| Basic Information | |
|---|---|
| Family ID | F033567 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVSA |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.44 % |
| % of genes from short scaffolds (< 2000 bps) | 92.66 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.972 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.944 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.814 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.107 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 10.17 |
| PF00291 | PALP | 8.47 |
| PF04542 | Sigma70_r2 | 8.47 |
| PF03551 | PadR | 1.13 |
| PF05096 | Glu_cyclase_2 | 0.56 |
| PF13517 | FG-GAP_3 | 0.56 |
| PF13472 | Lipase_GDSL_2 | 0.56 |
| PF14300 | DUF4375 | 0.56 |
| PF07366 | SnoaL | 0.56 |
| PF02597 | ThiS | 0.56 |
| PF05721 | PhyH | 0.56 |
| PF07589 | PEP-CTERM | 0.56 |
| PF03795 | YCII | 0.56 |
| PF13520 | AA_permease_2 | 0.56 |
| PF04773 | FecR | 0.56 |
| PF13620 | CarboxypepD_reg | 0.56 |
| PF05988 | DUF899 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 8.47 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 8.47 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 8.47 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 8.47 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.13 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.13 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.13 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.56 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.56 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.56 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.97 % |
| Unclassified | root | N/A | 35.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107611475 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300001089|JGI12683J13190_1006321 | Not Available | 1275 | Open in IMG/M |
| 3300001545|JGI12630J15595_10045477 | Not Available | 884 | Open in IMG/M |
| 3300001545|JGI12630J15595_10073748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300001593|JGI12635J15846_10191620 | Not Available | 1360 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100540590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100753995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300002911|JGI25390J43892_10153285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300003372|JGI26336J50218_1008092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 711 | Open in IMG/M |
| 3300005171|Ga0066677_10323282 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005332|Ga0066388_102557935 | Not Available | 929 | Open in IMG/M |
| 3300005537|Ga0070730_10044130 | All Organisms → cellular organisms → Bacteria | 3263 | Open in IMG/M |
| 3300005540|Ga0066697_10663199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300005541|Ga0070733_10771532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300005542|Ga0070732_10551466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300005552|Ga0066701_10846567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300005555|Ga0066692_10999770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300005557|Ga0066704_10012123 | All Organisms → cellular organisms → Bacteria | 4822 | Open in IMG/M |
| 3300005602|Ga0070762_11059062 | Not Available | 558 | Open in IMG/M |
| 3300005712|Ga0070764_10161887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1236 | Open in IMG/M |
| 3300005764|Ga0066903_108404323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300006034|Ga0066656_10890416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300006059|Ga0075017_101332663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300006173|Ga0070716_100684567 | Not Available | 782 | Open in IMG/M |
| 3300006175|Ga0070712_101304045 | Not Available | 633 | Open in IMG/M |
| 3300006804|Ga0079221_11052391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300006806|Ga0079220_10532705 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300006806|Ga0079220_12107681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300007255|Ga0099791_10324906 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300007255|Ga0099791_10482378 | Not Available | 601 | Open in IMG/M |
| 3300007258|Ga0099793_10097946 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300007788|Ga0099795_10229985 | Not Available | 792 | Open in IMG/M |
| 3300009038|Ga0099829_10059843 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300009038|Ga0099829_11482313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300009088|Ga0099830_10046058 | All Organisms → cellular organisms → Bacteria | 3051 | Open in IMG/M |
| 3300009088|Ga0099830_11600370 | Not Available | 543 | Open in IMG/M |
| 3300009090|Ga0099827_11228008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300009162|Ga0075423_11645375 | Not Available | 691 | Open in IMG/M |
| 3300009520|Ga0116214_1251296 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300009522|Ga0116218_1507715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300010046|Ga0126384_11095044 | Not Available | 730 | Open in IMG/M |
| 3300010048|Ga0126373_12406022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300010048|Ga0126373_12739072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300010325|Ga0134064_10159113 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300010326|Ga0134065_10413210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300010337|Ga0134062_10053589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1648 | Open in IMG/M |
| 3300010360|Ga0126372_11959202 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010360|Ga0126372_12505421 | Not Available | 567 | Open in IMG/M |
| 3300010366|Ga0126379_13411202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300010376|Ga0126381_100507142 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300010376|Ga0126381_103160932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300010379|Ga0136449_104425849 | Not Available | 518 | Open in IMG/M |
| 3300011269|Ga0137392_11123438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300011270|Ga0137391_10544433 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300011271|Ga0137393_10270966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1443 | Open in IMG/M |
| 3300011271|Ga0137393_11798215 | Not Available | 501 | Open in IMG/M |
| 3300012096|Ga0137389_10471102 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300012198|Ga0137364_10834141 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012202|Ga0137363_10149118 | Not Available | 1836 | Open in IMG/M |
| 3300012202|Ga0137363_11225309 | Not Available | 637 | Open in IMG/M |
| 3300012203|Ga0137399_11008926 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300012203|Ga0137399_11143168 | Not Available | 655 | Open in IMG/M |
| 3300012205|Ga0137362_11498274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300012207|Ga0137381_11250836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300012207|Ga0137381_11573179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300012209|Ga0137379_11134951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300012210|Ga0137378_10648613 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012351|Ga0137386_10958224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300012361|Ga0137360_11511620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300012362|Ga0137361_10312663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1438 | Open in IMG/M |
| 3300012363|Ga0137390_10091495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3000 | Open in IMG/M |
| 3300012363|Ga0137390_10970875 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300012582|Ga0137358_10045089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2927 | Open in IMG/M |
| 3300012582|Ga0137358_10169370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
| 3300012582|Ga0137358_10898462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300012917|Ga0137395_10012971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4625 | Open in IMG/M |
| 3300012923|Ga0137359_10756922 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300012925|Ga0137419_10207159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1455 | Open in IMG/M |
| 3300012925|Ga0137419_11643006 | Not Available | 547 | Open in IMG/M |
| 3300012927|Ga0137416_10515198 | Not Available | 1032 | Open in IMG/M |
| 3300012927|Ga0137416_10673656 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300012929|Ga0137404_11983801 | Not Available | 543 | Open in IMG/M |
| 3300012930|Ga0137407_10590169 | Not Available | 1042 | Open in IMG/M |
| 3300012930|Ga0137407_11136148 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012944|Ga0137410_11638010 | Not Available | 565 | Open in IMG/M |
| 3300012989|Ga0164305_10233057 | Not Available | 1318 | Open in IMG/M |
| 3300014166|Ga0134079_10553284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300015051|Ga0137414_1031478 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300015264|Ga0137403_11626428 | Not Available | 500 | Open in IMG/M |
| 3300015356|Ga0134073_10101731 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300015374|Ga0132255_101015329 | Not Available | 1245 | Open in IMG/M |
| 3300017955|Ga0187817_10525302 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300017970|Ga0187783_10334257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
| 3300017994|Ga0187822_10328803 | Not Available | 546 | Open in IMG/M |
| 3300018012|Ga0187810_10289074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300018431|Ga0066655_11314635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300020004|Ga0193755_1173552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300020199|Ga0179592_10217433 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300021086|Ga0179596_10581925 | Not Available | 568 | Open in IMG/M |
| 3300021088|Ga0210404_10896750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300021168|Ga0210406_10177193 | Not Available | 1778 | Open in IMG/M |
| 3300021171|Ga0210405_10558756 | Not Available | 893 | Open in IMG/M |
| 3300021181|Ga0210388_10402563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300021181|Ga0210388_10639126 | Not Available | 929 | Open in IMG/M |
| 3300021401|Ga0210393_11095682 | Not Available | 643 | Open in IMG/M |
| 3300021401|Ga0210393_11412631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300021405|Ga0210387_11748759 | Not Available | 525 | Open in IMG/M |
| 3300021406|Ga0210386_11529624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300021406|Ga0210386_11656843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300021407|Ga0210383_10162859 | Not Available | 1899 | Open in IMG/M |
| 3300021420|Ga0210394_10223871 | Not Available | 1643 | Open in IMG/M |
| 3300021432|Ga0210384_10106804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2511 | Open in IMG/M |
| 3300021474|Ga0210390_10986545 | Not Available | 689 | Open in IMG/M |
| 3300021476|Ga0187846_10135145 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300021479|Ga0210410_10626153 | Not Available | 954 | Open in IMG/M |
| 3300021479|Ga0210410_11556919 | Not Available | 554 | Open in IMG/M |
| 3300021560|Ga0126371_12387875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300024182|Ga0247669_1002979 | All Organisms → cellular organisms → Bacteria | 4021 | Open in IMG/M |
| 3300024222|Ga0247691_1075337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300025439|Ga0208323_1089832 | Not Available | 503 | Open in IMG/M |
| 3300025929|Ga0207664_11670807 | Not Available | 559 | Open in IMG/M |
| 3300026298|Ga0209236_1113058 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300026304|Ga0209240_1006483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4410 | Open in IMG/M |
| 3300026306|Ga0209468_1197975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300026310|Ga0209239_1122605 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300026310|Ga0209239_1212940 | Not Available | 683 | Open in IMG/M |
| 3300026320|Ga0209131_1404737 | Not Available | 511 | Open in IMG/M |
| 3300026355|Ga0257149_1053606 | Not Available | 584 | Open in IMG/M |
| 3300026361|Ga0257176_1061295 | Not Available | 601 | Open in IMG/M |
| 3300026497|Ga0257164_1034084 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300026514|Ga0257168_1032135 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300026528|Ga0209378_1114484 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300026551|Ga0209648_10480908 | Not Available | 739 | Open in IMG/M |
| 3300026555|Ga0179593_1281236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1598 | Open in IMG/M |
| 3300026557|Ga0179587_10127950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1565 | Open in IMG/M |
| 3300027071|Ga0209214_1049911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300027512|Ga0209179_1040944 | Not Available | 975 | Open in IMG/M |
| 3300027521|Ga0209524_1054550 | Not Available | 842 | Open in IMG/M |
| 3300027565|Ga0209219_1129944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300027591|Ga0209733_1062272 | Not Available | 976 | Open in IMG/M |
| 3300027591|Ga0209733_1142891 | Not Available | 584 | Open in IMG/M |
| 3300027633|Ga0208988_1031464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1367 | Open in IMG/M |
| 3300027660|Ga0209736_1207567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300027669|Ga0208981_1103305 | Not Available | 727 | Open in IMG/M |
| 3300027684|Ga0209626_1195251 | Not Available | 537 | Open in IMG/M |
| 3300027738|Ga0208989_10165357 | Not Available | 740 | Open in IMG/M |
| 3300027824|Ga0209040_10542493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300027846|Ga0209180_10614688 | Not Available | 599 | Open in IMG/M |
| 3300027862|Ga0209701_10689659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300027884|Ga0209275_10677146 | Not Available | 594 | Open in IMG/M |
| 3300027908|Ga0209006_11072589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300027911|Ga0209698_11087463 | Not Available | 593 | Open in IMG/M |
| 3300027915|Ga0209069_10746392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300028536|Ga0137415_10006593 | All Organisms → cellular organisms → Bacteria | 11509 | Open in IMG/M |
| 3300028563|Ga0265319_1269302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300028906|Ga0308309_10137362 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300028906|Ga0308309_11121668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300029636|Ga0222749_10158263 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300030520|Ga0311372_10204418 | All Organisms → cellular organisms → Bacteria | 3293 | Open in IMG/M |
| 3300030737|Ga0302310_10123651 | Not Available | 1578 | Open in IMG/M |
| 3300030991|Ga0073994_10083439 | Not Available | 616 | Open in IMG/M |
| 3300031718|Ga0307474_11487868 | Not Available | 533 | Open in IMG/M |
| 3300031748|Ga0318492_10433606 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300031764|Ga0318535_10540942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300031820|Ga0307473_10102463 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300031820|Ga0307473_10764134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
| 3300031823|Ga0307478_10747118 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031896|Ga0318551_10360451 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031912|Ga0306921_10846153 | Not Available | 1042 | Open in IMG/M |
| 3300031954|Ga0306926_12188452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300031962|Ga0307479_11208100 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300032160|Ga0311301_13032439 | Not Available | 504 | Open in IMG/M |
| 3300032174|Ga0307470_10084710 | Not Available | 1762 | Open in IMG/M |
| 3300032180|Ga0307471_100391803 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300034125|Ga0370484_0021851 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300034178|Ga0364934_0110892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.82% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.13% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.13% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.13% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.13% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.56% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003372 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1076114751 | 3300000955 | Soil | MGEQVRELFTWARRRKILAAFFVAMTLVIGILIGSIVSGRTSAMKSFGFGGTTAT |
| JGI12683J13190_10063213 | 3300001089 | Forest Soil | MGEQVKDLFIWARKRKILAMFFVAFTLVVGILIGSVVSGRVSAVKNTFAGV |
| JGI12630J15595_100454773 | 3300001545 | Forest Soil | MGQQVKELFDWARRRKILASVFVTLTLVVGILIGSVVSGRVSAMKTFS |
| JGI12630J15595_100737481 | 3300001545 | Forest Soil | MGQQVKELYNWARQRKVLAAVFVALTLTVGILIGSVVSGRVSATK |
| JGI12635J15846_101916201 | 3300001593 | Forest Soil | MGEQVKDLFIWARKRKILAMFFVAFTLVVGILIGSVVSGRVSAVKNTFA |
| JGIcombinedJ26739_1005405902 | 3300002245 | Forest Soil | MGLQVKELFDWARRRKILASAFLVITLGVGIMIGSIVSGRVSAMKALSF |
| JGIcombinedJ26739_1007539952 | 3300002245 | Forest Soil | MGEQVKEIYNWARRRKIMAAFFVALTLLVGIMIGSVVSGRVSAVKNTAF |
| JGI25390J43892_101532851 | 3300002911 | Grasslands Soil | MGEQVKELMDWARRRKVLAAVFVAFTLVVGILIGSIVSGR |
| JGI26336J50218_10080921 | 3300003372 | Bog Forest Soil | MGEQVNEIYNWSRQRKILVSVLVAFTLSVGVLIGSVVSGRVSAMKTFVATGVTPLA |
| Ga0066677_103232822 | 3300005171 | Soil | MGEQVKEILNWARQRKILASAFVALTLLVGILIGSLVSGRVS |
| Ga0066388_1025579351 | 3300005332 | Tropical Forest Soil | MGQQVREIFGWARRRKLLASAFLCLTLLVGILIGSIVSGRTSAMKGLSAFAGTNAT |
| Ga0070730_100441304 | 3300005537 | Surface Soil | MGEQVKEIFNWARRRKYLASFFVAFTLVLGIMIGSVISGRVSAMK |
| Ga0066697_106631991 | 3300005540 | Soil | MGDQVKELLNWARQRKILAGIFVSFTLVVGILIGSIVSGRVSATKGF |
| Ga0070733_107715321 | 3300005541 | Surface Soil | MGQQVREIFSWARQRKLLASAFLILTLVVGILIGSIVSGRTSAMKAMSTFA |
| Ga0070732_105514663 | 3300005542 | Surface Soil | MGEQVKELFNWARRRKVLASAFVAFTLVLGIMIGTIVSGRVSAMKAF |
| Ga0066701_108465671 | 3300005552 | Soil | MGDQVRELLNWARQRKILAAAFVGFTLVVGILIGSVVSGRVSATKGFGFPGT |
| Ga0066692_109997701 | 3300005555 | Soil | MGEQVKELMDWARRRKVLAAVFVAFTLVVGILIGSIVSGRVSATKGFGFSG |
| Ga0066704_100121235 | 3300005557 | Soil | MGEQVKELMNWAKRRKILATAFVALTLVVGILIGSVISGRVSATKGF |
| Ga0070762_110590621 | 3300005602 | Soil | MGQQVLEIFGWARRRKLLASAFLVLTLVIGILIGSIVSGRTSAMRAMSAFAG |
| Ga0070764_101618871 | 3300005712 | Soil | MGEQVKELFNWARRRKIMASFFVGFTLIVGIMIGSVISGRVSAMKSFSGTDAA |
| Ga0066903_1084043232 | 3300005764 | Tropical Forest Soil | MGDQVKEFFNWARQRKVLTAALVGLTLAVGILIGSVLSGRVSAT |
| Ga0066656_108904161 | 3300006034 | Soil | MGEQVKELLNWARQRKVLASVFVAFTLAVGILIGSVVSGRVSAMKSF |
| Ga0075017_1013326632 | 3300006059 | Watersheds | MGEQVKELFSWARRRKILAAAFVAFTLTVGILIGSV |
| Ga0070716_1006845671 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLQVKELFDWARRRKILATAFLVVTLGVGIVIGSIVSGKVSAMKTFSF |
| Ga0070712_1013040451 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQQVKELFDWARRRKLLASFFVALTLVVGILIGSVVSG |
| Ga0079221_110523912 | 3300006804 | Agricultural Soil | MGEQVREILNWARQRKILAAAFVTLTLLVGILIGSVVSGRVSAT |
| Ga0079220_105327051 | 3300006806 | Agricultural Soil | MGDQVREILNWARQRKILAAAFVSFTLLVGILIGSVVSGRVSATKGFG |
| Ga0079220_121076811 | 3300006806 | Agricultural Soil | MGEQVKELMDWARRRKILASAFVAFTLVVGILIGSVVSGRVSAMKTLGFAGTSA |
| Ga0099791_103249061 | 3300007255 | Vadose Zone Soil | MGEQVRELLNWARRRKILAAIFVAFTLTVGILIGSVVS |
| Ga0099791_104823781 | 3300007255 | Vadose Zone Soil | MGEQVRELFTWARRRKILATFFVVLTLTVGILIGSIVSGRTSAMKSFGFGG |
| Ga0099793_100979461 | 3300007258 | Vadose Zone Soil | MGEQVRELFTWARRRKILATFFVVLTLGIGILIGSIVSGRTSAMKS |
| Ga0099795_102299852 | 3300007788 | Vadose Zone Soil | MGQQVKELFDWARRRKILASVFVALTLVVGILIGSVVSGRVSAMKTMSFAGTN |
| Ga0099829_100598435 | 3300009038 | Vadose Zone Soil | MGQQVKELFDWARRRKILASAFVALTLTVGIMIGSVVSG |
| Ga0099829_114823132 | 3300009038 | Vadose Zone Soil | MGEQVKELVGWARRRKMLASLFVVFTLGGGIMIGTVVSGRVSAMKAISFAGAGAS |
| Ga0099830_100460581 | 3300009088 | Vadose Zone Soil | MAQQVKELFDWARRRKILASAFVALTLTVGIMIGSVVSGRVSAMK |
| Ga0099830_116003701 | 3300009088 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLTVGILIGSVVSGRVSAMKSL |
| Ga0099827_112280081 | 3300009090 | Vadose Zone Soil | MGEQVKELLNWARQRKVLASVFVAFTLAVGILIGSVVSGRVSAMKSFAF |
| Ga0075423_116453751 | 3300009162 | Populus Rhizosphere | MGQVNGLSAWTRRKKILASMSVVVTLALGIMIGSVVSGKVSAMKTLSTFAGTSAT |
| Ga0116214_12512961 | 3300009520 | Peatlands Soil | MGEQVKEIFNWARRRKIMASFFVAFTLVTGIMIGSVISGR |
| Ga0116218_15077152 | 3300009522 | Peatlands Soil | MGEQVREIFNWARRRKILAGVFVAFTLAVGILIGSVVSVRVSAMKTLAFPGT |
| Ga0126384_110950441 | 3300010046 | Tropical Forest Soil | MGEQVREIVGWARRRKALAGFFLAFTLGVGIMIGS |
| Ga0126373_124060221 | 3300010048 | Tropical Forest Soil | MGDQVKELLNWARQQKILAGVFVSFTLVVGILIGSVVS |
| Ga0126373_127390722 | 3300010048 | Tropical Forest Soil | MGQQVKELLGWARQRKILASFFVVLTLAIGIMIGSVVSGKVSAMKTFSFAGT |
| Ga0134064_101591131 | 3300010325 | Grasslands Soil | MGEQVKEMFNWARRRKILAAVFVAFTLAVGILIGSVVSGRV |
| Ga0134065_104132101 | 3300010326 | Grasslands Soil | MGDQVKELLNWARQRKILAGIFVSFTLVVGILIGSIVSGRVSATKGFGF |
| Ga0134062_100535891 | 3300010337 | Grasslands Soil | MGDQVKELLNWARQRKILAGIFVSFTLVVGILIGS |
| Ga0126372_119592022 | 3300010360 | Tropical Forest Soil | MGDQVKELMNWARRRKVLATGFLAFTLAVGILIGS |
| Ga0126372_125054211 | 3300010360 | Tropical Forest Soil | MGDQVKELMDWARRRKVLATGFLAFTLAVGILIGSIVS |
| Ga0126379_134112021 | 3300010366 | Tropical Forest Soil | MGDQVKELLNWARQRKILAGVFVGFTLVVGILIGSVVS |
| Ga0126381_1005071421 | 3300010376 | Tropical Forest Soil | MGDQVRELLNWARQRKILAGVFVGFTLVVGILIGSVVSGRVSAT |
| Ga0126381_1031609322 | 3300010376 | Tropical Forest Soil | MGDQVKELLNWARQRKILAGVFVGFTLVVGILIGSVVSGRVSAT |
| Ga0136449_1044258492 | 3300010379 | Peatlands Soil | LAPDDPEEQVKMAEQVQEFLNWAKRRKVMAFAFLALTLGVGIVIGSIVSGRVSATK |
| Ga0137392_111234381 | 3300011269 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVAATKSLGF |
| Ga0137391_105444332 | 3300011270 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVAATKSLGFSGTTA |
| Ga0137393_102709663 | 3300011271 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLTIGILIGSVVSGRVSATKGFGFAG |
| Ga0137393_117982151 | 3300011271 | Vadose Zone Soil | MGEQVKELMDWARRRKILAGVFVAITLVVGILIGSVVSGRVS |
| Ga0137389_104711023 | 3300012096 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAIFVAFTLAVGILIGSVVSGRVSAM |
| Ga0137364_108341411 | 3300012198 | Vadose Zone Soil | MGEQVKELMDWARRRKVLAAVFVAFTLVVGILIGSIVSGRVSA |
| Ga0137363_101491182 | 3300012202 | Vadose Zone Soil | MGEQVKELFSWARRRKILAAAFVAFTLTVGILIGSVISGRVSAMKTLPFSGA |
| Ga0137363_112253091 | 3300012202 | Vadose Zone Soil | MGEQVRELFTWARRRKILATFFVVLTLAVGILIGSIVSGRTSAMKSFGFG |
| Ga0137399_110089262 | 3300012203 | Vadose Zone Soil | MGEQVKELFSWARRRKTLATFFVVLTLGIGILIGSIVSGRTSAM |
| Ga0137399_111431681 | 3300012203 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVSAMKSIGFS |
| Ga0137362_114982742 | 3300012205 | Vadose Zone Soil | MGEQVKELMGWARRRKVLASAFVAFTLVVGILIGSVVSGR |
| Ga0137381_102364071 | 3300012207 | Vadose Zone Soil | MGQQMRELLDWGKRRKVLASLAIALTLSVGILIGSVISGR |
| Ga0137381_112508361 | 3300012207 | Vadose Zone Soil | MGEQVKELLNWARQRKVLASVFVAFTLAVGILIGSVVS |
| Ga0137381_115731791 | 3300012207 | Vadose Zone Soil | MGEQVREILNWARQRKILAAAFVTLTLLVGILIGSVVSG |
| Ga0137379_111349511 | 3300012209 | Vadose Zone Soil | MGEQVKELLNWARQRKVLASVFVAFTLAVGILIGSVVSGRVSAMK |
| Ga0137378_106486132 | 3300012210 | Vadose Zone Soil | MEEQVRELFNWTRRRKILAAVFVAFTLTVGILIGSFVSGRVS |
| Ga0137386_109582241 | 3300012351 | Vadose Zone Soil | MGEQVKELLNWARQRKVLASVFVAFTLAVGILIGSV |
| Ga0137360_115116201 | 3300012361 | Vadose Zone Soil | MGEQVKELFDWARRRKILAAVFVAFTLVVGILIGSVVSGRVSATKGFGFSGTTA |
| Ga0137361_103126633 | 3300012362 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVSAMKSIGFSG |
| Ga0137390_100914951 | 3300012363 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVS |
| Ga0137390_109708752 | 3300012363 | Vadose Zone Soil | MGEQVKELMDWARRRKILASVFVALTLVVGILIGSLVSGRVSAMKSFGFAGT |
| Ga0137358_100450895 | 3300012582 | Vadose Zone Soil | MGEQVKELMDWARRRKVLAAIFVAFTLVVGILIGSVVSGRVSAT |
| Ga0137358_101693701 | 3300012582 | Vadose Zone Soil | MGQQVKELFDWARRRKILASAFVALTLTVGIMIGSVVS |
| Ga0137358_108984621 | 3300012582 | Vadose Zone Soil | MGEQVKELMDWARRRKVLAAIFVAFTLVVGILIGSVVSGRVSATKGFGF |
| Ga0137395_100129711 | 3300012917 | Vadose Zone Soil | MGEQVREMFNWSRRRKILAGVFVAFTLAVGILIGSV |
| Ga0137359_107569221 | 3300012923 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLTVGILIGSVVSGRV |
| Ga0137419_102071593 | 3300012925 | Vadose Zone Soil | MEERVRELFNWTRRRKILAAVFVAFTLTVGILIGSVVSGRVSAMKSLGFSGT |
| Ga0137419_116430062 | 3300012925 | Vadose Zone Soil | MGQQVKELFDWARRRKLLASFFVALTLVVGILIGSVVSGRVSAMKTSFAG |
| Ga0137416_105151981 | 3300012927 | Vadose Zone Soil | MGQQVKELFDWARRRKILASFFVALTLTIGILIGSVVSGRVSAMKT |
| Ga0137416_106736561 | 3300012927 | Vadose Zone Soil | MGEQVRELFTWARRRKILATFFVVLTLAVGILIGSIVSGRTSAMKSFG |
| Ga0137404_119838011 | 3300012929 | Vadose Zone Soil | MGQQVKELFDWARRRKILASFFVALTLTIGILIGSVVSGRVS |
| Ga0137407_105901691 | 3300012930 | Vadose Zone Soil | MGQQVKELFDWARRRKILAAFFVALTLTVGILIGSVVSGRVSAMKT |
| Ga0137407_111361482 | 3300012930 | Vadose Zone Soil | MGEQVKELMDWARRRKILASVFVAFTLVVGILIGSVVSGRTSAMRSLGFAG |
| Ga0137410_116380101 | 3300012944 | Vadose Zone Soil | MGEQVRELFDWARRRKILAAVFVAFTLAVGILIGSVVSGRVSA |
| Ga0164305_102330571 | 3300012989 | Soil | MGLQVKELFDWARRRKIAASLFVVLTLSVGILIGSVVSGKVSAMKT |
| Ga0134079_105532841 | 3300014166 | Grasslands Soil | MGDQVRELLNWARQRKILAAAFVGFTLVVGILIGSVVSGRVSATKGF |
| Ga0137414_10314782 | 3300015051 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVSA |
| Ga0137403_116264281 | 3300015264 | Vadose Zone Soil | MGEQVRELFTWARRRKILATFFVVLTLTVGILIGSIVSGRTSAMKSFGFGGTTA |
| Ga0134073_101017311 | 3300015356 | Grasslands Soil | MGDQVRELLNWARQRKILAAAFVGFTLVVGILIGSVV |
| Ga0132255_1010153292 | 3300015374 | Arabidopsis Rhizosphere | MGQQVQELFGWARRRKFLATFFVGLTLAVGIMIGSV |
| Ga0187817_105253022 | 3300017955 | Freshwater Sediment | MGEQVKELFGWARRRKILATVFVAFTLAVGILIGSVVSGRVSAMKTAA |
| Ga0187783_103342571 | 3300017970 | Tropical Peatland | MGEQVQELFNWARRRKILASAFVAFTLVVGIMIGTVISGRVSAMKGFGGAD |
| Ga0187822_103288031 | 3300017994 | Freshwater Sediment | MGEQVREIFGWARRRKLLASGFVGLTLVIGIVLGTII |
| Ga0187810_102890742 | 3300018012 | Freshwater Sediment | MGEQVKELFNWARRRKIMASFFVAFTLVVGIMIGSVIS |
| Ga0066655_113146351 | 3300018431 | Grasslands Soil | MGEQVKELLNWARQRKVLASVFVAFTLAVGILIGSVVSGR |
| Ga0193755_11735521 | 3300020004 | Soil | MGEQVKELFNWARRRKIMAGIFVALTLVVGILIGSVVSG |
| Ga0179592_102174331 | 3300020199 | Vadose Zone Soil | MGEQVKELMDWARRRKILAVVFVAFTLVVGILIGSVVSGRVSATRGLGFAG |
| Ga0179596_105819251 | 3300021086 | Vadose Zone Soil | MGLQVKELFDWARRRKILASAFLVVTLGVGIVIGSI |
| Ga0210404_108967501 | 3300021088 | Soil | MGLQVKELFDWARRRKILASAFLVVTLGVGIMIGSIVSGRVSA |
| Ga0210406_101771932 | 3300021168 | Soil | MGQQVKELYDWARRRKILATIFVALTLTVGIMIGSVVSGRVSAMK |
| Ga0210405_105587561 | 3300021171 | Soil | MGQQVKELYDWARRRKILATIFVALTLTVGIMIGSVV |
| Ga0210388_104025631 | 3300021181 | Soil | MGEQVKELFNWARRRKIMASFFVAFTLVVGIMIGSVISG |
| Ga0210388_106391262 | 3300021181 | Soil | MGQQVLEIFGWARRRKLLASAFLVLTLVIGILIGSIVSGRTSAMRAMSAFAGTNATPLKV |
| Ga0210393_110956821 | 3300021401 | Soil | MGQQVLEIFGWARRRKLLASAFLVLTLVVGILIGSIVSGRTSAMKA |
| Ga0210393_114126311 | 3300021401 | Soil | MGEQVKELFNWARRRKIMASFFVAFTLVTGIMIGSVISGRVS |
| Ga0210387_117487591 | 3300021405 | Soil | MGQQVREIFGWARRRKLLASGFLVLTLMVGILIGSIV |
| Ga0210386_115296241 | 3300021406 | Soil | MGLQVKELFDWARRRKILASAFLVVTLGVGIMIGSIVSGRVSAMKALSFAGTNAT |
| Ga0210386_116568431 | 3300021406 | Soil | MGLQVKELFDWARRRKILASAFLVITLGVGIMIGSV |
| Ga0210383_101628592 | 3300021407 | Soil | MGLQVKELFDWARRRKILASAFLVITLGVGIMIGSVVSGRVSAMKALSFAGTTAP |
| Ga0210394_102238712 | 3300021420 | Soil | MGLQVKELFDWARRRKILASAFLVITLGVGIVIGSIVSGKVSAMKTLTFAGTNA |
| Ga0210384_101068043 | 3300021432 | Soil | MGLQAKELLDWARRRKVLASAFLVITLAVGIVIGSIVSGKVSAMKAMSF |
| Ga0210390_109865451 | 3300021474 | Soil | MGQQVLEIFGWARRRKLLASAFLVLTLVVGILIGSIVS |
| Ga0187846_101351451 | 3300021476 | Biofilm | MGEQVRELFDWARRRKVLAGVFVAFTLAVGILIGSVVS |
| Ga0210410_106261532 | 3300021479 | Soil | MGQQVQELFDWARRRKILASVFVAITLCAGILIGTIV |
| Ga0210410_115569191 | 3300021479 | Soil | MGLQVKELFDWARRRKIAASLFVVLTLSVGILIGSVVSGKVSAMKTLSTFAGT |
| Ga0126371_123878751 | 3300021560 | Tropical Forest Soil | MGEQVKEFLNWARQRKILTAALVGLTLVVGILIGSVVSGRVSATKGFGFRGTTA |
| Ga0247669_10029796 | 3300024182 | Soil | MGEQVKEIFNWARRRKYLASFFVAFTLVLGIMIGSVISGRVSVMKSF |
| Ga0247691_10753371 | 3300024222 | Soil | MGEQVKEIFNWARRRKYLASFFVAFTLVLGIMIGSVISGRVSAM |
| Ga0208323_10898322 | 3300025439 | Peatland | MGHMVDWARQRKLLVSVLLILCLGIGILIGTLVSGRVSAMKGFAGTNA |
| Ga0207664_116708071 | 3300025929 | Agricultural Soil | MGQQVREIFDWARRRKLLASAFLVLTLVIGILIGSVVSGRTSAMKAMSSF |
| Ga0209236_11130581 | 3300026298 | Grasslands Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGS |
| Ga0209240_10064836 | 3300026304 | Grasslands Soil | MGQQVKELFDWARRRKILASVFVALTLTVGIMIGSVVSGRVSAMK |
| Ga0209468_11979751 | 3300026306 | Soil | MGDQVKELLNWARQRKILAGIFVSFTLVVGILIGSIVSGRVSATKGFG |
| Ga0209239_11226051 | 3300026310 | Grasslands Soil | MGEQVKEMFNWARRRKILAAVFVAFTLAVGILIGS |
| Ga0209239_12129402 | 3300026310 | Grasslands Soil | MGEQVKEILNWARQRKILASAFVALTLLVGILIGSLVS |
| Ga0209131_14047371 | 3300026320 | Grasslands Soil | MGDQVRELFDWARRRKILAAVFVAFTLALGILIGSVVSGRVSAMKSLG |
| Ga0257149_10536061 | 3300026355 | Soil | MGQQVKELFDWARRRKLLASFFVALTLVVGILIGSVVSGRVSAMKTSFAGTNAT |
| Ga0257176_10612951 | 3300026361 | Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVSAMKS |
| Ga0257164_10340842 | 3300026497 | Soil | MGEQVRELFTWARRRKILATFFVALTLGVGILIGS |
| Ga0257168_10321353 | 3300026514 | Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGIMIGSVVSGR |
| Ga0209378_11144841 | 3300026528 | Soil | MEEQVRELFNWTRRRKILAAVFVAFTLTVGILIGSVVSGRVSA |
| Ga0209648_104809081 | 3300026551 | Grasslands Soil | MGEQVKELFSWARRRKILAAVFVAFTLTVGILIGSVIS |
| Ga0179593_12812361 | 3300026555 | Vadose Zone Soil | MGEQVKEIFNWARRRKIMASFFVAFTLVTGIVIGSIISGRVSAMKTFSGTN |
| Ga0179587_101279501 | 3300026557 | Vadose Zone Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGIMIGSVVSGRVSATKSLGFSGTKA |
| Ga0209214_10499111 | 3300027071 | Forest Soil | MGEQVREILNWARQRKILAAGFVTLTLLVGILIGSVVSGRVSAT |
| Ga0209179_10409441 | 3300027512 | Vadose Zone Soil | MGQQVKELFDWARRRKILAAFFVALTLTVGILIGSVVSGRVSAMKTS |
| Ga0209524_10545502 | 3300027521 | Forest Soil | MGQQVKELFDWARRRKILASLFVALTLTVGILIGSVVSGRVS |
| Ga0209219_11299441 | 3300027565 | Forest Soil | MGEQVKEIYNWARRRKIMAGFFVALTLLVGIMIGSVVSGRVSAVKN |
| Ga0209733_10622721 | 3300027591 | Forest Soil | MGQQVKELFDWARRRKILASLFVALTLVVGILIGSVVSGRVSAMKTMSFAGT |
| Ga0209733_11428911 | 3300027591 | Forest Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSVVSGRVSAMKSL |
| Ga0208988_10314643 | 3300027633 | Forest Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGILIGSV |
| Ga0209736_12075671 | 3300027660 | Forest Soil | MGEQVKEIYNWARRRKIMAGFFVALTLLVGIMIGSVVSGRVS |
| Ga0208981_11033051 | 3300027669 | Forest Soil | MGQQVKELFDWARRRKILAAFFVALTLTVGILIGSVVSGRVSAMKTSFA |
| Ga0209626_11952511 | 3300027684 | Forest Soil | MGEQVREMFNWSRRRKILAGVFVAFTLAVGILIGSVVSGRVSAMK |
| Ga0208989_101653572 | 3300027738 | Forest Soil | MGQQVKELFDWARRRKLLASFFVALTLVVGILIGSVVSGRVSAMKT |
| Ga0209040_105424931 | 3300027824 | Bog Forest Soil | MGEQVKELFNWARRRKIMASFFVAFTLVVGIMIGSVISGRVSAMKSF |
| Ga0209180_106146881 | 3300027846 | Vadose Zone Soil | MGEQVREIFSWARRRKIMAAVFVAFTLTVGIMIGTVISGRVSAMKS |
| Ga0209701_106896591 | 3300027862 | Vadose Zone Soil | MGEQVRELMDWARRRKILASVFVAFTLVVGILIGSVVSGRTS |
| Ga0209275_106771461 | 3300027884 | Soil | MGQQVLEIFGWARRRKLLASAFLVLTLVIGILIGSIVSGRTSAMRAMSAFAGTNAT |
| Ga0209006_110725891 | 3300027908 | Forest Soil | MGEQVKEIYNWARRRKIMAAFFVALTLLVGIMIGSVVSGRVSAVKNTAFGGT |
| Ga0209698_110874631 | 3300027911 | Watersheds | MGEQVQELFSWARRRKILVAVFVTFTLAVGILIGSVVS |
| Ga0209069_107463922 | 3300027915 | Watersheds | MGQQVRELFDWARRRKILASAFVALTLTVGILIGSVVSGRVSAMKTFS |
| Ga0137415_1000659313 | 3300028536 | Vadose Zone Soil | MGQQVKELFDWARRRKILASAFVALTLTVGILIGSVVSGRVSAMK |
| Ga0265319_12693021 | 3300028563 | Rhizosphere | MGEQVKELFNWARRRKILAAFFVAFTLVVGIMIGSVISGRVSAM |
| Ga0308309_101373623 | 3300028906 | Soil | MGEQVKEIFNWARRRKIMASFFVAFTLVTGIMIGSVISGRVSAMKSF |
| Ga0308309_111216681 | 3300028906 | Soil | MGEQVKELFNWARRRKIMASFFVAFTLVTGIMIGSVISGRVSAMKSFSGTNAT |
| Ga0222749_101582631 | 3300029636 | Soil | MGEQVKELFDWARRRKIVVSVLVVFTLGIGILIGSVVSGRVSAMKTLGF |
| Ga0311372_102044181 | 3300030520 | Palsa | MSQQFNDLFGWARRRKFLAAFAVALTLVVGILIGSIVSGRVSAMKGFAGTNATP |
| Ga0302310_101236512 | 3300030737 | Palsa | MSQQFNDLFGWARRRKFLAAFAVALTLVVGILIGSIVSGRVSA |
| Ga0073994_100834391 | 3300030991 | Soil | MGEQVRELFNWARRRKILAAVFVAFTLAVGIMIGSVVSGRVSATKSLGF |
| Ga0307474_114878681 | 3300031718 | Hardwood Forest Soil | MGQQVKELFDWARRRKILASVFVALTLTVGIMIGSVVSGR |
| Ga0318492_104336061 | 3300031748 | Soil | MGDQVRELLNWARQRKILAAAFVSFTLVVGILIGSV |
| Ga0318535_105409421 | 3300031764 | Soil | MGDQVRELLNWARQRKILAAAFVSFTLVVGILIGSVVSGRVSATKGFGFPGTTA |
| Ga0307473_101024631 | 3300031820 | Hardwood Forest Soil | MGEQVKELFDWARRRKILAAVFVAFTLALGILIGSVVSGRV |
| Ga0307473_107641342 | 3300031820 | Hardwood Forest Soil | MGDQVRELLNWARQRKILAAAFVGFTLVVGILIGSVVSGRVSAT |
| Ga0307478_107471182 | 3300031823 | Hardwood Forest Soil | MEDQTRVNSSWTRRRKMLAAGFVALALAVGILIGSVVSGRV |
| Ga0318551_103604512 | 3300031896 | Soil | MGDQVRELLNWARQRKILAAAFVSFTLVVGILIGS |
| Ga0306921_108461531 | 3300031912 | Soil | MGEQVKEIVSWARRRKALAGFFLAFTLGVGVIIGSLVSDKVQAMRSTF |
| Ga0306926_121884521 | 3300031954 | Soil | MGDQVRELLNWARQRKILAGVFVGFTLVVGILIGSVVSG |
| Ga0307479_112081001 | 3300031962 | Hardwood Forest Soil | MGAQVKELMDWARRRKILAGAFVAFTLIVGILIGSVVSGRT |
| Ga0311301_130324391 | 3300032160 | Peatlands Soil | MAEQVQEFLNWAKRRKVMAFAFLALTLGVGIVIGSIVSGR |
| Ga0307470_100847102 | 3300032174 | Hardwood Forest Soil | MGQQVKELFDWARRRKILASLFVALTLVVGILIGSV |
| Ga0307471_1003918033 | 3300032180 | Hardwood Forest Soil | MEDQTRVNSSWTRRRKMLAAGFVALALAVGILIGSVVSGRVSATKSFGFAGTN |
| Ga0370484_0021851_1362_1472 | 3300034125 | Untreated Peat Soil | MGEQVKEIYNWARRRKIMAAFFVALTLLVGIMIGSVV |
| Ga0364934_0110892_3_110 | 3300034178 | Sediment | MGFEVREVLNWARQRKVAATLFVTLTLGVGILIGTV |
| ⦗Top⦘ |