| Basic Information | |
|---|---|
| Family ID | F033670 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAIRQARLEPLALSASGHERMVKGPTAASKEQRIDFSAGIAWFG |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.59 % |
| % of genes near scaffold ends (potentially truncated) | 60.80 % |
| % of genes from short scaffolds (< 2000 bps) | 81.25 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.568 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (65.909 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (84.659 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF00082 | Peptidase_S8 | 2.84 |
| PF00578 | AhpC-TSA | 2.27 |
| PF13633 | Obsolete Pfam Family | 2.27 |
| PF02806 | Alpha-amylase_C | 1.70 |
| PF14280 | DUF4365 | 1.70 |
| PF08849 | BrxA | 1.70 |
| PF13676 | TIR_2 | 1.70 |
| PF00176 | SNF2-rel_dom | 1.14 |
| PF07963 | N_methyl | 1.14 |
| PF00589 | Phage_integrase | 1.14 |
| PF13701 | DDE_Tnp_1_4 | 1.14 |
| PF03781 | FGE-sulfatase | 1.14 |
| PF04851 | ResIII | 1.14 |
| PF06114 | Peptidase_M78 | 0.57 |
| PF13495 | Phage_int_SAM_4 | 0.57 |
| PF13516 | LRR_6 | 0.57 |
| PF13340 | DUF4096 | 0.57 |
| PF04326 | AlbA_2 | 0.57 |
| PF00590 | TP_methylase | 0.57 |
| PF04465 | DUF499 | 0.57 |
| PF12161 | HsdM_N | 0.57 |
| PF01610 | DDE_Tnp_ISL3 | 0.57 |
| PF12762 | DDE_Tnp_IS1595 | 0.57 |
| PF13358 | DDE_3 | 0.57 |
| PF01022 | HTH_5 | 0.57 |
| PF00692 | dUTPase | 0.57 |
| PF13304 | AAA_21 | 0.57 |
| PF13655 | RVT_N | 0.57 |
| PF08388 | GIIM | 0.57 |
| PF00271 | Helicase_C | 0.57 |
| PF01609 | DDE_Tnp_1 | 0.57 |
| PF01661 | Macro | 0.57 |
| PF02635 | DrsE | 0.57 |
| PF01555 | N6_N4_Mtase | 0.57 |
| PF13267 | DUF4058 | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.70 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.70 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.70 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 1.14 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.57 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.57 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.57 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.57 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.57 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.57 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.57 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.57 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.57 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.57 % |
| All Organisms | root | All Organisms | 49.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10087021 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300003218|JGI26339J46600_10010653 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2682 | Open in IMG/M |
| 3300003218|JGI26339J46600_10092315 | Not Available | 750 | Open in IMG/M |
| 3300003219|JGI26341J46601_10062352 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300004152|Ga0062386_101749545 | Not Available | 519 | Open in IMG/M |
| 3300004475|Ga0068969_1003598 | Not Available | 614 | Open in IMG/M |
| 3300004611|Ga0068925_1319141 | Not Available | 663 | Open in IMG/M |
| 3300004612|Ga0068961_1017318 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1608 | Open in IMG/M |
| 3300006102|Ga0075015_100645148 | Not Available | 624 | Open in IMG/M |
| 3300009520|Ga0116214_1018667 | Not Available | 2468 | Open in IMG/M |
| 3300009520|Ga0116214_1063355 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300009520|Ga0116214_1067726 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300009520|Ga0116214_1078865 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300009520|Ga0116214_1125285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 950 | Open in IMG/M |
| 3300009520|Ga0116214_1232061 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Lacipirellulaceae → Lacipirellula → Lacipirellula parvula | 699 | Open in IMG/M |
| 3300009521|Ga0116222_1019198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3109 | Open in IMG/M |
| 3300009521|Ga0116222_1037480 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 2133 | Open in IMG/M |
| 3300009521|Ga0116222_1042149 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300009521|Ga0116222_1105582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1212 | Open in IMG/M |
| 3300009521|Ga0116222_1205557 | Not Available | 848 | Open in IMG/M |
| 3300009522|Ga0116218_1203829 | Not Available | 893 | Open in IMG/M |
| 3300009523|Ga0116221_1078324 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 1483 | Open in IMG/M |
| 3300009523|Ga0116221_1283347 | Not Available | 717 | Open in IMG/M |
| 3300009523|Ga0116221_1364552 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 627 | Open in IMG/M |
| 3300009524|Ga0116225_1099489 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 1350 | Open in IMG/M |
| 3300009524|Ga0116225_1295794 | Not Available | 723 | Open in IMG/M |
| 3300009524|Ga0116225_1384167 | Not Available | 625 | Open in IMG/M |
| 3300009525|Ga0116220_10012373 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 3388 | Open in IMG/M |
| 3300009525|Ga0116220_10025239 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2414 | Open in IMG/M |
| 3300009525|Ga0116220_10185374 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 899 | Open in IMG/M |
| 3300009672|Ga0116215_1020205 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300009672|Ga0116215_1147093 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1047 | Open in IMG/M |
| 3300009672|Ga0116215_1214699 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera brasiliensis | 846 | Open in IMG/M |
| 3300009672|Ga0116215_1333366 | Not Available | 658 | Open in IMG/M |
| 3300009698|Ga0116216_10015181 | All Organisms → cellular organisms → Bacteria | 4843 | Open in IMG/M |
| 3300009698|Ga0116216_10055774 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera | 2435 | Open in IMG/M |
| 3300009698|Ga0116216_10513431 | Not Available | 724 | Open in IMG/M |
| 3300009698|Ga0116216_10726425 | Not Available | 596 | Open in IMG/M |
| 3300009698|Ga0116216_10978278 | Not Available | 506 | Open in IMG/M |
| 3300009700|Ga0116217_10087863 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 2146 | Open in IMG/M |
| 3300009700|Ga0116217_10121613 | Not Available | 1766 | Open in IMG/M |
| 3300009700|Ga0116217_10280968 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300009824|Ga0116219_10022678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3849 | Open in IMG/M |
| 3300009824|Ga0116219_10148995 | Not Available | 1354 | Open in IMG/M |
| 3300009824|Ga0116219_10310305 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300009839|Ga0116223_10677028 | Not Available | 593 | Open in IMG/M |
| 3300009839|Ga0116223_10890489 | Not Available | 508 | Open in IMG/M |
| 3300010339|Ga0074046_10035573 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 3375 | Open in IMG/M |
| 3300010339|Ga0074046_10073963 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300010339|Ga0074046_10213972 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 1208 | Open in IMG/M |
| 3300010339|Ga0074046_10214542 | Not Available | 1206 | Open in IMG/M |
| 3300010339|Ga0074046_10267458 | Not Available | 1057 | Open in IMG/M |
| 3300010339|Ga0074046_10269826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 1052 | Open in IMG/M |
| 3300010339|Ga0074046_10522955 | Not Available | 707 | Open in IMG/M |
| 3300010339|Ga0074046_10621051 | Not Available | 638 | Open in IMG/M |
| 3300010339|Ga0074046_10626507 | Not Available | 635 | Open in IMG/M |
| 3300010339|Ga0074046_10795841 | Not Available | 553 | Open in IMG/M |
| 3300010339|Ga0074046_10864046 | Not Available | 528 | Open in IMG/M |
| 3300010339|Ga0074046_10903205 | Not Available | 513 | Open in IMG/M |
| 3300010339|Ga0074046_10933361 | Not Available | 502 | Open in IMG/M |
| 3300010341|Ga0074045_10165551 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 1495 | Open in IMG/M |
| 3300010341|Ga0074045_10274931 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 1109 | Open in IMG/M |
| 3300010343|Ga0074044_10233965 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300010343|Ga0074044_10337464 | Not Available | 989 | Open in IMG/M |
| 3300010379|Ga0136449_100218218 | All Organisms → cellular organisms → Bacteria | 3594 | Open in IMG/M |
| 3300010379|Ga0136449_100338127 | Not Available | 2715 | Open in IMG/M |
| 3300010379|Ga0136449_100685629 | Not Available | 1722 | Open in IMG/M |
| 3300010379|Ga0136449_100966997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
| 3300010379|Ga0136449_101381385 | Not Available | 1089 | Open in IMG/M |
| 3300010379|Ga0136449_102031515 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 847 | Open in IMG/M |
| 3300010379|Ga0136449_102767275 | Not Available | 694 | Open in IMG/M |
| 3300010379|Ga0136449_103074253 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010379|Ga0136449_103581583 | Not Available | 590 | Open in IMG/M |
| 3300010379|Ga0136449_103603515 | Not Available | 587 | Open in IMG/M |
| 3300010379|Ga0136449_103749748 | Not Available | 573 | Open in IMG/M |
| 3300010379|Ga0136449_103888725 | Not Available | 560 | Open in IMG/M |
| 3300010379|Ga0136449_104102718 | Not Available | 542 | Open in IMG/M |
| 3300010379|Ga0136449_104232562 | Not Available | 532 | Open in IMG/M |
| 3300011047|Ga0138553_113315 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300011051|Ga0138540_173964 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 652 | Open in IMG/M |
| 3300011053|Ga0138531_131715 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300011057|Ga0138544_1053832 | Not Available | 512 | Open in IMG/M |
| 3300011063|Ga0138537_1054609 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300011069|Ga0138592_1023875 | Not Available | 503 | Open in IMG/M |
| 3300011073|Ga0138584_1035171 | Not Available | 513 | Open in IMG/M |
| 3300011085|Ga0138581_1156653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 588 | Open in IMG/M |
| 3300011086|Ga0138564_1122711 | Not Available | 1243 | Open in IMG/M |
| 3300011088|Ga0138576_1013462 | Not Available | 971 | Open in IMG/M |
| 3300011089|Ga0138573_1107102 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 1944 | Open in IMG/M |
| 3300011089|Ga0138573_1234889 | Not Available | 1015 | Open in IMG/M |
| 3300014156|Ga0181518_10369860 | Not Available | 698 | Open in IMG/M |
| 3300014158|Ga0181521_10055423 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300014158|Ga0181521_10106648 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300014159|Ga0181530_10117040 | Not Available | 1566 | Open in IMG/M |
| 3300014159|Ga0181530_10374875 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 729 | Open in IMG/M |
| 3300014162|Ga0181538_10284233 | Not Available | 903 | Open in IMG/M |
| 3300014162|Ga0181538_10619119 | Not Available | 564 | Open in IMG/M |
| 3300014164|Ga0181532_10177193 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 1264 | Open in IMG/M |
| 3300014164|Ga0181532_10784621 | Not Available | 511 | Open in IMG/M |
| 3300014165|Ga0181523_10247298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300014165|Ga0181523_10259163 | Not Available | 991 | Open in IMG/M |
| 3300014165|Ga0181523_10528201 | Not Available | 651 | Open in IMG/M |
| 3300016705|Ga0181507_1350000 | Not Available | 918 | Open in IMG/M |
| 3300017943|Ga0187819_10350049 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300017946|Ga0187879_10765353 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300017961|Ga0187778_10107495 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata | 1738 | Open in IMG/M |
| 3300017998|Ga0187870_1033463 | Not Available | 2351 | Open in IMG/M |
| 3300018013|Ga0187873_1024426 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → Aquisphaera giovannonii | 3005 | Open in IMG/M |
| 3300018017|Ga0187872_10066696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum aromaticum | 1874 | Open in IMG/M |
| 3300018057|Ga0187858_10962562 | Not Available | 501 | Open in IMG/M |
| 3300018058|Ga0187766_10202623 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 1253 | Open in IMG/M |
| 3300018058|Ga0187766_11117614 | Not Available | 567 | Open in IMG/M |
| 3300021439|Ga0213879_10050887 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1094 | Open in IMG/M |
| 3300025576|Ga0208820_1101129 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300025576|Ga0208820_1140427 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026908|Ga0207787_1002413 | Not Available | 2240 | Open in IMG/M |
| 3300026990|Ga0207824_1022640 | Not Available | 668 | Open in IMG/M |
| 3300027497|Ga0208199_1003240 | All Organisms → cellular organisms → Bacteria | 4574 | Open in IMG/M |
| 3300027497|Ga0208199_1008717 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2423 | Open in IMG/M |
| 3300027497|Ga0208199_1022804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 1394 | Open in IMG/M |
| 3300027497|Ga0208199_1048106 | Not Available | 913 | Open in IMG/M |
| 3300027568|Ga0208042_1043034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
| 3300027570|Ga0208043_1015406 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2490 | Open in IMG/M |
| 3300027570|Ga0208043_1198928 | Not Available | 507 | Open in IMG/M |
| 3300027604|Ga0208324_1020904 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 2023 | Open in IMG/M |
| 3300027604|Ga0208324_1153997 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300027625|Ga0208044_1032434 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300027641|Ga0208827_1119014 | Not Available | 763 | Open in IMG/M |
| 3300027662|Ga0208565_1101570 | Not Available | 866 | Open in IMG/M |
| 3300027662|Ga0208565_1120075 | Not Available | 781 | Open in IMG/M |
| 3300027696|Ga0208696_1159152 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 728 | Open in IMG/M |
| 3300027696|Ga0208696_1240924 | Not Available | 564 | Open in IMG/M |
| 3300027696|Ga0208696_1274134 | Not Available | 520 | Open in IMG/M |
| 3300027824|Ga0209040_10007748 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 7710 | Open in IMG/M |
| 3300027824|Ga0209040_10464557 | Not Available | 572 | Open in IMG/M |
| 3300027825|Ga0209039_10103414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1219 | Open in IMG/M |
| 3300027825|Ga0209039_10104021 | Not Available | 1215 | Open in IMG/M |
| 3300027825|Ga0209039_10176437 | Not Available | 878 | Open in IMG/M |
| 3300027825|Ga0209039_10186011 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera soli | 850 | Open in IMG/M |
| 3300027825|Ga0209039_10342237 | Not Available | 582 | Open in IMG/M |
| 3300027854|Ga0209517_10094985 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 2026 | Open in IMG/M |
| 3300027854|Ga0209517_10643544 | Not Available | 554 | Open in IMG/M |
| 3300030494|Ga0310037_10028218 | Not Available | 2699 | Open in IMG/M |
| 3300030494|Ga0310037_10077467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1558 | Open in IMG/M |
| 3300030494|Ga0310037_10080491 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300030494|Ga0310037_10109032 | Not Available | 1279 | Open in IMG/M |
| 3300030494|Ga0310037_10464247 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030659|Ga0316363_10053695 | Not Available | 1913 | Open in IMG/M |
| 3300030706|Ga0310039_10202892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300030706|Ga0310039_10203040 | Not Available | 780 | Open in IMG/M |
| 3300030707|Ga0310038_10210175 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300030707|Ga0310038_10343137 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300030707|Ga0310038_10509447 | Not Available | 508 | Open in IMG/M |
| 3300032160|Ga0311301_10069908 | All Organisms → cellular organisms → Bacteria | 7435 | Open in IMG/M |
| 3300032160|Ga0311301_10308338 | All Organisms → cellular organisms → Bacteria | 2525 | Open in IMG/M |
| 3300032160|Ga0311301_10338488 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 2366 | Open in IMG/M |
| 3300032160|Ga0311301_10343266 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2343 | Open in IMG/M |
| 3300032160|Ga0311301_10376236 | Not Available | 2196 | Open in IMG/M |
| 3300032160|Ga0311301_10714290 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1404 | Open in IMG/M |
| 3300032160|Ga0311301_10938521 | Not Available | 1157 | Open in IMG/M |
| 3300032160|Ga0311301_11077346 | Not Available | 1049 | Open in IMG/M |
| 3300032160|Ga0311301_11096816 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1036 | Open in IMG/M |
| 3300032160|Ga0311301_11313811 | Not Available | 912 | Open in IMG/M |
| 3300032160|Ga0311301_11554924 | Not Available | 809 | Open in IMG/M |
| 3300032160|Ga0311301_11681866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_53_8 | 765 | Open in IMG/M |
| 3300032160|Ga0311301_11725850 | Not Available | 752 | Open in IMG/M |
| 3300032160|Ga0311301_11729287 | Not Available | 750 | Open in IMG/M |
| 3300032160|Ga0311301_11834737 | Not Available | 719 | Open in IMG/M |
| 3300032160|Ga0311301_12796605 | Not Available | 533 | Open in IMG/M |
| 3300032160|Ga0311301_12832358 | Not Available | 528 | Open in IMG/M |
| 3300032160|Ga0311301_13044086 | Not Available | 502 | Open in IMG/M |
| 3300033402|Ga0326728_10441331 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 1088 | Open in IMG/M |
| 3300033402|Ga0326728_10532229 | Not Available | 942 | Open in IMG/M |
| 3300033983|Ga0371488_0151398 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 65.91% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 9.66% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.70% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.57% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004611 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011047 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011053 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011086 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026908 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 77 (SPAdes) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100870214 | 3300000567 | Peatlands Soil | MAIRQARLEPLALSASGHERMVNGRAAASEEKRIDLSKEIA* |
| JGI26339J46600_100106531 | 3300003218 | Bog Forest Soil | MRESALRLMAIRQAGLEPLALSASGRERMVYGRAAASEEK |
| JGI26339J46600_100923152 | 3300003218 | Bog Forest Soil | AIRQARLEPMALSASGQEKMVNRWAAASGEKQINFSAGIAWFGDILK* |
| JGI26341J46601_100623521 | 3300003219 | Bog Forest Soil | MEPLALSATGHERAANGCAAASGEEKFDSPEAIARFGDIMK* |
| Ga0062386_1017495451 | 3300004152 | Bog Forest Soil | MAIRRACLEPLAFSASGRERMFNGWAAACGEEKIDFSGGIAPFGDILI* |
| Ga0068969_10035982 | 3300004475 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFSAGIAWFGDILK* |
| Ga0068925_13191411 | 3300004611 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPMAASREERFDFSAGIAWFGDI |
| Ga0068961_10173182 | 3300004612 | Peatlands Soil | LRRMAIRQARLERLALSASGHERMISGWAAASEEKRIDLSAGIAWFGDILK* |
| Ga0075015_1006451482 | 3300006102 | Watersheds | LRLMAIRQARLELLALSVSGRERMFNGWAAASEEKRTDFSARVAWFGDILK* |
| Ga0116214_10186673 | 3300009520 | Peatlands Soil | MAIRQARQERLALSASGHERMVNGGAVASGEERFDFSAGIARFGDIMK |
| Ga0116214_10633553 | 3300009520 | Peatlands Soil | MGIRQARLEPLALSASGHERMVNGGAAACGEEKFDLSEGIARFGDI |
| Ga0116214_10677261 | 3300009520 | Peatlands Soil | MAIRPARLEPLALSASGHERMVNGRAAASGEKSIGFSAGIAWFGDILK* |
| Ga0116214_10788652 | 3300009520 | Peatlands Soil | MAIRQARLEPLALSATGHERAANGCAAASGEEKFDSPEAIARFGDIL |
| Ga0116214_11252851 | 3300009520 | Peatlands Soil | MAIRPARLAPLALSASGHERVVNDRAAASGEKRMDLSEEIAWFG |
| Ga0116214_12320612 | 3300009520 | Peatlands Soil | MAIRQARLEPLALSVFGRERMFNGGAAASGEKRIDFS |
| Ga0116222_10191982 | 3300009521 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEERIDFSAGIAFSVTY* |
| Ga0116222_10374801 | 3300009521 | Peatlands Soil | MAIRQARWERLALSASGHERMVKGPTAASKEQRIDFSAGIAWFGG |
| Ga0116222_10421493 | 3300009521 | Peatlands Soil | MAIRQARLELVALSVSGHERIVNGWVAASGGEWIDLPAGIAWFGE* |
| Ga0116222_11055822 | 3300009521 | Peatlands Soil | MAIRQARLEALALSASGRERMFNGWAAASRERRIDFSIKIAWFGD |
| Ga0116222_12055572 | 3300009521 | Peatlands Soil | MRPLCIGQARLELLALSASCHERMVNGWAAASGKARIDLCAGIAWI |
| Ga0116218_12038292 | 3300009522 | Peatlands Soil | MAIRQARLERLALSASGHERMIKGPTAASKEQRIDFSAGIAWFGDILK* |
| Ga0116221_10783242 | 3300009523 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDF |
| Ga0116221_12833471 | 3300009523 | Peatlands Soil | MAIRQARLEPLALSVSGRERMVKGPTAASKEQRIDF |
| Ga0116221_13645521 | 3300009523 | Peatlands Soil | MAIRQARLEPLALSATGHERAANGCAAASGGKRFDFSAGIARFGDIMK* |
| Ga0116225_10994891 | 3300009524 | Peatlands Soil | SREQALRRMAIRQARLERLALSASGHERMIKGPTAASKEQRIDFSAGIAWFGDILK* |
| Ga0116225_12957941 | 3300009524 | Peatlands Soil | MAIWQARLKPLALSVFGRERMFNGWAAASGEKRIDFSAG |
| Ga0116225_13841671 | 3300009524 | Peatlands Soil | MAIRQARLEPLALSVSGHERMVNGRAAASGEEQMILSVEIAWFGDILKERPLVEIGPIR* |
| Ga0116220_100123731 | 3300009525 | Peatlands Soil | MAIRRARLKPLASSATYHERMVDGRAAASGEKRDRF |
| Ga0116220_100252391 | 3300009525 | Peatlands Soil | MAIRQARLEPLALSASGRERMVKGPTAASEAKRIDFSARVAW |
| Ga0116220_101853741 | 3300009525 | Peatlands Soil | ARLEPLALSASGHERMVKGPTASSKEQRIDFSAGIAWFGDILK* |
| Ga0116215_10202051 | 3300009672 | Peatlands Soil | MSIRQARLGLLALSASGHERMVNGRAAASGEKSIGFSAEIAWF |
| Ga0116215_11470932 | 3300009672 | Peatlands Soil | MAIRQARGEPAASSAFGHERIANGWAAASGEEKFDLSAGIARFGDILK* |
| Ga0116215_12146992 | 3300009672 | Peatlands Soil | LWRRADRQARLEPLALSASGHERMVHGWATASGEEKFDLSAAIARFGDILNYRGG |
| Ga0116215_13333661 | 3300009672 | Peatlands Soil | MAIRQARLERLALSSGHERMVKGPMAASKEQRIDFSAGIAWFGA* |
| Ga0116216_100151814 | 3300009698 | Peatlands Soil | MAIRQARLEALALSASGRERMFNGWAAASRERRIDFSIKIAWFGDILK* |
| Ga0116216_100557741 | 3300009698 | Peatlands Soil | MPIRQALLEPLALSAFGHEGVVNGRVAVSEEKKQ* |
| Ga0116216_105134312 | 3300009698 | Peatlands Soil | MRPLCIGQARLELLALSASCHERMVNGWAAASGKARIDLCAGIAWIGA* |
| Ga0116216_107264251 | 3300009698 | Peatlands Soil | MAIWQARLERLALSASGHERMVKGPTAASKEQRIDFSAGIAWFG |
| Ga0116216_109782781 | 3300009698 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFSAGI |
| Ga0116217_100878633 | 3300009700 | Peatlands Soil | MAIRQARLERLTLSAFGHERMFNGWAAASGEERFDFSAGIARFGDIIK* |
| Ga0116217_101216132 | 3300009700 | Peatlands Soil | MAIRQARLQPLALSVSGHEGVIQGRAAASGEKRIDLS |
| Ga0116217_102809682 | 3300009700 | Peatlands Soil | MAIRQARLEPLALSASGHERMVKGPTAASKEQRIDFSAGIAWFG |
| Ga0116219_100226784 | 3300009824 | Peatlands Soil | MAIRQARLEALALSASGRERMFNGWAAASRERRIDFS |
| Ga0116219_101489952 | 3300009824 | Peatlands Soil | MAIRQARLERLALSAFGHERMFNGWAAASGEERFDFSAGIARFGDIIK* |
| Ga0116219_103103052 | 3300009824 | Peatlands Soil | MAIRQARLEPLALSATGHERAANGCAAASGGKRFDFSAGIA |
| Ga0116223_106770282 | 3300009839 | Peatlands Soil | MAIGQARLEPLALSVSGRERMVKGPTAASKEQRIDFSAGIAWFGDILK |
| Ga0116223_108904892 | 3300009839 | Peatlands Soil | AMRPLCIGQARLELLALSASCHERMVNGWAAASGKARIDLCAGIAWIGA* |
| Ga0074046_100355733 | 3300010339 | Bog Forest Soil | MAIRQARLEPLALSVSGRERMFNGWAAASGEKRIDLSAGIARFGDILK* |
| Ga0074046_100739633 | 3300010339 | Bog Forest Soil | MGIRPARLEPLALSASGHVRMVDGRAAASGEKRIDLSEEIAWFGNML |
| Ga0074046_102139722 | 3300010339 | Bog Forest Soil | MAIRQARLERLALSAFGHERMFNGWAAASGEERFDFSAGTARFGE* |
| Ga0074046_102145421 | 3300010339 | Bog Forest Soil | MAIQQARLEPLALSVSGRERMVKGPTAASKEQRIDFSAVFYAASRHPI* |
| Ga0074046_102674582 | 3300010339 | Bog Forest Soil | MAIRQARLDPLALSVSGRERMFNGWAAASGEKRIDFSA |
| Ga0074046_102698261 | 3300010339 | Bog Forest Soil | MAIRPARLEPLALSASGHERMVNGRAAASGEKSIGFSAG |
| Ga0074046_105229552 | 3300010339 | Bog Forest Soil | MAIRQARLERVALIASCHERMVNGWAASRGEERIDLAAGIARLVTYW* |
| Ga0074046_106210511 | 3300010339 | Bog Forest Soil | MAIRQAGLEPLALSVSGRERMFNGWAAGCVEEKCDLSEGIARFCDILI* |
| Ga0074046_106265071 | 3300010339 | Bog Forest Soil | MTMQPARLEPLALTASGHERMVNGWAAASGEEKFDLPAGIARFGD |
| Ga0074046_107958411 | 3300010339 | Bog Forest Soil | MAIRQARLEPLALSVSGRERMFNGWAAESEEKRIDFSAGTRLVQ* |
| Ga0074046_108640461 | 3300010339 | Bog Forest Soil | QMAIRPARLEPLALSASGHERMVNGRAAASGEKSIGFSAGIAWFGDILK* |
| Ga0074046_109032051 | 3300010339 | Bog Forest Soil | MAIRQARMERLALIASGHERMIKGPTAASKEQRID |
| Ga0074046_109333611 | 3300010339 | Bog Forest Soil | MVIRQARLERLTLSAFGHERMFNGWAAASAEERFDFSAGIARFGDIIK* |
| Ga0074045_101655512 | 3300010341 | Bog Forest Soil | MVIRQARLERLTLSAFGHERMFNGWAAASGEERFDFSAGIARFGE* |
| Ga0074045_102749312 | 3300010341 | Bog Forest Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFSAGIAWFG |
| Ga0074044_102339653 | 3300010343 | Bog Forest Soil | MGIRPARLEPLALSASGHERMVDGRAAASGEKRIDLSE |
| Ga0074044_103374641 | 3300010343 | Bog Forest Soil | MAMRQARLELVALSASGHERIVNGWAAASGGEWIDLSAGIAWFGE* |
| Ga0136449_1002182187 | 3300010379 | Peatlands Soil | MAIRQARLGLVALSASGSERMVNGWAAASGEERSDLSAGIAWFGE* |
| Ga0136449_1003381273 | 3300010379 | Peatlands Soil | MAIRQARLEPLALTASGHERMVNGWAAASGEEKFDLPAGIARF |
| Ga0136449_1006099021 | 3300010379 | Peatlands Soil | QALRLMAIRQARLERVASSASGHERMVNGWAAASGGERIDFNDPKYG* |
| Ga0136449_1006856294 | 3300010379 | Peatlands Soil | MAIRPARLEPLALSAPGHVRIVNEPAAACGEEKFDFSEGIDRFGDILK* |
| Ga0136449_1009669971 | 3300010379 | Peatlands Soil | MAIRQARLERVASSASGHERMVNGWAAASGGERID |
| Ga0136449_1013813851 | 3300010379 | Peatlands Soil | IRQARLERVASSASGHERMVNGWAAASGGERIDLSAGIAWFGE* |
| Ga0136449_1020315152 | 3300010379 | Peatlands Soil | LRLIAIRQARQERVALIASCHERKVNGWAAASGEERIDLSAGIARLVTF* |
| Ga0136449_1027672751 | 3300010379 | Peatlands Soil | LRLIELRQARLEPLALSVSGLERTFNGWAAASGEEKFDL |
| Ga0136449_1030742532 | 3300010379 | Peatlands Soil | MAIRQARLEPLALSVSGRERMFNGWAAASGEKRIDFS |
| Ga0136449_1035815831 | 3300010379 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASREERFDFSAGIA |
| Ga0136449_1036035151 | 3300010379 | Peatlands Soil | MAIWQARLEPLALSASCHERMVNGWAAASGGERIDFCNLTPE |
| Ga0136449_1037497481 | 3300010379 | Peatlands Soil | KSGRELALRLMAIRQARLEALALSASGRERMFNGWAAASRERRIDFSIKIAWFGDILK* |
| Ga0136449_1038887251 | 3300010379 | Peatlands Soil | ARLERLALSASGHERMVKGPTAASKEQRIDFSAGIAWFGDIMNIE* |
| Ga0136449_1041027181 | 3300010379 | Peatlands Soil | MAIRQAGLEPLALSVSGRERMFNGWAARCVEEKCDLSEGIARFCDILI* |
| Ga0136449_1042325621 | 3300010379 | Peatlands Soil | MSIRQARLGLLALSASGHERMVNGWAAASGEKRIDFSAGIAWFGA* |
| Ga0138553_1133152 | 3300011047 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFSTGIAWFGDILNYR |
| Ga0138540_1739641 | 3300011051 | Peatlands Soil | MAIRQARMERLALSASGHERMIKGPTAASKEQRIDLSARIAWFGGILNYR |
| Ga0138531_1317151 | 3300011053 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPRAASKEQRIDFSAGIAWFG |
| Ga0138544_10538321 | 3300011057 | Peatlands Soil | MAIRQARLEPLALSVSGRERMFNDWAAASGEKRINFSAGIAWFGDILNHR |
| Ga0138537_10546092 | 3300011063 | Peatlands Soil | MAIRPARLKPLALSVSGHGRVFNGQAASGDKRMDLSE |
| Ga0138592_10238751 | 3300011069 | Peatlands Soil | MAIRQARLERLALSAFGHEKMVYGGAVASGEEPFNFSAGIARFGDIIK* |
| Ga0138584_10351711 | 3300011073 | Peatlands Soil | MAIRQARLEPLALSVSGRERMVNGWGAASGEKRINFSAAIA* |
| Ga0138581_11566531 | 3300011085 | Peatlands Soil | MGIRPARLEPLALSASGHERMVNGRAAASGEEKFDLPEAVARFGDI |
| Ga0138564_11227112 | 3300011086 | Peatlands Soil | MAIRQARLEPLALSASGHERMVNGWAAASGEKRIDFVC |
| Ga0138576_10134622 | 3300011088 | Peatlands Soil | MAIRQARLERLALTASGHERMVKGPTAASKEQRIDFS |
| Ga0138573_11071022 | 3300011089 | Peatlands Soil | MGIRQARLEPLALRASSHERMANGWAAASGEKRIE |
| Ga0138573_12348892 | 3300011089 | Peatlands Soil | MAIRQARLERLALTASGHERMVKGPTAASKEQRIDFSAGVAWFGDILIVEGP |
| Ga0181518_103698601 | 3300014156 | Bog | MTIRQARLELLALSVSGRERMFNGWAAASGEKWIA* |
| Ga0181521_100554234 | 3300014158 | Bog | MGIRPARLEPLALSACGHERMVNGRAAASGEKRIDLSEEIAWFGDILK* |
| Ga0181521_101066482 | 3300014158 | Bog | MGIRPACLEPLALSASGHERMVNGQAAASAGKRIDLSEEIA* |
| Ga0181530_101170401 | 3300014159 | Bog | MAIRQACLVSLALSAPSHEGMVNGCAAACEEKKFNLSEGIARFCDILI* |
| Ga0181530_103748752 | 3300014159 | Bog | MGIRPARLEPLALSACGHERMVNGRAAASGEKRIDLSEEIAWFGDI |
| Ga0181538_102842331 | 3300014162 | Bog | MAIREARLEPLALSVSGRERMFNGWAAASGENRMDFSAEVAWFGDILNREGVLME |
| Ga0181538_106191191 | 3300014162 | Bog | MAIRQARREPLALTASGHERMVNGWAAASGEEKFDLPEG |
| Ga0181532_101771932 | 3300014164 | Bog | MAIRQARLERVASSASGHERMVNGWAAASGGERIDLSAGIAWFGE* |
| Ga0181532_107846212 | 3300014164 | Bog | IKGLALRVMAIRQARLELVALSASGHERIVNGWAVASGGEWIDLSAGIAWFGEK* |
| Ga0181523_102472982 | 3300014165 | Bog | MPIRQARLELLALSVSGRERMFNGWAAASGEKWIA* |
| Ga0181523_102591631 | 3300014165 | Bog | MSIRQALLGPLALSASGHERMVNGWAAASGEKRIDFSAGIAWFGA* |
| Ga0181523_105282011 | 3300014165 | Bog | MGIRPARLEPLALSACGHERMVNGRAAASGEKRIDLSEE |
| Ga0181507_13500001 | 3300016705 | Peatland | MAIRQARLERPALSASGHERMVNGPTAASKEQRIDFS |
| Ga0181505_109406541 | 3300016750 | Peatland | MTASPGSISKGLVAIRQARLEPLALSASGHERMVNGWAEASGEKRNDLSVQIVLF |
| Ga0187819_103500491 | 3300017943 | Freshwater Sediment | MGRRLTNIKGQALRVMAIRQARLELVALSASGHERIVNGWAAASGGEWIDLSAGIAWFGE |
| Ga0187879_107653532 | 3300017946 | Peatland | MAIRQARLELVALSASGHERMVNGWAAASGEERIDLSAGIAWFGE |
| Ga0187778_101074953 | 3300017961 | Tropical Peatland | IRQARLERLALSASGHERMVKGPTVARREKRLDFSRL |
| Ga0187870_10334633 | 3300017998 | Peatland | LRLMAIRQARLEPLALSVSGRERMFNGWAAASGAKRIDLSAGIAWFGDIL |
| Ga0187873_10244263 | 3300018013 | Peatland | LRLLAIRRARLEPLALSASGRGRMFNGWAAASGEKRIDFSAGVAWFGGGEKGHY |
| Ga0187872_100666963 | 3300018017 | Peatland | MAIRQARLERLALSASGHERMFNGWAAASGEKRIDFSAGVAWFGGGEKGHY |
| Ga0187858_109625622 | 3300018057 | Peatland | MGIRPARLEPLALSASGHERMVNGQAAASAGKRIDLSEEIA |
| Ga0187766_102026231 | 3300018058 | Tropical Peatland | MAIRQARLELVALSASGHERIVNGWAAASGGEWIDLSA |
| Ga0187766_111176141 | 3300018058 | Tropical Peatland | MAIRQARLERLALSAFGHERMVYGGAVASGDKRFDFSAGIA |
| Ga0213879_100508873 | 3300021439 | Bulk Soil | MAIRQARLERLALSAFGHERMVKGPTAASKEQRIDFSTEK |
| Ga0208820_11011291 | 3300025576 | Peatland | MAIRQAGLEPLALSASGHERMVNGRAAASGEEKFDLPEAIARFGD |
| Ga0208820_11404272 | 3300025576 | Peatland | MAIRPARLEPLALSASGHERMVNVRAAASGEKRIDL |
| Ga0207787_10024131 | 3300026908 | Tropical Forest Soil | MAIRQARSERLALGASARERVVNSWAAASGEERIDLSAGIARLATY |
| Ga0207824_10226401 | 3300026990 | Tropical Forest Soil | LRLMAIRQARLEPLALSVSGPERMVNGWAAASGEERIDFSAGIARLGAILK |
| Ga0208199_10032402 | 3300027497 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEERIDFSAGIAFSVTY |
| Ga0208199_10087171 | 3300027497 | Peatlands Soil | MAIRQARLEPLALSASGRERMVKGPTAASEAKRIDLGAIGLAT |
| Ga0208199_10228041 | 3300027497 | Peatlands Soil | MAIRPARLEPLALSASGHERMVNGRAAASGEKSIGFSAGIAWFGDILK |
| Ga0208199_10481061 | 3300027497 | Peatlands Soil | LRLMAIRQARLEALALSASGRERMFNGWAAASRERRIDFSIKIAWFGDILK |
| Ga0208042_10430342 | 3300027568 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEERIDFSAGIAFS |
| Ga0208043_10154061 | 3300027570 | Peatlands Soil | MAIRQARLEPLALSASGRERMVKGPTAASEAKRIDLGAIGLA |
| Ga0208043_11989282 | 3300027570 | Peatlands Soil | LRRRANRQARLGPLALSASGHERMVHGWAAASGEKRIDFSAGIAWF |
| Ga0208324_10209041 | 3300027604 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFFAGIAWFGGI |
| Ga0208324_11539972 | 3300027604 | Peatlands Soil | LRLMAIRQARLEALALSASGRERMFNGWAAASRERRIDFSVKIAWF |
| Ga0208044_10324341 | 3300027625 | Peatlands Soil | MAIRQARLEPLALSASGHERMVNGRAAASEEKRIDLSKEIA |
| Ga0208827_11190141 | 3300027641 | Peatlands Soil | QARLEPLALSASGRDRTVNGWAAASGEERFDFSAGIARFGDIIK |
| Ga0208565_11015701 | 3300027662 | Peatlands Soil | LRLMAIRQARLEALALSASGRERMFNGWAAASRERRIDFSVKIAWFGDILK |
| Ga0208565_11200753 | 3300027662 | Peatlands Soil | MEPLALSVSGHERMVNGWAAVSGEEKFDSPEAIARFGD |
| Ga0208696_11591521 | 3300027696 | Peatlands Soil | MAIRQVRLEPLAFSASGHERMFNGWAASGEIRIDFP |
| Ga0208696_12409242 | 3300027696 | Peatlands Soil | LRLMAIWQARLEPLALSASCHERMVNGWAAASGGERID |
| Ga0208696_12741341 | 3300027696 | Peatlands Soil | ADGLRQARLEPLALSVSGRERTFNGWAAASEEKRTDFSARVAWFGDILK |
| Ga0209040_100077481 | 3300027824 | Bog Forest Soil | MAIRQARLERLTLSAFGHERMFNGWAAASGEERFDFSAGIARFGDIIK |
| Ga0209040_104645571 | 3300027824 | Bog Forest Soil | MASRQARLERLALSASGHERMIKGPTAASKEQRIDFSA |
| Ga0209039_101034141 | 3300027825 | Bog Forest Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFS |
| Ga0209039_101040211 | 3300027825 | Bog Forest Soil | MAIRQARLGPLALSASGHERTVNARAAASGEKTIDFSEQIAWFGDILK |
| Ga0209039_101764371 | 3300027825 | Bog Forest Soil | MAIRQERPELLAFSASGHEGAVNGWTATSGEKTIDFSEQIAWFGDILK |
| Ga0209039_101860111 | 3300027825 | Bog Forest Soil | MAIRRARLKPLAMSVSGRAPMVNGRAAASGEKRVDLSEEIG |
| Ga0209039_103422371 | 3300027825 | Bog Forest Soil | LRLMAIRQRLEPLALSVSGRERMFNSWAAASDEKRSDFSAGVAWFGDILNVEG |
| Ga0209517_100949851 | 3300027854 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFFAGIAWFGGILNYR |
| Ga0209517_106435441 | 3300027854 | Peatlands Soil | GRALAIRQARLEPLALSASSRERMVDGWAAASGEETD |
| Ga0310037_100282182 | 3300030494 | Peatlands Soil | DRQARPAPLALSAAGHERMVNGWAAASGEEQFDLSEGIA |
| Ga0310037_100774671 | 3300030494 | Peatlands Soil | MAIRQARLERLALSASGHERMVKGPTAASKEQRIDFSAGIA |
| Ga0310037_100804913 | 3300030494 | Peatlands Soil | MAIRQARLEPLALSASGHERMLNGRAAASGGERIGFSAGI |
| Ga0310037_101090324 | 3300030494 | Peatlands Soil | MAIRQACLEPLALGASGHERMVYGPTAASVEERIDLSAGIAWFGDILSN |
| Ga0310037_104642471 | 3300030494 | Peatlands Soil | MAIRQARLEPLALSASGHERMVKGPTAASKEQRIDFSCSSDV |
| Ga0316363_100536951 | 3300030659 | Peatlands Soil | DRQARLKPLALSVSSHERMVNGWAAASGEEPIDFSSGIAWLGAY |
| Ga0310039_102028921 | 3300030706 | Peatlands Soil | MAFRQARLAGTLAPLALSASGHERMVKAPTAASKEQRIDFS |
| Ga0310039_102030401 | 3300030706 | Peatlands Soil | LRLMAIRQARLEPLALSVSGHERMVNGRAAASGEEQMILSVEIAWFGDILKERPLVEIGPIR |
| Ga0310038_102101752 | 3300030707 | Peatlands Soil | MAIRQARLEPLALSASGHERMVNGGVVASGEERFDFSAGI |
| Ga0310038_103431372 | 3300030707 | Peatlands Soil | MAIRQARLEPLALSASGHERMVKGPTAASKEQRIDFSAGIAWFGDILNNRGV |
| Ga0310038_105094471 | 3300030707 | Peatlands Soil | LRLMAIRQARLEPPALTASGHERMVNGWAAASGEEKFDLPAGIARFGDILNMEGP |
| Ga0311301_100699084 | 3300032160 | Peatlands Soil | MAIRQARLERVASSASGHERMVNGWAAASGGERIDFNDPKYG |
| Ga0311301_103083384 | 3300032160 | Peatlands Soil | MGIRPARLEPLALSACGHERMVNGRAAACGEEKFDLSEGIARFGDILK |
| Ga0311301_103384882 | 3300032160 | Peatlands Soil | MAIRQARLERLALSASGHERMIKGPTAASKEQRIDFSAGIAWFGDILK |
| Ga0311301_103432662 | 3300032160 | Peatlands Soil | MAIRQARLEPLALSASGRERMVKGPTAASEAKRID |
| Ga0311301_103762361 | 3300032160 | Peatlands Soil | MAIRPARLEPLAFSACGHERMVNGRAAASGEKQIDLSEELPVSVTY |
| Ga0311301_107142902 | 3300032160 | Peatlands Soil | MAIRQARGEPAASSAFGHERIANGWAAASGEEKFDLSAGIARFGDILK |
| Ga0311301_109385212 | 3300032160 | Peatlands Soil | MAIRHARLEPLALSASGHERMFNGRAAASEEKRIDLSKEIA |
| Ga0311301_110773461 | 3300032160 | Peatlands Soil | MAIRQARLEALALSASGRERMFNGWAAASRERRIDFSVKIAWFGDILK |
| Ga0311301_110968163 | 3300032160 | Peatlands Soil | MAIRQARLEPLALSVSGRERMFNGWAAASEDKRIDFSA |
| Ga0311301_113138111 | 3300032160 | Peatlands Soil | KVLRLIAIRQAGLEPPALSASGRERMVYGPTAASEEKRIFP |
| Ga0311301_115549241 | 3300032160 | Peatlands Soil | MAIRQARLEPLALSVSGHERMVNGRAAASGEEQMILSVEIAWFGDILKERPLVEIGPIR |
| Ga0311301_116818662 | 3300032160 | Peatlands Soil | MAIQQARLEPRALSASGRERMVYGRAAASEDKRIDLAEETAWF |
| Ga0311301_117258501 | 3300032160 | Peatlands Soil | MAIRQACLVSLALSAPSHEGMVNGCAAACEEKKFNLSEGIARFCDILNR |
| Ga0311301_117292871 | 3300032160 | Peatlands Soil | MAIRQARLERPALSSSHERMVKDPTAASKEQRIDFSAGIAWFGDILN |
| Ga0311301_118347371 | 3300032160 | Peatlands Soil | MAIRQARLERVASSASGHERMVNGWAAASGGERIDLSAGIAWF |
| Ga0311301_127966051 | 3300032160 | Peatlands Soil | MRLMAIRQAGLEPLALSASGRERTVYGRAAASEEK |
| Ga0311301_128323581 | 3300032160 | Peatlands Soil | MEPLALSASGHERMISGWAAASEEKRIDLSAGIAWFGDILKEEGRSSR |
| Ga0311301_130440862 | 3300032160 | Peatlands Soil | MSIRQARLGLLALSASGHERMVNGWAAASGEKRIDFSAGIAWFGA |
| Ga0326728_104413313 | 3300033402 | Peat Soil | MAIRQARLEPLALSASSHERIVNGRSAASGEESIDLGK |
| Ga0326728_105322291 | 3300033402 | Peat Soil | KGLVLRVMAIRQARLELVALSVSGHERIVNGWVAASGGEWIDLPAGIAWFGE |
| Ga0371488_0151398_2_127 | 3300033983 | Peat Soil | MAIRQARLELVALSVSGHERIVNGWVAASGGEWIDLPAGIAW |
| ⦗Top⦘ |