025889|Ga0208644_1207287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage846Open in IMG/M
3300025896|Ga0208916_10183777All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage903Open in IMG/M
3300027631|Ga0208133_1168961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage503Open in IMG/M
3300027683|Ga0209392_1234417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300027721|Ga0209492_1018484All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2381Open in IMG/M
3300027721|Ga0209492_1090459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1079Open in IMG/M
3300027734|Ga0209087_1006379All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6267Open in IMG/M
3300027734|Ga0209087_1008000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5531Open in IMG/M
3300027743|Ga0209593_10060571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1440Open in IMG/M
3300027764|Ga0209134_10291856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage555Open in IMG/M
3300027792|Ga0209287_10146871All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300027793|Ga0209972_10001928All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17452Open in IMG/M
3300027793|Ga0209972_10026072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3470Open in IMG/M
3300027793|Ga0209972_10235548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage832Open in IMG/M
3300027808|Ga0209354_10118076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis1083Open in IMG/M
3300027899|Ga0209668_10281149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1063Open in IMG/M
3300027899|Ga0209668_10719002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300027900|Ga0209253_10057245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3227Open in IMG/M
3300027956|Ga0209820_1083806Not Available860Open in IMG/M
(restricted) 3300028569|Ga0247843_1095568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1372Open in IMG/M
(restricted) 3300028569|Ga0247843_1185533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
3300031539|Ga0307380_10249076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1680Open in IMG/M
3300031565|Ga0307379_10920136All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium755Open in IMG/M
3300031578|Ga0307376_10092673All Organisms → cellular organisms → Bacteria2133Open in IMG/M
3300031758|Ga0315907_10023537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5661Open in IMG/M
3300031857|Ga0315909_10008586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11175Open in IMG/M
3300031857|Ga0315909_10013858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8370Open in IMG/M
3300031857|Ga0315909_10244791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis1381Open in IMG/M
3300031857|Ga0315909_10773140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300031857|Ga0315909_10864989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage562Open in IMG/M
3300032092|Ga0315905_10066575All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3651Open in IMG/M
3300032093|Ga0315902_10040557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5470Open in IMG/M
3300032093|Ga0315902_10158352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis2343Open in IMG/M
3300033816|Ga0334980_0004142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6541Open in IMG/M
3300033979|Ga0334978_0300005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300033981|Ga0334982_0162605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1129Open in IMG/M
3300033981|Ga0334982_0399954All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300033993|Ga0334994_0329635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage764Open in IMG/M
3300033993|Ga0334994_0472554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage588Open in IMG/M
3300033995|Ga0335003_0310677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300034012|Ga0334986_0015290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5352Open in IMG/M
3300034012|Ga0334986_0131858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1461Open in IMG/M
3300034022|Ga0335005_0015991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5311Open in IMG/M
3300034062|Ga0334995_0527012All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300034062|Ga0334995_0741784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300034063|Ga0335000_0143881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1587Open in IMG/M
3300034063|Ga0335000_0775224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300034068|Ga0334990_0087347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis1684Open in IMG/M
3300034068|Ga0334990_0320308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300034071|Ga0335028_0226954All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1143Open in IMG/M
3300034073|Ga0310130_0000975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17152Open in IMG/M
3300034082|Ga0335020_0358812All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300034105|Ga0335035_0000724All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage25627Open in IMG/M
3300034110|Ga0335055_0473887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300034118|Ga0335053_0188296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1365Open in IMG/M
3300034120|Ga0335056_0181437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1228Open in IMG/M
3300034280|Ga0334997_0375633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300034280|Ga0334997_0790660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300034283|Ga0335007_0670694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300034356|Ga0335048_0363512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter → Flavihumibacter cheonanensis729Open in IMG/M
3300034357|Ga0335064_0016209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3877Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater20.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment15.34%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.20%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.11%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.41%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.41%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.41%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.84%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.84%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.27%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.70%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water1.70%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.70%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice1.70%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.70%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.70%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.14%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment1.14%
BenthicEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic1.14%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.14%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond1.14%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.57%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.57%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.57%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001533Benthic freshwater microbial communities from British Columbia, CanadaEnvironmentalOpen in IMG/M
3300002296Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002390Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003393Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DDEnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005739Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008122Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009450Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009451Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009484Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011009Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNAEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012348Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020505Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020527Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020551Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027683Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033979Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
MLSed_10002036343300001533BenthicMVLMKYEIKWKLGKVITEAPTVEEAIKKFKEMRIEVPDKEITISKFGK*
MLSed_1006055673300001533BenthicMYWEIKWKSGRIITNATTVEEAIENFKKLRIEVPDKEITISKFGK*
B570J29587_100207553300002296FreshwaterMVRMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEI
B570J29645_10175223300002390FreshwaterMKYEIRWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK*
B570J29032_10913568213300002408FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFN*FCPVSHWYGIF
B570J29032_10924573813300002408FreshwaterMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFN*
B570J40625_100004108203300002835FreshwaterMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIALFG*
B570J40625_10015549453300002835FreshwaterMKYEIKWKEGKVITDALTVEEAIQKFKELGIEVPDKEISISKFGK*
JGI25909J50240_105906443300003393Freshwater LakeMKWEIKWKSGKVITEAPTIEEAIKKFKELGIDVPKKEISICNFGK*
Ga0068877_1036648613300005525Freshwater LakeMKYEIRWKTGKVITDAPNIEEAIKKFKELRIEVPDKEISIASFGK*
Ga0068876_1017914533300005527Freshwater LakeMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF*
Ga0068872_1009411823300005528Freshwater LakeMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ*
Ga0068872_1035962233300005528Freshwater LakeMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEIGIASF*
Ga0068872_1042021713300005528Freshwater LakeLDKKMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF*
Ga0049081_1000572543300005581Freshwater LenticMKYEIKWKSGRIITEAETVEDAIKKFKELGIDVPEKEISIASFG*
Ga0049081_1033495213300005581Freshwater LenticMKYEIKWKSGRIITEAESIEDAIKKFKELGIEVADKEISIASFG*
Ga0076948_101670033300005739Lake WaterMKFEIKWKGGRIITEAPDIEEAIKKFKELRIEVTEKEISIASFPWRSF*
Ga0076948_101670143300005739Lake WaterMKFEIKWKGGRIITEAPDIEEAIKKFKELQIEVTEKEISIASFPWRSF*
Ga0078117_1002045163300005758Lake WaterMKFEIKWKGGRIITEASDIEEAIKKFKELRIIVTEKEISIASFPWRSF*
Ga0079957_100882193300005805LakeMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG*
Ga0070744_1001255733300006484EstuarineMKYEIRWKTGKVITEAPNIEEAIKKFKQLRIEVPDKEINISSFGK*
Ga0070744_1006803133300006484EstuarineMKYEIKWKTGKVITEAENIEEAIKKFKELRIEVPDKEISIASFGK*
Ga0070744_1022761513300006484EstuarineMKYEIKWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK*
Ga0070749_1011216243300006802AqueousMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF*
Ga0070749_1014409023300006802AqueousMVLMKWQIKWKTGKVITEAPTIEEAIKKFKQLGIDVPDKEISIASFG*
Ga0070749_1031795033300006802AqueousMKYEIKWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK*
Ga0075464_1022240813300006805AqueousMKYEIKWKSGRIITDAASVEEAIKKFKELGIEIPEKQISIASFQ*
Ga0102859_105890833300007708EstuarineMVLMYWEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK*
Ga0102859_110581143300007708EstuarineMYWEIKWKSGRIIANAPTVEEAIENFKKLRIEVPD
Ga0102859_124027833300007708EstuarineVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK*
Ga0102859_127637133300007708EstuarineMYWEIKWKSGRIITNAQTVEEAIENFKKLRIEVPDKEITISKFGK*
Ga0099850_125187343300007960AqueousMKYEIKWKSGRIITAAASVEEAIKKFKELGIEVPEKEISIASF*
Ga0114347_1006166113300008114Freshwater, PlanktonMKYEIKWKSGRIITDAASVEEAIKKFKEMGIDIPEKEISIASF*
Ga0114359_105580143300008122Freshwater, PlanktonMVLMKYEIKWKSGRIITDAASVEEAIKKFKEMGIDIPEKEISIASF*
Ga0114363_102193083300008266Freshwater, PlanktonMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVKDKEISIASFG*
Ga0114363_106182043300008266Freshwater, PlanktonMKYEIKWKSGRIITDAANVEEAIKKFKELGIEIPEKEISIASF*
Ga0114878_103917543300008339Freshwater LakeMKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ*
Ga0114880_100950863300008450Freshwater LakeMKYEIKWKSGRIITDAATVEEAIKKFKELGIKVPEKEISIASFQ*
Ga0114880_102092043300008450Freshwater LakeMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIAEKEISIASFQ*
Ga0114880_104315643300008450Freshwater LakeMVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG*
Ga0105105_1101251613300009009Freshwater SedimentMYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFNK*
Ga0105098_1003377043300009081Freshwater SedimentMYYEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK*
Ga0105098_1040059623300009081Freshwater SedimentMKYEIKWKSGRIITDAETVEDAIKKFKELGIDVPEKEISIASFG*
Ga0105098_1061658013300009081Freshwater SedimentMYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFNK*
Ga0105098_1067227413300009081Freshwater SedimentMKFEVKWKTGKVITEAETIEEAIQKFKELGIDVPDKEISICKFGK*
Ga0105099_1032115933300009082Freshwater SedimentMYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK*
Ga0105099_1105733413300009082Freshwater SedimentMKYEIKWKSGKVITEAPTVEEAIKKFKEMRIEILEKEITISKFGK*
Ga0105103_1022261833300009085Freshwater SedimentMYYEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFGK*
Ga0105091_1015473113300009146Freshwater SedimentLMKYEIKWKQGKVITEAESIEDAINKFKELGIEVPDKEISICKFGK*
Ga0114918_1026636043300009149Deep SubsurfaceKSGRIKTDAASVEEAIKKFKELGIEVPEKEISIASF*
Ga0114918_1036772613300009149Deep SubsurfaceMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEISIASF*
Ga0105092_1041304933300009157Freshwater SedimentMVLMYWEIKWKSGRIITNSSTVEEAIENFKKLKIEVPDKE
Ga0114977_1004805113300009158Freshwater LakeMKWEIKWKTGKVITEAPIIESEIQKFKELGIDIPEKEISI
Ga0105102_1012002833300009165Freshwater SedimentMVLMYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK*
Ga0105102_1014060813300009165Freshwater SedimentMYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISICKFGK*
Ga0105102_1036182113300009165Freshwater SedimentMYWEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFGK*
Ga0105102_1078622823300009165Freshwater SedimentMKYEIKWKSGKVITEASTVEEAIKKFKEMRIEIPEKEITISKFGK*
Ga0105104_1020506523300009168Freshwater SedimentMVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVADKEISIASFG*
Ga0105104_1029112113300009168Freshwater SedimentMKFEVKWKTGKVITEAETIEEAIQKFKELGIEVTDKEISICKFGK*
Ga0105097_1001402313300009169Freshwater SedimentMYWEIKWKSGKIITNAPTVEKAIENFKKLKIEVPDKEISISKFGK*
Ga0105097_1006806573300009169Freshwater SedimentMYYEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK*
Ga0105096_1009747033300009170Freshwater SedimentMKYEIKWKSGRIITDAENVEDAIKKFKELGIEVEDKEISIASFG*
Ga0105096_1029313723300009170Freshwater SedimentMKYEIKWKSGKIITEAESIEDAIKKFKELGIDVPDKEISICKFGK*
Ga0105096_1064942423300009170Freshwater SedimentHFKKMVLMYYEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK*
Ga0114974_10010800123300009183Freshwater LakeMKWEIKWKTGKVITEAPTIESAIQKFKELGIDIPEKEISIASFG*
Ga0114976_1002624363300009184Freshwater LakeMKWEIKWKTGKVITEAPIIESEIQKFKELGIDIPEKEISIASFG*
Ga0127391_110807423300009450Meromictic PondMKYEIKWKTGRIKTDAASVEEAIKKFKELGIDIPEKEISIASF*
Ga0127402_110007213300009451Meromictic PondMVLMKYEIKWKSGRIKTDAASLEEAIKKFKELGIDIPEKEISIASF*
Ga0127411_116877823300009484Meromictic PondMKYEIKWKSGKIITDAASVEEAIKKFKELGIDIPEKEISIASF*
Ga0129333_1068949823300010354Freshwater To Marine Saline GradientMKYEIKWNGGKMILQAANVEEEIKRFKELGIEVIEKEISIASFG*
Ga0129336_1032347033300010370Freshwater To Marine Saline GradientMKYEIKWKTGKVITDAPNIEEAIKKFKELRIEVPDKEISIASFGK*
Ga0129318_1020915013300011009Freshwater To Marine Saline GradientIKWKTGSKAIDAENIEEAIKKFKELRIEVPDKEISISSFGK*
Ga0153805_100179513300012013Surface IceKKVVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIDVPEKEISIASFG*
Ga0153805_100516153300012013Surface IceMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVEDKEISIASFG*
Ga0153805_101085143300012013Surface IceKKVVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVKDKEISIASFG*
Ga0153801_102577413300012017FreshwaterKKVVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVEDKEISIASFG*
Ga0157140_1000321053300012348FreshwaterMVLKKYEIKWKEGIKTIEAENIEEAIKKFKELRIEVPDKEISVLSFGKWFKISIGFW*
Ga0164293_1013259233300013004FreshwaterMVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEISIASFG*
Ga0164293_1032921443300013004FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVADKEISIASFG*
Ga0164293_1049655523300013004FreshwaterMKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK*
Ga0164293_1088378733300013004FreshwaterMYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK*
Ga0164293_1088378933300013004FreshwaterMYWEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK*
(restricted) Ga0172366_1058416923300013128SedimentMKFQIKWKGGRIITETPNVEEAIKKFKELRIEVTEKEISIASFPWRSI*
(restricted) Ga0172364_1006665153300013129SedimentMKFQIKWKDGKIITEAPNVEEAIKKFKELRIEVTEKEISIASFPWRSI*
(restricted) Ga0172363_1094694633300013130SedimentMKFQIKWKGGRIITEAPNVEEAIKKFKELQIEVTE
(restricted) Ga0172373_1076189733300013131FreshwaterMKFQIKWKGGRIITEAPNVEEAIKKFKELRIPVTEKEISIASFPWRSI*
(restricted) Ga0172372_1034880133300013132FreshwaterMKFQIKWKDGKIITEAPNVEEAIKKFKELRIPVTEKEISIASFPWRSI*
Ga0177922_1083780923300013372FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKEMGIEVEGKEISIASFG*
Ga0177922_1091323623300013372FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVKDKEISIASFG*
Ga0181347_112374733300017722Freshwater LakeMKYEIKWKSGRIITDAESIEDAIKKFKELNIEVEDKEISIA
Ga0181356_119820913300017761Freshwater LakeVVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG
Ga0181358_100482233300017774Freshwater LakeMVLRKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG
Ga0181358_104301163300017774Freshwater LakeMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVED
Ga0181348_133041013300017784Freshwater LakeKWKSGRIITEAETVEDAIKKFKELGIDVPEKEISIASFG
Ga0181355_122819223300017785Freshwater LakeMKWEIKWKSGKVITEAPTIEEAIQKFKELGIDVPEKEISICKFGK
Ga0181359_100148613300019784Freshwater LakeMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG
Ga0181359_108339743300019784Freshwater LakeKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG
Ga0181359_109521643300019784Freshwater LakeMKWEIKWKSGKVITEAPTIEEAIKKFKELGIDVPKKEISICNFGK
Ga0181359_122590833300019784Freshwater LakeMKYEIKWKSGRIITDAESIEDAIKKFKELNIEVEDKEISIASFG
Ga0181359_124098713300019784Freshwater LakeMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG
Ga0207193_102511013300020048Freshwater Lake SedimentMYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKE
Ga0207193_179223023300020048Freshwater Lake SedimentKWKTGKVITEAENIEEAIKKFKELRIEVPDKEISIASFGK
Ga0211731_1049874833300020205FreshwaterMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASF
Ga0208088_1000317103300020505FreshwaterMKYEIRWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK
Ga0208232_1000265193300020527FreshwaterMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIALFG
Ga0208235_102469433300020530FreshwaterGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG
Ga0207939_101945523300020536FreshwaterMVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG
Ga0208360_100444653300020551FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFN
Ga0181354_103331823300022190Freshwater LakeMKYEIKWKSGKIITDAESIEDAIKKFKELGIDVPEKEISIASFG
Ga0181351_103562533300022407Freshwater LakeMKWEIKWKSGKIITEAPTIEEAIKKFKELGIEVEDKEISIASIG
Ga0181351_120393113300022407Freshwater LakeKMVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG
Ga0244775_1004015713300024346EstuarineMYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK
Ga0244775_1014776413300024346EstuarineMKYEIRWKTGKVITEAPNIEEAIKKFKQLRIEVPDKEINISSFGK
Ga0244776_1028369743300024348EstuarineMYWEIKWKSGRIIANAPTVEEAIENFKKLRIEVPDKEISISKFGK
Ga0244776_1039217743300024348EstuarineMVLMYWEIKWKSGRIITNAQTVEEAIENFKKLRIEVPDKEITISKFGK
Ga0208644_120728743300025889AqueousMKYEIKWKSGRIKTDAASLEEAIKKFKELGIDIPEKEISIASF
Ga0208916_1018377723300025896AqueousMKYEIKWKSGRIITDAASVEEAIKKFKELGIEIPEKQISIASFQ
Ga0208133_116896113300027631EstuarineYEIKWKTGKVITDAENIEEAIKKFKELRIEVPDKEISIASFGK
Ga0209392_123441723300027683Freshwater SedimentMKYEIKWKSGKIITEAESIEDAIKKFKELGIDVPDKEISICKFGK
Ga0209492_101848413300027721Freshwater SedimentMYYEIKWKSGRIITNAPTVEEAIENFKKLRIEVPDKEISISKFNK
Ga0209492_109045933300027721Freshwater SedimentMYWEIKWKSGKIITNAPTVEKAIENFKKLKIEVPDKEISISKFGK
Ga0209087_1006379123300027734Freshwater LakeMVLMKWEIKWKTGKVITEAPTIESAIQKFKELGIDIPEKEISIASFG
Ga0209087_1008000133300027734Freshwater LakeMKWEIKWKTGKVITEAPIIESEIQKFKELGIDIPEKEISIASFG
Ga0209593_1006057143300027743Freshwater SedimentMYWEIKWKSGKIITNAPTVEEAIENFKKLRIEVPDKEISISKFGK
Ga0209134_1029185633300027764Freshwater LakeMKYEIKWKEGKVITEAPTIEEAIQKFKELGIEVPDKEISICKFGK
Ga0209287_1014687133300027792Freshwater SedimentMYWEIKWKSGKIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK
Ga0209972_10001928113300027793Freshwater LakeMKYEIRWKTGKVITDAPNIEEAIKKFKELRIEVPDKEISIASFGK
Ga0209972_1002607263300027793Freshwater LakeMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ
Ga0209972_1023554823300027793Freshwater LakeMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEIGIASF
Ga0209354_1011807613300027808Freshwater LakeMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEI
Ga0209668_1028114923300027899Freshwater Lake SedimentMKYEIRWKTGKVITDAENIEEAIKKFKELRIEVPNKEISIASFGK
Ga0209668_1071900233300027899Freshwater Lake SedimentMKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFDK
Ga0209253_1005724543300027900Freshwater Lake SedimentMVLMKWEIKWKSGKVITEAPTVEEAIKKFKEMRIEVQDKEITISKFGK
Ga0209820_108380643300027956Freshwater SedimentMKWEIKWKQGKIITEAPTVEEAIQKFKELGIDIPDKEISICKFGK
(restricted) Ga0247843_109556813300028569FreshwaterMKYEIRWKTGKVITEAANIEEAIKKFKELRIEVIDKDINISSFGK
(restricted) Ga0247843_118553313300028569FreshwaterMKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVIDKDINISSFGK
Ga0307380_1024907643300031539SoilMKYEIKWKSGRIKTDAASVEEAIKKFKELRIEVPEKEISIASF
Ga0307379_1092013623300031565SoilMKYEIKWKSGRIKTDAASVEEAIKKFKELGIDIPGKEISIASF
Ga0307376_1009267353300031578SoilMKYEIKWKSGRIKTDAASVEEAIKKFKELGIDIPEKEISIASF
Ga0315907_1002353753300031758FreshwaterMKYEIKWKSGRIITDAASVEEAIKKFKEMGIDIPEKEISIASF
Ga0315909_10008586133300031857FreshwaterMKYEIKWKSGRIITDAATVEEAIKKFKELGIKVPEKEISIASFQ
Ga0315909_10013858153300031857FreshwaterMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIAEKEISIASFQ
Ga0315909_1024479113300031857FreshwaterMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVKDKEISIA
Ga0315909_1077314023300031857FreshwaterMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIEVPEKEISIASFQ
Ga0315909_1086498923300031857FreshwaterMKYEIKWKSGRIITDAANVEEAIKKFKELGIEIPEKEISIASF
Ga0315905_1006657583300032092FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEIEISIASFG
Ga0315902_10040557133300032093FreshwaterMKYEIKWKSGRIITDAASVEEAIKKFKELGIDVPEKEISIASFQ
Ga0315902_1015835223300032093FreshwaterMVLMKYEIKWKSGRIITDAASVEEAIKKFKELGIDIPEKEIGIASF
Ga0334980_0004142_4646_47893300033816FreshwaterMVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG
Ga0334978_0300005_58_1923300033979FreshwaterMKYEIKWKSGRIITDAENVEDAIKKFKELGIEVADKEISIASFG
Ga0334982_0162605_341_4753300033981FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVKDKEISIASFG
Ga0334982_0399954_472_6153300033981FreshwaterMVLMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVADKEISIASFG
Ga0334994_0329635_287_4243300033993FreshwaterMKWQIKWKTGKVITDAPTIEEAIKKFKELRIEVPDKEISIASFGK
Ga0334994_0472554_441_5753300033993FreshwaterMKYEIKWKSGRIITDAETVEDAIKKFKELGIEVADKEISIASFG
Ga0335003_0310677_457_5943300033995FreshwaterMKYEIKWKTGKVITEAPNIEEAINKFKELRIEVPDKEISIASFGK
Ga0334986_0015290_1999_21333300034012FreshwaterMKYEIKWKSGRIITDAENVEDAIKKFKELGIEVEDKEISIASFG
Ga0334986_0131858_57_2033300034012FreshwaterMVLMYWEIKWKSGRIITNAPTVEEAIENFKKLKIEVPDKEISISKFGK
Ga0335005_0015991_2391_25283300034022FreshwaterMKYEIRWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK
Ga0334995_0527012_2_1363300034062FreshwaterKYEIKWKTGKVITEAPNIEEAIKKFKELRIEVPDKEISIASFGK
Ga0334995_0741784_416_5443300034062FreshwaterYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFG
Ga0335000_0143881_1291_14253300034063FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGINVPEKEISIASFG
Ga0335000_0775224_59_1933300034063FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVADKEISIASFG
Ga0334990_0087347_261_4043300034068FreshwaterMVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEISIASFG
Ga0334990_0320308_634_7683300034068FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKMISIASFG
Ga0335028_0226954_110_2533300034071FreshwaterMVLMKYEIKWKSGRIITDAESIEDAIKKFKELGIEVEDKEISIASFN
Ga0310130_0000975_10227_103733300034073Fracking WaterMVLMYWEIKWKSGKVITNAPTVEEAIKKFKEMRIEVPDKEITISKFGK
Ga0335020_0358812_77_2143300034082FreshwaterMKYEIKWKQGKVITEAESIEDAINKFKELGIEVPDKEISICKFGK
Ga0335035_0000724_24193_243303300034105FreshwaterMKYEIKWKTGKVITEAENIEEAIKKFKELRIKVPDKEISIASFGK
Ga0335055_0473887_241_3753300034110FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEISIASFI
Ga0335053_0188296_575_7093300034118FreshwaterMKWEIKWKSGKVITEAPTIEEAIKKFKELGIEVKDKEISIASFG
Ga0335056_0181437_3_1343300034120FreshwaterKYEIKWKSGRIITDAESIEDAIKKFKELGIEVADKEISIASFG
Ga0334997_0375633_157_2913300034280FreshwaterMKYEIKWKSGRIITDAETVEDAIKKFKELGIDVPEKEISIASFG
Ga0334997_0790660_2_1153300034280FreshwaterMKYEIKWKSGRIITDAESIEDAIKKFKELGIDVPEKEI
Ga0335007_0670694_469_5853300034283FreshwaterWKSGRIITDAETVEDAIKKFKELGIEVEDKEISIASFG
Ga0335048_0363512_582_7163300034356FreshwaterMKYEIKWKSGRIITDAKSIEDAIKKFKELGIDVPEKEISIASFG
Ga0335064_0016209_2215_23523300034357FreshwaterMKYEIRWKTGKVITEAENIEEAIKKFKELRIEVPDKEISIASFGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.