 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F033592 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 81.92 % |
| % of genes from short scaffolds (< 2000 bps) | 75.71 % |
| Associated GOLD sequencing projects | 151 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.921 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.469 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.096 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.311 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 27.54% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF03420 | Peptidase_S77 | 33.90 |
| PF07068 | Gp23 | 1.13 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.92 % |
| All Organisms | root | All Organisms | 18.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.47% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.38% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.47% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.52% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.52% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.95% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.39% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.82% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.26% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.26% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.69% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.69% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 1.13% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.13% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.13% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.13% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.13% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.56% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.56% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.56% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.56% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.56% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.56% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000192 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 60 08/10/11 100m | Environmental | Open in IMG/M |
| 3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300001347 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001740 | Marine viral communities from the Deep Pacific Ocean - MSP-114 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300005425 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199 | Environmental | Open in IMG/M |
| 3300005426 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74 | Environmental | Open in IMG/M |
| 3300005551 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF89A | Environmental | Open in IMG/M |
| 3300005595 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B | Environmental | Open in IMG/M |
| 3300005596 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B | Environmental | Open in IMG/M |
| 3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006343 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0200m | Environmental | Open in IMG/M |
| 3300006352 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006567 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770m | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300008251 | Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM8C Gulf of Mexico | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013114 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 198m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020256 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556010-ERR599067) | Environmental | Open in IMG/M |
| 3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
| 3300020338 | Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX555920-ERR599099) | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020390 | Marine microbial communities from Tara Oceans - TARA_B100002049 (ERX555953-ERR598985) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021977 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Hafa_FS925 _150kmer | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024244 | Seawater microbial communities from Monterey Bay, California, United States - 125D_r | Environmental | Open in IMG/M |
| 3300024291 | Seawater microbial communities from Monterey Bay, California, United States - 74D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025667 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300026073 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026262 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027685 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028132 | Seawater microbial communities from Monterey Bay, California, United States - 61D | Environmental | Open in IMG/M |
| 3300028136 | Seawater microbial communities from Monterey Bay, California, United States - 9D | Environmental | Open in IMG/M |
| 3300028175 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_135m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028274 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_200m | Environmental | Open in IMG/M |
| 3300028414 | Seawater microbial communities from Monterey Bay, California, United States - 33D | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031628 | Marine microbial communities from water near the shore, Antarctic Ocean - #229 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101291873 | 3300000115 | Marine | GKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN* |
| DelMOWin2010_101297314 | 3300000117 | Marine | LRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN* |
| DelMOWin2010_101529223 | 3300000117 | Marine | LTGKGKYGLRPNQLKYGNDKLFKLTTDANVKSYLLVTEFRRN* |
| SI60aug11_100mDRAFT_10122081 | 3300000192 | Marine | ETLPLDGKGKYGLRPGQLKFGNDKIFNLTTDSNVKSYLLVTEFRRESNG* |
| SI34jun09_100mDRAFT_10560353 | 3300000254 | Marine | DLPLTGKGKYGLRPNQLKYGNDKIFKLTTDSNVNSYLLVTEFRRN* |
| LP_A_09_P04_10DRAFT_10435543 | 3300000265 | Marine | LTGKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN* |
| JGI20156J14371_100892703 | 3300001347 | Pelagic Marine | RPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN* |
| JGI24006J15134_101126121 | 3300001450 | Marine | LRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN* |
| JGI24006J15134_101352061 | 3300001450 | Marine | GLRPDQLKFGNDKQILLTTDSNVESYLLVNEFRRNS* |
| JGI24006J15134_101950362 | 3300001450 | Marine | DLALKGKGKYGLRPNELKFGSDKQIKIITDALVKSYLLVTEFRRNN* |
| JGI24005J15628_101521711 | 3300001589 | Marine | GKYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN* |
| JGI24005J15628_101685061 | 3300001589 | Marine | GKYGLRPDQLKFGNDKQILLTTDSNVESYLLVNEFRRNS* |
| JGI24005J15628_102051051 | 3300001589 | Marine | GKGKYGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN* |
| JGI24656J20076_10095684 | 3300001740 | Deep Ocean | KLSLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN* |
| JGI25134J35505_101055652 | 3300002518 | Marine | TDGDKKLSLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN* |
| Ga0066859_100450481 | 3300005425 | Marine | KGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN* |
| Ga0066847_100873644 | 3300005426 | Marine | SLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN* |
| Ga0066843_100144005 | 3300005551 | Marine | GKYGLRPDQLKFGNDVKILLSTDSNVKKYLLITQFRRN* |
| Ga0066843_100290891 | 3300005551 | Marine | TLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN* |
| Ga0066833_100428194 | 3300005595 | Marine | YGLRPGQLKFGKDKQFKLTTDSNVKSYLLVTEFRRN* |
| Ga0066834_100993174 | 3300005596 | Marine | KYGLRPDQLKFGNDVKILLSTDSNVKKYLLITQFRRN* |
| Ga0066381_101774541 | 3300005945 | Marine | AYDGGYTKLSLTGKGKYGLRPGQLNFGNDKQFTLTTDPNVTSYLLVTEFRRN* |
| Ga0075441_103618712 | 3300006164 | Marine | YGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN* |
| Ga0075446_101220053 | 3300006190 | Marine | KYGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN* |
| Ga0068468_10580891 | 3300006305 | Marine | TGLGKYGLRPDQLKFGDDKQILLSTDSNVTSYLLITEFRRNN* |
| Ga0068476_14610031 | 3300006324 | Marine | DETLPLTGKGKYGLRPSQLKFGNDKQFTLTTDSNVRSYLLVTEFRRN* |
| Ga0068501_11996774 | 3300006325 | Marine | ELLNDLELTGKGKYGLRPDQLKFGDDKIIKLSTNGTVDSYLMVTEFRRND* |
| Ga0099675_16677773 | 3300006334 | Marine | RFFLGQLKFGNDKKITLTTDALVKSYLLVTEFRRNN* |
| Ga0068482_16080571 | 3300006338 | Marine | GKGKYGLRPGQLKFGNDKQFTLTTDANVTSYLLVTEFRRN* |
| Ga0068503_102599051 | 3300006340 | Marine | LSLTGKGKYGLRPGQLKFGNDKTFHLTTDSNVTSYLLVTEFRRN* |
| Ga0099699_10030491 | 3300006343 | Marine | YGLRPDQLKFGDDKQILLSTDSNVTSYLLITEFRRNN* |
| Ga0075448_102539261 | 3300006352 | Marine | GKGKYGLRPNQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN* |
| Ga0070744_101362393 | 3300006484 | Estuarine | TLTGKGKYGLRPNQLKYGNDKIFNLTTDSNIKSYLLVTEFRRN* |
| Ga0099958_11190021 | 3300006567 | Marine | TLELTGKGKYGLRPGQLKFGNDELFKLTTDGNVTSYLLVTEFRRN* |
| Ga0098042_10383731 | 3300006749 | Marine | LTGKGKYGLRPDELKFGNDKQLLLTTDSNVESYLLVTEFRRNN* |
| Ga0098044_12703771 | 3300006754 | Marine | KGKYGLRPDQLKFGNDVKILLSTDSNVKKYLLITQFRRN* |
| Ga0066376_105819703 | 3300006900 | Marine | GKYGLRPEQLKFGNDKIFKLTTDANVKSYLLVTEFRRN* |
| Ga0066376_106960202 | 3300006900 | Marine | SLTGKGKYGLRPDELKFGNDKQLLLTTDSDVKSYLLVTEFRRNN* |
| Ga0070746_100664871 | 3300006919 | Aqueous | GLRPDQLKFGDDKIIKLTTDSNVESYLLITEFRRK* |
| Ga0098053_10178644 | 3300006923 | Marine | ESTDLTLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN* |
| Ga0075444_101207744 | 3300006947 | Marine | GKYGLRPNELKFGSDRQIKIITDALVKSYLLVTEFRRNN* |
| Ga0075444_102968963 | 3300006947 | Marine | GKGKYGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNK* |
| Ga0070747_12392863 | 3300007276 | Aqueous | FTGNGKYGLRPDQLKFGDDKIIKLTTDSNVESYLLITEFRRK* |
| Ga0099847_11773333 | 3300007540 | Aqueous | GLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRRESNG* |
| Ga0102861_11777331 | 3300007544 | Estuarine | LRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNS* |
| Ga0102855_11437081 | 3300007647 | Estuarine | DLSLTGKGKYGLRPDQLKFGNDKQIRLTTDSNVKSYLLVTEFRRNN* |
| Ga0102823_10528784 | 3300007692 | Estuarine | GKGKYGLRPNQLKYGNDKIIKLTTDSNVKSYLLVTEFRRN* |
| Ga0105739_11216261 | 3300007954 | Estuary Water | GTLTISAGGEDLTLTGKGKYGLRPEQLKFGNDKIFKLTTDSNVRKYLLVTEFRRN* |
| Ga0105748_103833271 | 3300007992 | Estuary Water | GLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN* |
| Ga0114916_10831564 | 3300008221 | Deep Ocean | GKGKYGLRPDQVKFGNDKQILLTTDSNVKSYVLVREFRRNN* |
| Ga0105359_104390802 | 3300008251 | Methane Seep Mesocosm | SESTDLSLTGKGKYGLRPGQLKFGNDKIFTLTTDSNVTSYLLVTEFRRN* |
| Ga0102831_12737102 | 3300008996 | Estuarine | GKGKYGLRPGQLKFGNDKIFNLTTDSNVKSYLLVTEFRRESNG* |
| Ga0102816_12732351 | 3300008999 | Estuarine | LGPNQLKYGNDKIFKLTTDSNVNSYLLVTEFRRN* |
| Ga0102810_11623313 | 3300009002 | Estuarine | YGLRPDQLKFGNDAKIKLTTDSNVESYLLVTEFRRN* |
| Ga0102892_11129251 | 3300009057 | Estuarine | LTISAGDETLPLDGKGKYGLRPGQLKFGNDKIFNLTTDSNVKSYLLVTEFRRN* |
| Ga0115552_14164742 | 3300009077 | Pelagic Marine | GKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN* |
| Ga0114993_110782931 | 3300009409 | Marine | KGKYGLRPDQLQFGNDKVFKITTDENVKSYLLVTEFRRK* |
| Ga0114915_11496923 | 3300009428 | Deep Ocean | KGKYGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN* |
| Ga0115546_11206644 | 3300009435 | Pelagic Marine | YGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN* |
| Ga0114932_101819854 | 3300009481 | Deep Subsurface | RPTQQKFGNDKQIKITTDALVKSYLLVTEFRRNN* |
| Ga0115571_12538883 | 3300009495 | Pelagic Marine | GLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN* |
| Ga0138260_106432974 | 3300012419 | Polar Marine | GKYGLRPEQLKFGEDKQFKITTDKNVKSYLLVTEFRRN* |
| Ga0163180_104541671 | 3300012952 | Seawater | TLTGLGKYGLRPDQLKFGDDKQILLSTDSNVTSYLLITEFRRNN* |
| Ga0163179_108454283 | 3300012953 | Seawater | GKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN* |
| Ga0163179_109948671 | 3300012953 | Seawater | TGKGKYGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN* |
| Ga0171650_10095217 | 3300013114 | Marine | KYGLRPGQLKFGNDKQFKLTTDEDVKSYLLVTEFRRN* |
| Ga0181387_10398801 | 3300017709 | Seawater | YGLRPNQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN |
| Ga0181370_10071114 | 3300017715 | Marine | TLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN |
| Ga0181383_10828011 | 3300017720 | Seawater | DLELTGSGKYGLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRRESNG |
| Ga0181398_11582082 | 3300017725 | Seawater | LTGNGKYGLRPDQLKFGNDKQIKLTTDSVVESYLLVTEFRRNN |
| Ga0181419_10683314 | 3300017728 | Seawater | LRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0181433_10601283 | 3300017739 | Seawater | GKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0181397_10618824 | 3300017744 | Seawater | NGKYGLRPDQLKFGNDKIIKLTTDSNVKSYLLITEFRRK |
| Ga0181393_10178605 | 3300017748 | Seawater | FTGNGKYGLRPDQLKFGNDKIIKLTTDSNVKSYLLITEFRRK |
| Ga0181405_11225243 | 3300017750 | Seawater | GNGKYGLRPDQLKFGNDKIIKLTTDSNVESYLLITEFRRK |
| Ga0181408_10631504 | 3300017760 | Seawater | LPLTGSGKYGLRPGQLKFGNDKIFNLTTDSNVRNYLLVTEFRRESNG |
| Ga0187217_11714161 | 3300017770 | Seawater | IGKDTGNGKYGLRPDQLKFGDDKIIKLTTDSNVKSYLLITEFRRK |
| Ga0181432_12610831 | 3300017775 | Seawater | KGKYGLRPDQLKFGNDKKILLSTDSNVDSYLMVTEFRRND |
| Ga0181380_13242671 | 3300017782 | Seawater | YGLRPDQLKFGNDKQVLLTTDSNVESYLLVTEFRRNN |
| Ga0181379_11403954 | 3300017783 | Seawater | LRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN |
| Ga0181424_101479704 | 3300017786 | Seawater | YGLRPDQLKFGNDKIIKLTTDSNVESYLLITEFRRK |
| Ga0211645_10560033 | 3300020256 | Marine | DGDKKLSLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN |
| Ga0211526_10534053 | 3300020264 | Marine | DKGKYGLRPNQLKFGNDKQILLTTDSDVTSYLLVTEFRRNN |
| Ga0211571_11193971 | 3300020338 | Marine | STDLTLTGKGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN |
| Ga0211511_10486443 | 3300020349 | Marine | YGLRPDQLKFGDDKQILLTTDSNVTSYLLITEFRRNN |
| Ga0211672_100122335 | 3300020370 | Marine | YGLRPDQLKFGDDKQILLTTDSNIESYLLITEFRRNN |
| Ga0211652_102444672 | 3300020379 | Marine | TGNGKYGLRPDELKFGDDKQFKLTTDSNVESYLLITEFRRK |
| Ga0211652_102866251 | 3300020379 | Marine | NGKYGLRPDQLKFGNDKQIKLTTDSNVESYLLITEFRRN |
| Ga0211555_101399981 | 3300020390 | Marine | GSDTLELTGKGKYGLRPGQLKFGNDKIFTLTTDSNVTSYLLVTEFRRN |
| Ga0211687_101603384 | 3300020396 | Marine | GKYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN |
| Ga0211532_102078453 | 3300020403 | Marine | YGLRPDQLKFGNDKQIKLTTDSNVESYLLITEFRRN |
| Ga0211708_103381521 | 3300020436 | Marine | KYGLRPDQLKFGDDKQILLSTDSNVTSYLLITEFRRNN |
| Ga0211558_104921701 | 3300020439 | Marine | LLLTGKYGLRPGQLKFGNDKKITLTTDALVKSYLLVTEFRRNN |
| Ga0211574_104784051 | 3300020446 | Marine | GNGKYGLRPDELKFGNDKQFKLTTDSNVKSYLLITEFRRK |
| Ga0211641_100793001 | 3300020450 | Marine | LTGKYGLRPGQLKFGNDKKMTITTDNLVKSYLLVTEFRRNN |
| Ga0211641_106053992 | 3300020450 | Marine | LTGKYGLRPGQLKFGNDKKMTITTDALVKSYLLVTEFRRNN |
| Ga0211473_106930852 | 3300020451 | Marine | KYGLRPDQLMFGKDKQIKLSTDSNVKSYLIVTEFRRFD |
| Ga0211545_104924552 | 3300020452 | Marine | KYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0211548_101306911 | 3300020454 | Marine | LTGKGKYGLRPDQLKFGNDKQILLTTDSNVKSYLLVTEFRRNN |
| Ga0211548_105267422 | 3300020454 | Marine | LGGFLLTGKYGLRPGQLKFGDDKKMTITTDALVKSYLLVTEFRRNN |
| Ga0206678_102921591 | 3300021084 | Seawater | ASSESADLVLDGNGKYGLRPDQLKFGNDKQFTLTTDSNVKNYLLVTEFRRN |
| Ga0206688_104174001 | 3300021345 | Seawater | LKLSGKGKYGLRPGQLKFGNNKIFTLTTDSNITSYLLVTEFRRN |
| Ga0206693_11232701 | 3300021353 | Seawater | GKYGLRPDQLKFGNDKKMTLTTDSNVKSYLLVTEFRRK |
| Ga0206123_103974712 | 3300021365 | Seawater | KGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0206685_102654871 | 3300021442 | Seawater | GKGKYGLRPGQLKFGNDKIFKLTTDSNITSYLLVTEFRRN |
| Ga0226832_105562241 | 3300021791 | Hydrothermal Vent Fluids | DLKLTGKGKYGLRPDQLKFGDDKIIKLSTDSNVESYLMVTEFRRN |
| Ga0222717_105326141 | 3300021957 | Estuarine Water | TGKYGLRPGQLKFGDDKKMTITTDALVKSYLLVTEFRRNN |
| Ga0232639_14182452 | 3300021977 | Hydrothermal Vent Fluids | SETSDLSLTGKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0224906_11236981 | 3300022074 | Seawater | GLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0222646_1285461 | 3300022822 | Saline Water | GKYGLRPGQLKFGNDKQLLLTTDANVTNYLLITEFRRN |
| (restricted) Ga0233432_103011893 | 3300023109 | Seawater | LLTGKYGLRPGQLKFGNDKQIKITTDALVKSYLLVTEFRRNN |
| Ga0228678_10541513 | 3300024244 | Seawater | DLVLTGKGKYGLRPNQLKFGNDKKMTLTTDSNVKSYLLVTEFRRK |
| Ga0228660_10662033 | 3300024291 | Seawater | TLTGKGKYGLRPDQLQFGNDRKMTLTTDSNIKSYLLVTEFRRESNG |
| Ga0244775_108659003 | 3300024346 | Estuarine | LTLTGKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN |
| Ga0207905_10253161 | 3300025048 | Marine | FTGSGKYGLRPGQLKFGNDKQFKLTTDSNVKSYLLVTEFRRN |
| Ga0208792_10949751 | 3300025085 | Marine | GLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRRN |
| Ga0208434_10766353 | 3300025098 | Marine | VRKDLPLTGSGKYGLRPGQLKFGNDKVFKLTTDSNVRNYLLVTEFRRESNG |
| Ga0208669_10434744 | 3300025099 | Marine | TANGKYGLRPDQLEFGKDKQIKLTTDSNVKSYLLITEFRRK |
| Ga0208790_10069327 | 3300025118 | Marine | RPDQLKFGNDGIITLSTDSSVDSYLMVTEFRRNED |
| Ga0208919_12577111 | 3300025128 | Marine | GTPLSLTGKGKYGLRPGQLKFGNDKTFHLTTDSNVTSYLLVTEFRRN |
| Ga0208643_10616884 | 3300025645 | Aqueous | TGNGKYGLRPDQLKFGEDKQIKLTTDSNVKSYLLITEFRRK |
| Ga0209043_11785661 | 3300025667 | Marine | TISAGDEALPLDGKGKYGLRPGQLKFGNDKIFNLTTDSNVKSYLLVTEFRRESNG |
| Ga0209095_12020982 | 3300025685 | Pelagic Marine | KYGLRPDQLKFGNDKKMTLTTDSNVKSYLLVTEFRRK |
| Ga0209199_11873083 | 3300025809 | Pelagic Marine | TGKGKYGLRPNQLKYGNDKIFKLATDSNVNSYLLVTEFRRN |
| Ga0207961_11359912 | 3300026073 | Marine | TGLGKYGLRPDQLKFGDDKQILLSTDSNVTSYLLITEFRRNN |
| Ga0207990_11351492 | 3300026262 | Marine | LTGKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0208641_10328225 | 3300026268 | Marine | TGKGKYGLRPDQLKFGNDGIITLSTDSSVDSYLMVTEFRRNED |
| Ga0228607_10915211 | 3300026517 | Seawater | GKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0208950_100172416 | 3300027413 | Marine | LDGKGKYGLRPGQLKFGNDKIFNLTTDSNVKSYLLVTEFRRESNG |
| Ga0208973_10434874 | 3300027506 | Marine | GTQVRKDLVLTGNGKYGLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRRESNG |
| Ga0209554_10332485 | 3300027685 | Marine | KGKYGLRPSQLKYGNDKLFKLTTDANVKSYLLVTEFRRN |
| Ga0209815_11695921 | 3300027714 | Marine | LTGKGKYGLRPEQLKFGEDRQFKLTTDANVKSFLLVTEFRRN |
| Ga0209815_12439821 | 3300027714 | Marine | GLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN |
| Ga0208671_101375174 | 3300027757 | Estuarine | DLPLTGSGKYGLRPGQLKFGNDKIFKLTTDSNVRNYLLVTEFRRESNG |
| Ga0209279_100063191 | 3300027771 | Marine | GKGKYGLRPNQLKYGNDKIIKLTTDANVKSYLLVTEFRRN |
| Ga0209279_101806692 | 3300027771 | Marine | GGPTKLSLTGKGKYGLRPEQLKFGNDKIFKLTTDANVKSYLLVTEFRRN |
| Ga0209279_102742311 | 3300027771 | Marine | KGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN |
| Ga0209711_102354463 | 3300027788 | Marine | TLTGKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN |
| Ga0209830_102982503 | 3300027791 | Marine | TGKGKYGLRPDQLKFGNDKQILLTTDSNVKSYLLITEFRRNN |
| Ga0209091_103086603 | 3300027801 | Marine | LTLTGKGKYGLRPDQLKFGNDKQILLTTDSNVKSYLLITEFRRNN |
| Ga0209090_104349151 | 3300027813 | Marine | IAESEEHDLALRGKGKYGLRPNELKFGSDKQINISTDARVKSYLLVTEFRRNN |
| Ga0209090_104370073 | 3300027813 | Marine | GKGKYGLRPNQLKYGNDKQFKLTTDSNVKSYLLVTEFRRN |
| Ga0209089_105091991 | 3300027838 | Marine | GKYVLRPDQLKFGNDKQILLTTDSNVTSYLLVSEFRRNN |
| Ga0209402_100298081 | 3300027847 | Marine | GKYGLRPDQLKFGNDKQILLTTDSNVTSYLLVSEFRRNN |
| Ga0228649_11465391 | 3300028132 | Seawater | LRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN |
| Ga0228608_11454253 | 3300028136 | Seawater | KGKYGLRPDQLQFGNDRKMTLTTDSNIKSYLLVTEFRRK |
| Ga0257117_10383974 | 3300028175 | Marine | VLTGNGKYGLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRRESNG |
| Ga0257107_10122471 | 3300028192 | Marine | FTGKGKYGLRPDQLKFGNDKQLLLTTDSNITSYLLVTEFRRNN |
| Ga0257106_10969754 | 3300028194 | Marine | FTGNGKYGLRPNQLKFGNDKQLLLSTDSNVESYLMITEFRRN |
| Ga0257110_10853004 | 3300028197 | Marine | TGNGKYGLRPDQLKFGNDKIIKLTTDSNVESYLLITEFRRK |
| Ga0257110_11657094 | 3300028197 | Marine | TGKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVNEFRRNS |
| Ga0257110_12034041 | 3300028197 | Marine | TGKGKYGLRPNQLKFGNDKQFKITTDANVKSYLLVTEFRRN |
| Ga0257119_10698074 | 3300028274 | Marine | TGNGKYGLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRRESNG |
| Ga0228627_10692741 | 3300028414 | Seawater | GLRPSQLKFGNDKIFKLTTDSNVRNYLLVTEFRRESNG |
| Ga0257109_10271855 | 3300028487 | Marine | TGKGKYGLRPDQLKFGNDKQILLTTDSNVESYLLVTEFRRNN |
| Ga0257109_12135272 | 3300028487 | Marine | ESTDLSLTGKGKYGLRPGQLKYGNDTIFKLTTDGNITSFLLVTEFRRN |
| Ga0308024_10859731 | 3300031140 | Marine | TSSESSDLSLTGKGKYGLRPEQLKFGNDKIFTLTTDANVKSYLLVTEFRRN |
| Ga0308022_11507503 | 3300031142 | Marine | AGTAVKKELTLTGKGKYGLRPEQLKFGEDRQFKLTTDANVKSFLLVTEFRRN |
| Ga0308022_11744503 | 3300031142 | Marine | GLRPEQLKFGNDKIFKLTTDANVKSYLLVTEFRRN |
| Ga0308022_11857741 | 3300031142 | Marine | GLTKLSLTGKGKYGLRPEQLKFGKDKIFKLTTDANVKSYLLVTEFRRN |
| Ga0308010_12358241 | 3300031510 | Marine | DAAGTAVKKELPLTGKGKYGLRPGQLKFGEDKQFKITTDANVKSYLLVTEFRRN |
| Ga0307488_105179891 | 3300031519 | Sackhole Brine | KGKYGLRPNQLKYGNDKIFNLTTDSNIKSYLLVTEFRRN |
| Ga0307489_106865523 | 3300031569 | Sackhole Brine | KYGLRPDQLKFGNDKQILLTTDSNVESYLLVSEFRRNN |
| Ga0307996_11582771 | 3300031589 | Marine | EGGFKKMTLTDSGKYGLRPEQLKFGNDKIFKLTTDANVKSYLLVTEFRRN |
| Ga0308007_101606323 | 3300031599 | Marine | GAGRTVVKPLTLTNSGKYGLRPEQLKFGNDKIFKLTTDSNVRNYLLVTEFRRN |
| Ga0308014_10586834 | 3300031628 | Marine | DLTLTGKGKYGLRPDQLKFGNDKQILLTTDSNVKSYLLVSEFRRNN |
| Ga0308001_102718041 | 3300031644 | Marine | TGKGKYGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN |
| Ga0308001_103862572 | 3300031644 | Marine | TGKGKYGLRPSQLKYGNDKLFKLTTDANVKSYLLVTEFRRN |
| Ga0308017_10491434 | 3300031689 | Marine | GTAVKKELTLTGKGKYGLRPEQLKFGEDRQFKLTTDANVKSYLLVTEFRRN |
| Ga0308016_102355673 | 3300031695 | Marine | GKYGLRPDQLKFGNDKQILLTTDSNVTSYLLVTEFRRNN |
| Ga0315328_101148541 | 3300031757 | Seawater | KYGLRPGQLKFGNDKQFKLTTDESVDSYLLVTEFRRETNG |
| Ga0315326_108349232 | 3300031775 | Seawater | DLSLTGKGKYGLRPGQLKFGNDKIFTLTTDSNVTSYLLVTEFRRN |
| Ga0310122_104782672 | 3300031800 | Marine | DLDLTGKGKYGLRPDQKKFGNDVKILLSTDSNVKSYLLITEFRRN |
| Ga0315318_101996921 | 3300031886 | Seawater | ISAGDETLPLDGKGKYGLRPGQLKFGNDELFKLTTDANVKSFLLVTEFRRN |
| Ga0315316_116364822 | 3300032011 | Seawater | GLRPSQLKFGNDKIFTLTTDFHVKSYLLVTEFRRN |
| Ga0315333_105222642 | 3300032130 | Seawater | GLRPRQLIFGNDKQFTLTTDLNVKSYLLVTEFRRN |
| Ga0310345_113862701 | 3300032278 | Seawater | GLRPDQLKFGNDKQILLTTDSNVKSYLLVTEFRRNN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |