| Basic Information | |
|---|---|
| Family ID | F033551 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ILLSKSAAESNAGVLGQDYLSTNFAVIDMGGRALYLRRPDSR |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.18 % |
| % of genes from short scaffolds (< 2000 bps) | 92.66 % |
| Associated GOLD sequencing projects | 144 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.254 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.554 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.282 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.14% β-sheet: 20.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 54.24 |
| PF00884 | Sulfatase | 5.08 |
| PF13379 | NMT1_2 | 3.39 |
| PF13650 | Asp_protease_2 | 1.69 |
| PF07883 | Cupin_2 | 1.13 |
| PF00005 | ABC_tran | 1.13 |
| PF13376 | OmdA | 1.13 |
| PF00892 | EamA | 0.56 |
| PF00528 | BPD_transp_1 | 0.56 |
| PF04820 | Trp_halogenase | 0.56 |
| PF00999 | Na_H_Exchanger | 0.56 |
| PF13520 | AA_permease_2 | 0.56 |
| PF13365 | Trypsin_2 | 0.56 |
| PF07963 | N_methyl | 0.56 |
| PF08734 | GYD | 0.56 |
| PF00589 | Phage_integrase | 0.56 |
| PF01434 | Peptidase_M41 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.56 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.56 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.56 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.56 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig74474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 717 | Open in IMG/M |
| 2170459002|FZY7DQ102JI02P | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
| 2170459005|F1BAP7Q02IL1SB | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 2170459006|GBPF9FW02G4FAR | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 548 | Open in IMG/M |
| 2170459007|GKWS7RC02JTGR4 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 534 | Open in IMG/M |
| 2170459010|GIO7OMY02JXOS9 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
| 2170459011|GI3SL7401AZ1I7 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
| 2189573004|GZGWRS402HL0ZI | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 512 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1003978 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
| 3300000890|JGI11643J12802_11594636 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 708 | Open in IMG/M |
| 3300000955|JGI1027J12803_101674768 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1111 | Open in IMG/M |
| 3300000955|JGI1027J12803_107670645 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 838 | Open in IMG/M |
| 3300004157|Ga0062590_100177275 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300004479|Ga0062595_100556414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 880 | Open in IMG/M |
| 3300004480|Ga0062592_100179750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1462 | Open in IMG/M |
| 3300005172|Ga0066683_10488226 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 753 | Open in IMG/M |
| 3300005186|Ga0066676_10270507 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1115 | Open in IMG/M |
| 3300005187|Ga0066675_10981034 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 636 | Open in IMG/M |
| 3300005288|Ga0065714_10082155 | All Organisms → cellular organisms → Bacteria | 2327 | Open in IMG/M |
| 3300005289|Ga0065704_10403639 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 744 | Open in IMG/M |
| 3300005293|Ga0065715_10393339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 891 | Open in IMG/M |
| 3300005335|Ga0070666_11266576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 550 | Open in IMG/M |
| 3300005434|Ga0070709_11708224 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 514 | Open in IMG/M |
| 3300005436|Ga0070713_100385519 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1306 | Open in IMG/M |
| 3300005447|Ga0066689_10284790 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1022 | Open in IMG/M |
| 3300005540|Ga0066697_10559343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 640 | Open in IMG/M |
| 3300005548|Ga0070665_102351607 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300005556|Ga0066707_10653714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 664 | Open in IMG/M |
| 3300005561|Ga0066699_10010878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 4524 | Open in IMG/M |
| 3300005568|Ga0066703_10418923 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005574|Ga0066694_10291715 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 776 | Open in IMG/M |
| 3300005598|Ga0066706_10622530 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005764|Ga0066903_102954620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 921 | Open in IMG/M |
| 3300005764|Ga0066903_103061797 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 905 | Open in IMG/M |
| 3300005841|Ga0068863_101333130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 725 | Open in IMG/M |
| 3300006034|Ga0066656_10245134 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1150 | Open in IMG/M |
| 3300006175|Ga0070712_100278448 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1346 | Open in IMG/M |
| 3300006175|Ga0070712_101683994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300006794|Ga0066658_10906959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300006796|Ga0066665_10052575 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2814 | Open in IMG/M |
| 3300006796|Ga0066665_11420748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 538 | Open in IMG/M |
| 3300006797|Ga0066659_10179602 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300006881|Ga0068865_100546798 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 972 | Open in IMG/M |
| 3300006904|Ga0075424_102842296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 504 | Open in IMG/M |
| 3300009038|Ga0099829_10432269 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300009147|Ga0114129_11729040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 762 | Open in IMG/M |
| 3300009176|Ga0105242_12735472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 543 | Open in IMG/M |
| 3300009177|Ga0105248_10953214 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 969 | Open in IMG/M |
| 3300009545|Ga0105237_12601050 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
| 3300009792|Ga0126374_11246332 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 598 | Open in IMG/M |
| 3300009792|Ga0126374_11487368 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300010046|Ga0126384_10154597 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1770 | Open in IMG/M |
| 3300010046|Ga0126384_10540042 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1011 | Open in IMG/M |
| 3300010047|Ga0126382_10236533 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300010047|Ga0126382_10870162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 776 | Open in IMG/M |
| 3300010047|Ga0126382_11105326 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 703 | Open in IMG/M |
| 3300010301|Ga0134070_10395655 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 544 | Open in IMG/M |
| 3300010304|Ga0134088_10007885 | All Organisms → cellular organisms → Bacteria | 4499 | Open in IMG/M |
| 3300010304|Ga0134088_10496801 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 601 | Open in IMG/M |
| 3300010326|Ga0134065_10330539 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 593 | Open in IMG/M |
| 3300010329|Ga0134111_10371517 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300010329|Ga0134111_10390705 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 594 | Open in IMG/M |
| 3300010333|Ga0134080_10593950 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 538 | Open in IMG/M |
| 3300010359|Ga0126376_12921418 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300010360|Ga0126372_12247309 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 595 | Open in IMG/M |
| 3300010360|Ga0126372_12652997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 553 | Open in IMG/M |
| 3300010361|Ga0126378_13119997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 527 | Open in IMG/M |
| 3300010364|Ga0134066_10016654 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1575 | Open in IMG/M |
| 3300010366|Ga0126379_12551356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 609 | Open in IMG/M |
| 3300010366|Ga0126379_13669062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
| 3300010373|Ga0134128_10523010 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1322 | Open in IMG/M |
| 3300010376|Ga0126381_101658698 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 924 | Open in IMG/M |
| 3300010398|Ga0126383_10784748 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1035 | Open in IMG/M |
| 3300012198|Ga0137364_10187772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1510 | Open in IMG/M |
| 3300012199|Ga0137383_10087499 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2255 | Open in IMG/M |
| 3300012204|Ga0137374_11295783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 503 | Open in IMG/M |
| 3300012208|Ga0137376_10329371 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1326 | Open in IMG/M |
| 3300012208|Ga0137376_11240500 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012208|Ga0137376_11793299 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 504 | Open in IMG/M |
| 3300012285|Ga0137370_10386280 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 846 | Open in IMG/M |
| 3300012349|Ga0137387_10280433 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1204 | Open in IMG/M |
| 3300012350|Ga0137372_10615289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 795 | Open in IMG/M |
| 3300012362|Ga0137361_10861849 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 823 | Open in IMG/M |
| 3300012582|Ga0137358_10129552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1715 | Open in IMG/M |
| 3300012910|Ga0157308_10213373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 659 | Open in IMG/M |
| 3300012917|Ga0137395_10095090 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
| 3300012925|Ga0137419_10665417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 842 | Open in IMG/M |
| 3300012957|Ga0164303_11378019 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300012985|Ga0164308_10402662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1120 | Open in IMG/M |
| 3300012987|Ga0164307_11260629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 616 | Open in IMG/M |
| 3300012987|Ga0164307_11678037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 538 | Open in IMG/M |
| 3300013102|Ga0157371_11438264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
| 3300013296|Ga0157374_10609842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1102 | Open in IMG/M |
| 3300013297|Ga0157378_11315180 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300014166|Ga0134079_10230195 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 792 | Open in IMG/M |
| 3300014969|Ga0157376_10067458 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3026 | Open in IMG/M |
| 3300015077|Ga0173483_10468991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 664 | Open in IMG/M |
| 3300015356|Ga0134073_10280976 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 587 | Open in IMG/M |
| 3300015371|Ga0132258_11321263 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1822 | Open in IMG/M |
| 3300015372|Ga0132256_100147297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2357 | Open in IMG/M |
| 3300015372|Ga0132256_100322966 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1632 | Open in IMG/M |
| 3300015372|Ga0132256_100806525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1055 | Open in IMG/M |
| 3300015372|Ga0132256_101758736 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 728 | Open in IMG/M |
| 3300015372|Ga0132256_102393246 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 631 | Open in IMG/M |
| 3300015372|Ga0132256_102419967 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 627 | Open in IMG/M |
| 3300015373|Ga0132257_102489688 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300015374|Ga0132255_100647072 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1566 | Open in IMG/M |
| 3300015374|Ga0132255_101266206 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1112 | Open in IMG/M |
| 3300015374|Ga0132255_105732380 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 525 | Open in IMG/M |
| 3300016319|Ga0182033_10928004 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 772 | Open in IMG/M |
| 3300016341|Ga0182035_10785699 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 834 | Open in IMG/M |
| 3300016357|Ga0182032_10760987 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 816 | Open in IMG/M |
| 3300016404|Ga0182037_11306812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 639 | Open in IMG/M |
| 3300017930|Ga0187825_10316342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 584 | Open in IMG/M |
| 3300018027|Ga0184605_10146978 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1059 | Open in IMG/M |
| 3300018028|Ga0184608_10254181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 773 | Open in IMG/M |
| 3300018071|Ga0184618_10179035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 879 | Open in IMG/M |
| 3300018072|Ga0184635_10169011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 873 | Open in IMG/M |
| 3300018081|Ga0184625_10125071 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1338 | Open in IMG/M |
| 3300018468|Ga0066662_11342708 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300019866|Ga0193756_1029289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 776 | Open in IMG/M |
| 3300019869|Ga0193705_1057068 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 795 | Open in IMG/M |
| 3300019878|Ga0193715_1113024 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 532 | Open in IMG/M |
| 3300019881|Ga0193707_1074257 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300019890|Ga0193728_1023821 | All Organisms → cellular organisms → Bacteria | 3057 | Open in IMG/M |
| 3300020000|Ga0193692_1119058 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 536 | Open in IMG/M |
| 3300020002|Ga0193730_1021319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1870 | Open in IMG/M |
| 3300020006|Ga0193735_1106022 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 778 | Open in IMG/M |
| 3300020170|Ga0179594_10308312 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300021080|Ga0210382_10132023 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1061 | Open in IMG/M |
| 3300021168|Ga0210406_11194327 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 554 | Open in IMG/M |
| 3300021560|Ga0126371_12146295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 673 | Open in IMG/M |
| 3300022756|Ga0222622_11134254 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 575 | Open in IMG/M |
| 3300023058|Ga0193714_1003427 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300025901|Ga0207688_10547256 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 727 | Open in IMG/M |
| 3300025903|Ga0207680_11364548 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300025905|Ga0207685_10589396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 595 | Open in IMG/M |
| 3300025909|Ga0207705_10327074 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1178 | Open in IMG/M |
| 3300025922|Ga0207646_10195081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1829 | Open in IMG/M |
| 3300025925|Ga0207650_10470784 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1047 | Open in IMG/M |
| 3300025929|Ga0207664_10681089 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 925 | Open in IMG/M |
| 3300025934|Ga0207686_10421986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1020 | Open in IMG/M |
| 3300025986|Ga0207658_11320610 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 659 | Open in IMG/M |
| 3300026023|Ga0207677_11232675 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 685 | Open in IMG/M |
| 3300026088|Ga0207641_11305278 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 726 | Open in IMG/M |
| 3300026317|Ga0209154_1018536 | All Organisms → cellular organisms → Bacteria | 3286 | Open in IMG/M |
| 3300026331|Ga0209267_1102325 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1218 | Open in IMG/M |
| 3300026335|Ga0209804_1293703 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 557 | Open in IMG/M |
| 3300026342|Ga0209057_1159210 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 688 | Open in IMG/M |
| 3300026537|Ga0209157_1203526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 833 | Open in IMG/M |
| 3300026538|Ga0209056_10028651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5290 | Open in IMG/M |
| 3300026542|Ga0209805_1198223 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300026548|Ga0209161_10576201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 503 | Open in IMG/M |
| 3300026550|Ga0209474_10325297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 883 | Open in IMG/M |
| 3300027326|Ga0209731_1052827 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 617 | Open in IMG/M |
| 3300027903|Ga0209488_10299396 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300028716|Ga0307311_10277326 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 502 | Open in IMG/M |
| 3300028799|Ga0307284_10138648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 932 | Open in IMG/M |
| 3300028799|Ga0307284_10497512 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 500 | Open in IMG/M |
| 3300028819|Ga0307296_10608398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 598 | Open in IMG/M |
| 3300028878|Ga0307278_10343163 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 658 | Open in IMG/M |
| 3300028881|Ga0307277_10034337 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2031 | Open in IMG/M |
| 3300028884|Ga0307308_10314622 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300030916|Ga0075386_12202339 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 584 | Open in IMG/M |
| 3300031128|Ga0170823_14023381 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300031226|Ga0307497_10620778 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 549 | Open in IMG/M |
| 3300031469|Ga0170819_17345482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 521 | Open in IMG/M |
| 3300031720|Ga0307469_12316157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 524 | Open in IMG/M |
| 3300031740|Ga0307468_100207700 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1332 | Open in IMG/M |
| 3300031740|Ga0307468_102318821 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 522 | Open in IMG/M |
| 3300031797|Ga0318550_10331628 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 738 | Open in IMG/M |
| 3300031858|Ga0310892_11252259 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
| 3300031910|Ga0306923_11788325 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 632 | Open in IMG/M |
| 3300031910|Ga0306923_12098025 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
| 3300031942|Ga0310916_11262034 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 609 | Open in IMG/M |
| 3300031946|Ga0310910_11094774 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 620 | Open in IMG/M |
| 3300034125|Ga0370484_0073296 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.65% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 3.39% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.13% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.13% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0474.00004720 | 2166559005 | Simulated | LLSKSAAESNAGVLGQEYLSSNFAVVDVGGRALYLRRPDSR |
| E1_07616000 | 2170459002 | Grass Soil | LLSKSVTESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| E41_05475450 | 2170459005 | Grass Soil | HVSGDVLLSKSVAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| L01_01896710 | 2170459006 | Grass Soil | NAEVAVAHVSGVILLSKSAAESNAGVLGQEYLSSNFAVVDVGGRALYLRRPDSR |
| L02_03501200 | 2170459007 | Grass Soil | VAHVSGDILLSKSAAESNAGVLGQEYLSSNFAVVDVGGRALYLRRPDSR |
| F62_03227900 | 2170459010 | Grass Soil | AHVSGDILLSKSVAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| F64_05900020 | 2170459011 | Grass Soil | VAVAHVSGDILLSKSAAESNAGVLGQEYLSSNFAVVDVGGRALYLRRPDSR |
| FG2_07657230 | 2189573004 | Grass Soil | SKSAAESNAGVLGQDYLATNFAVIDMGGKVLYLRRPDSR |
| AF_2010_repII_A01DRAFT_10039783 | 3300000580 | Forest Soil | SKSTAESNAGVLGQDYLATNFAVIDMGGKALYLRHPDSR* |
| JGI11643J12802_115946362 | 3300000890 | Soil | VAHVSRDILLSKSTAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| JGI1027J12803_1016747685 | 3300000955 | Soil | ILLSKSTAESNAGVLGQDYLSTNFAVIDVGGRALYLRRPDSR* |
| JGI1027J12803_1076706454 | 3300000955 | Soil | AEVVVAHVSGDILLSKSSEESNAGVLGQEYLASNFAVIDMGSMALYLRHPDSR* |
| Ga0062590_1001772753 | 3300004157 | Soil | VAHVSGDILLSKSAAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0062595_1005564142 | 3300004479 | Soil | AEVVVAHVSKDILLSNSSAESNAGVLGQEYLSSNFAVIDVGGMALYLRHPDSR* |
| Ga0062592_1001797501 | 3300004480 | Soil | AEVAVAHVSGDILLSKSAAESNAGVLGQDYLATNFAVIDMGGKTLYLRHPDSR* |
| Ga0066683_104882262 | 3300005172 | Soil | SGDILLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR* |
| Ga0066676_102705072 | 3300005186 | Soil | HLSGDILLSKSAAESNAGVLGQEYLSSHFAILDMGGMALYLRHSDSR* |
| Ga0066675_109810342 | 3300005187 | Soil | DILLSKSASESNAGVLGQEYLSSNFAVLDMGGLALYLRHPDSAR* |
| Ga0065714_100821553 | 3300005288 | Miscanthus Rhizosphere | EVVLAHVSGDILLSKSTAESNAGVLGQDYLASNFAVIDMGGKALFLRHPDSR* |
| Ga0065704_104036391 | 3300005289 | Switchgrass Rhizosphere | DILLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0065715_103933391 | 3300005293 | Miscanthus Rhizosphere | HVSGDILLSKSSGESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0070666_112665761 | 3300005335 | Switchgrass Rhizosphere | NAEVAVAHVSGEVLLSKSTAESNAGVLGQEYLSSNFAVLDVGGRALYLRHPDSR* |
| Ga0070709_117082242 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLSKSTAESNAGVLGQEYLSSNFAVLDVGGRALYLRHPDSR* |
| Ga0070713_1003855191 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | HVSGDVLLSKSVAESNAGVLGQDYMATNFAVIDMGGKSLYLRRPDSR* |
| Ga0066689_102847901 | 3300005447 | Soil | VLLSNSAAESNAGVLGQEYLASNFAVIDMGGMALYLMHPDAR* |
| Ga0066697_105593431 | 3300005540 | Soil | LLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0070665_1023516072 | 3300005548 | Switchgrass Rhizosphere | ESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0066707_106537141 | 3300005556 | Soil | EVVVAHLSGDILLSKSAAESNAGVLGQEYLSSHFAILDMGGMALYLRHPDSR* |
| Ga0066699_100108781 | 3300005561 | Soil | VAHVSGEVLLSKSATESNAGVLGQDYLSTNFAVMDMGGRALYLRRPDSR* |
| Ga0066703_104189231 | 3300005568 | Soil | SKSATESNAGVLGQDYLSTNFAVMDMGGRALYLRRPDSR* |
| Ga0066694_102917151 | 3300005574 | Soil | SGDILLSKSAAESNAGVLGQEYLSSNFAAIDMGGMALYLRHPDSR* |
| Ga0066706_106225302 | 3300005598 | Soil | LSKSATESNAGVLGQDYLSTNFAVIDVGGKALYLRRPDSR* |
| Ga0066903_1029546202 | 3300005764 | Tropical Forest Soil | VSGDVLLSKSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0066903_1030617972 | 3300005764 | Tropical Forest Soil | ESNAGVLGQDYLSTNFAIIDMGGKALYLRHPDSR* |
| Ga0068863_1013331302 | 3300005841 | Switchgrass Rhizosphere | DILLSKSTAESNAGVLGQDYLASNFAVIDMGGKALFLRHPDSR* |
| Ga0066656_102451341 | 3300006034 | Soil | ILLSKSAAESNAGVLGQEYLSSNFAAIDMGGMALYLRHPDSR* |
| Ga0070712_1002784481 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKSAAESNAGVLGQDYLATNFAVIDMGGKTLYLRHPDSP* |
| Ga0070712_1016839942 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ESNAGVLGQDYLATNFAIIDMGGKALYLRHPDSR* |
| Ga0066658_109069592 | 3300006794 | Soil | VLLSKSTTESNAGVLGQDYLSTNFAVIDTAGKALYLRHPDSR* |
| Ga0066665_100525754 | 3300006796 | Soil | AHLSGDILLSKSAAESNAGVLGQEYLSSHFAILDMGGMALYLRHPDSR* |
| Ga0066665_114207481 | 3300006796 | Soil | LSKSAAESNAGVLGQEYLSSHFAILDMGGMALYLRHADSR* |
| Ga0066659_101796021 | 3300006797 | Soil | KSAAESNAGVLGQEYLSSHFAILDMGGMALYLRHPDSR* |
| Ga0068865_1005467982 | 3300006881 | Miscanthus Rhizosphere | VVAHVSGDILLSKTTAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0075424_1028422961 | 3300006904 | Populus Rhizosphere | KSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0099829_104322692 | 3300009038 | Vadose Zone Soil | SATESNAGVLGQDYLSTNFAVIDMGGKALYLRRPDSR* |
| Ga0114129_117290403 | 3300009147 | Populus Rhizosphere | LLSKSAAESNAGVLGQDYLSINFAVIDMGGRALYLRRPDSR* |
| Ga0105242_127354722 | 3300009176 | Miscanthus Rhizosphere | EVVVAHVSADILLSKSAAESNAGVLGEDYLSTNFAVIDMSDRALYLRHPDSR* |
| Ga0105248_109532142 | 3300009177 | Switchgrass Rhizosphere | AHVSGDILLSKSTAESNAGVLGQDYLASNFAVIDMGGKALFLRHPDSR* |
| Ga0105237_126010501 | 3300009545 | Corn Rhizosphere | VSRDILLSKSTAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0126374_112463321 | 3300009792 | Tropical Forest Soil | TESNAGVLGQEYLSSNFAVIDMGGRALYLRHPDSR* |
| Ga0126374_114873681 | 3300009792 | Tropical Forest Soil | GDILLSKSVAESNAGVLGQDYLSTNFGVIDIGGRALYLRRPDSR* |
| Ga0126384_101545973 | 3300010046 | Tropical Forest Soil | LSKSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0126384_105400421 | 3300010046 | Tropical Forest Soil | VVVAHVSGDILLLKSAAESNAGVLGQDYLATNFAIIDMGGKALYLRRPDSR* |
| Ga0126382_102365331 | 3300010047 | Tropical Forest Soil | SGDILLSKSAAESNAGVLGQDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0126382_108701621 | 3300010047 | Tropical Forest Soil | KSAAESNAGVLGQDYLSTNFAVIDIGGRALYLRRPDSR* |
| Ga0126382_111053262 | 3300010047 | Tropical Forest Soil | LSKSAAESNAGVLGQEYLSSNFAVIDMGGRALYLRHPDSR* |
| Ga0134070_103956551 | 3300010301 | Grasslands Soil | LLSKSAAESNAGVLGQEYLSSHFAILDMGGMALYLRHSDSR* |
| Ga0134088_100078851 | 3300010304 | Grasslands Soil | ESNAGVLGQEYLSSHFAILDMGGMALYLRHPDSR* |
| Ga0134088_104968011 | 3300010304 | Grasslands Soil | IAHLSGDILLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR* |
| Ga0134065_103305391 | 3300010326 | Grasslands Soil | NSAAESNAGVLGQEYLASNFAVIDMGGMALYLRHPDSR* |
| Ga0134111_103715171 | 3300010329 | Grasslands Soil | EVVVAHVSGDILLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0134111_103907051 | 3300010329 | Grasslands Soil | SKDVLLSNSAAESNAGVLGQEYLASNFAVIDMGGMGLYLRHPDSR* |
| Ga0134080_105939501 | 3300010333 | Grasslands Soil | LSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0126376_129214182 | 3300010359 | Tropical Forest Soil | AAESNAGVLGQDYLATNFAVIDMGGRAMYLRHPDSR* |
| Ga0126372_122473091 | 3300010360 | Tropical Forest Soil | AESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0126372_126529972 | 3300010360 | Tropical Forest Soil | HVSGDVLLSKSAAESNAGVLGQDYLATNFAIIDMGGKTLYLRRPDSR* |
| Ga0126378_131199972 | 3300010361 | Tropical Forest Soil | SKSEGESNAGVLGQDYLSTNFAVIDMGGKALYLRRPDSR* |
| Ga0134066_100166543 | 3300010364 | Grasslands Soil | VVVAHISGDILLSKSAAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0126379_125513561 | 3300010366 | Tropical Forest Soil | SAAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0126379_136690621 | 3300010366 | Tropical Forest Soil | DVAVAHVSGDILLSNSAADSNAGVLGEEYLSSNFAVLDIGGKALYMRHPDSR* |
| Ga0134128_105230102 | 3300010373 | Terrestrial Soil | ILLSKTTAESNAGVLGQDYLTTNFAVIDMGGKALYLRRPDSR* |
| Ga0126381_1016586981 | 3300010376 | Tropical Forest Soil | KSATESNAGVLGQDYLATNFAVIDMGGKALYLRHPDSR* |
| Ga0126383_107847481 | 3300010398 | Tropical Forest Soil | AEVVVAHVSGDVLLSKSGTESNAGVLGQDYLSSNFAVIDVSGRTLYLRHPDSR* |
| Ga0137364_101877723 | 3300012198 | Vadose Zone Soil | VVAHVSKDVLLSNSAAESNAGVLGQEYLASNFAVIDMGGMALYLRHPDSR* |
| Ga0137383_100874994 | 3300012199 | Vadose Zone Soil | HLSGDIRLSKSAAESNAGVLGEEYLSSNFAIIDMGSLALYLRHPDSR* |
| Ga0137374_112957832 | 3300012204 | Vadose Zone Soil | ESNAGVLGQEYLSSNFAIVDVGGRALYLRHPEFR* |
| Ga0137376_103293711 | 3300012208 | Vadose Zone Soil | AHVSGDILLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0137376_112405002 | 3300012208 | Vadose Zone Soil | AHVSGDVLLSKSATESNAGVLGQDYLSTNFAVIDVGGKALYLRRPDSR* |
| Ga0137376_117932992 | 3300012208 | Vadose Zone Soil | SKSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0137370_103862801 | 3300012285 | Vadose Zone Soil | THVSGDILLSKSAAESNAGVLGQEYLSSNFAVVDVGGRALYLRHPDSR* |
| Ga0137387_102804331 | 3300012349 | Vadose Zone Soil | LSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR* |
| Ga0137372_106152891 | 3300012350 | Vadose Zone Soil | ILLSKSAAESNAGVLGQDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0137361_108618491 | 3300012362 | Vadose Zone Soil | KSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR* |
| Ga0137358_101295523 | 3300012582 | Vadose Zone Soil | LLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR* |
| Ga0157308_102133731 | 3300012910 | Soil | AHVSGDILLSKTTAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0137395_100950902 | 3300012917 | Vadose Zone Soil | SKSATESNAGVLGQDYLSTNFAVMDMGGRALYLLRPDSR* |
| Ga0137419_106654171 | 3300012925 | Vadose Zone Soil | ILLSKSAAESNAGVLGQEYLSSNFAVVDVGGRALYLRRPDSR* |
| Ga0164303_113780191 | 3300012957 | Soil | SKSAAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0164308_104026621 | 3300012985 | Soil | VVVAHVSGDILLSKSSGESNAGVLGQDYLATNFAVIDMGGKTLYLRSPDSR* |
| Ga0164307_112606292 | 3300012987 | Soil | VLLSKSVAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0164307_116780372 | 3300012987 | Soil | LSKSAPESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0157371_114382642 | 3300013102 | Corn Rhizosphere | SKTTAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0157374_106098421 | 3300013296 | Miscanthus Rhizosphere | TAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0157378_113151802 | 3300013297 | Miscanthus Rhizosphere | VAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0134079_102301951 | 3300014166 | Grasslands Soil | AHVSKDILLSNSAAESNAGVLGEEYLSSNFAVIDVGGMALYLRHPDSR* |
| Ga0157376_100674584 | 3300014969 | Miscanthus Rhizosphere | DILLSKSAAESNAGVLGQDYLATNFAVIDMGGKTLYLRHPDSR* |
| Ga0173483_104689911 | 3300015077 | Soil | SGDILLSKSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0134073_102809761 | 3300015356 | Grasslands Soil | AHLSGDILLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR* |
| Ga0132258_113212633 | 3300015371 | Arabidopsis Rhizosphere | VAHVSGDILLSKSSAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0132256_1001472973 | 3300015372 | Arabidopsis Rhizosphere | VSGDILLSKSATESNAGVLGQDYLATNFAVIDTGGKALYLRHPDSR* |
| Ga0132256_1003229661 | 3300015372 | Arabidopsis Rhizosphere | VVVAHVSGDILLSKSATESNAGVLGQDYLATNFAVIDMGGKALYLRHPDSR* |
| Ga0132256_1008065251 | 3300015372 | Arabidopsis Rhizosphere | KSAVESNAGVLGQDYLATNFAVVDMGGKALYLRRPDSR* |
| Ga0132256_1017587361 | 3300015372 | Arabidopsis Rhizosphere | ILLSKSAAESNAGVLGEDYLATNFAVIDMGGRAIYLRRPDSR* |
| Ga0132256_1023932462 | 3300015372 | Arabidopsis Rhizosphere | EVVVAHVSGDILLSKSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0132256_1024199672 | 3300015372 | Arabidopsis Rhizosphere | VVAHVSGDILLSKSAAETNAGVLGQDYLATNFAVIDMGGKVLYLRRPDSR* |
| Ga0132257_1024896881 | 3300015373 | Arabidopsis Rhizosphere | SAAETNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR* |
| Ga0132255_1006470723 | 3300015374 | Arabidopsis Rhizosphere | VVAHVSGDILLSKSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR* |
| Ga0132255_1012662061 | 3300015374 | Arabidopsis Rhizosphere | KSTAESNAGVLGQDYLATNFAIIDMGGKTLYLRHPDSR* |
| Ga0132255_1057323802 | 3300015374 | Arabidopsis Rhizosphere | ESNAGVLGEDYLSTNFAVIDMGARALYLRRPDSR* |
| Ga0182033_109280041 | 3300016319 | Soil | LLSKSTTESNAGVLGQDYLATNFAVIDMGGKALYLRHPDSR |
| Ga0182035_107856992 | 3300016341 | Soil | VAHVSGDVLLSKSAAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0182032_107609871 | 3300016357 | Soil | SGDVLLSKSAAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR |
| Ga0182037_113068122 | 3300016404 | Soil | LLSKSAAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0187825_103163422 | 3300017930 | Freshwater Sediment | VAHVSGNILLSNSTAESNAGVLGQEYLSSNFGVIDVGGMALYLRHPDTR |
| Ga0184605_101469781 | 3300018027 | Groundwater Sediment | ILLSKSAAESNAGVLGQEYLSSNFAIIDMGGMALYLRQPDSR |
| Ga0184608_102541811 | 3300018028 | Groundwater Sediment | ILLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| Ga0184618_101790351 | 3300018071 | Groundwater Sediment | KSAAESNAGVLGQEYLSSNFAIIDMGGMALYLRHPDSR |
| Ga0184635_101690112 | 3300018072 | Groundwater Sediment | LSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| Ga0184625_101250712 | 3300018081 | Groundwater Sediment | SAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| Ga0066662_113427082 | 3300018468 | Grasslands Soil | AEVVVAHVSGEVLLSKSATESNAGVLGQDYLSANFAVIDMGGKALYLRRPESP |
| Ga0193756_10292892 | 3300019866 | Soil | SKSAAESNAGVLGQEYLSSNFAIIDMGGMALYLRHPDSR |
| Ga0193705_10570681 | 3300019869 | Soil | HVSGDILLSKSEAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| Ga0193715_11130241 | 3300019878 | Soil | DVLLSNSVAESNAGVLGQEYLASNFAVIDMGGMALYLRHPDSR |
| Ga0193707_10742571 | 3300019881 | Soil | ARVSSDILLSKSAAESNAGVLGEDYLSTNFAVIDMGGKALYLRRPDSR |
| Ga0193728_10238216 | 3300019890 | Soil | AESNAGVLGEEYLSSNFAIIDMGSLALYLRHPDSR |
| Ga0193692_11190582 | 3300020000 | Soil | SAAESNAGVLGEDYLSTNFAVIDMSDRALYLRHPDSR |
| Ga0193730_10213195 | 3300020002 | Soil | GDIRLSKSAAESNAGVLGEEYLSSNFAIIDMGSLALYLRHPDSR |
| Ga0193735_11060221 | 3300020006 | Soil | EESNSGLIGTEYLASNFAVIDIGGMALYLRHPDSR |
| Ga0179594_103083121 | 3300020170 | Vadose Zone Soil | KVATLFAGVLGQDYLSTNFAVIDMGGKALYLRRPNSR |
| Ga0210382_101320232 | 3300021080 | Groundwater Sediment | LLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| Ga0210406_111943272 | 3300021168 | Soil | SKSAAESNAGVLGQEYLSSNFAVVDVGGRALYLRRADSR |
| Ga0126371_121462952 | 3300021560 | Tropical Forest Soil | VLLSKSKEESNAGVLGQDYLATNFAVIDMGGKALYLRHPDSR |
| Ga0222622_111342542 | 3300022756 | Groundwater Sediment | LLSKSAAESNAGVLGEDYLSTNFAVIDMGGKALYLRRPDSR |
| Ga0193714_10034274 | 3300023058 | Soil | VVVAHVSGDILLSKSVAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207688_105472562 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | HVSGDILLSKSSGESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207680_113645481 | 3300025903 | Switchgrass Rhizosphere | SSGESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207685_105893961 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAESNAGVLGQEYLSSNFAVVDVGGRALYLRRADSR |
| Ga0207705_103270742 | 3300025909 | Corn Rhizosphere | TSSGESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207646_101950811 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGDILLSKSAAESNAGVLGQEYLSSNFAVVDIGGRALYLRRPDSR |
| Ga0207650_104707841 | 3300025925 | Switchgrass Rhizosphere | AESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207664_106810892 | 3300025929 | Agricultural Soil | LSKSAPESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207686_104219861 | 3300025934 | Miscanthus Rhizosphere | AAESNAGVLGEDYLSTNFAVIDMSDRALYLRHPDSR |
| Ga0207658_113206102 | 3300025986 | Switchgrass Rhizosphere | VAHVSRDILLSKSTAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207677_112326752 | 3300026023 | Miscanthus Rhizosphere | ILLSKSSGESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0207641_113052781 | 3300026088 | Switchgrass Rhizosphere | GDILLSKSTAESNAGVLGQDYLASNFAVIDMGGKALFLRHPDSR |
| Ga0209154_10185361 | 3300026317 | Soil | HLSGDILLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR |
| Ga0209267_11023253 | 3300026331 | Soil | VSGEVLLSKSKTESNAGVLGQDYLSTNFAVIDTAGKALYLRHPDSR |
| Ga0209804_12937031 | 3300026335 | Soil | AEVVIAHLSGDILLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR |
| Ga0209057_11592102 | 3300026342 | Soil | ILLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR |
| Ga0209157_12035262 | 3300026537 | Soil | SGDILLSKSAAESNAGVLGQEYLSSNFAVIDMGGMALYLRHPDSR |
| Ga0209056_100286511 | 3300026538 | Soil | VAHLSGDILLSKSAAESNAGVLGQEYLSSHFAILDMGGMALYLRHPDSR |
| Ga0209805_11982232 | 3300026542 | Soil | VAHVSGEVLLSKSATESNAGVLGQDYLSTNFAVMDMGGRALYLRRPDSR |
| Ga0209161_105762011 | 3300026548 | Soil | ILLSKSAAESNAGVLGQEYLSSNFAIIDMGGMALYLRHPDSR |
| Ga0209474_103252971 | 3300026550 | Soil | AESNAGVLGQEYLASNFAVIDMGGMALYLRHPDSR |
| Ga0209731_10528271 | 3300027326 | Forest Soil | VVVAHVSGDVLLSKSAEESNAGVLGQDYLSTNFAVIDMGGKALYMRHPDSR |
| Ga0209488_102993963 | 3300027903 | Vadose Zone Soil | VVAHVSRDILLSKSAAESNAGVLGQDCLATNFAVIDMGGKVLYLRRPDSR |
| Ga0307311_102773262 | 3300028716 | Soil | VSGDILLSKSAAESNAGVLGAEYLSSNFAVIDMGGMALYLRHPDIR |
| Ga0307284_101386482 | 3300028799 | Soil | VAHVSGDILLSKSAAESNAGVLGAEYLSSNFAVIDMGGMALYLRHPDIR |
| Ga0307284_104975122 | 3300028799 | Soil | LLNSAAESNAGVLGQEYLSLNFAVIDVGGMALYLRHPDSR |
| Ga0307296_106083982 | 3300028819 | Soil | DILLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| Ga0307278_103431631 | 3300028878 | Soil | AESNAGILGQEYLSSNFAVVDMGGMALYLRHPDSR |
| Ga0307277_100343371 | 3300028881 | Soil | ILLSKSASESNAGVLGQEYLSSNFAVLDMGGLALYLRHPDSAG |
| Ga0307308_103146223 | 3300028884 | Soil | SKSAVESNAGVLGEEYLSSNLAIIDMGSLALYLRHPDSR |
| Ga0075386_122023392 | 3300030916 | Soil | GDILLSKSAAESNAGVLGQDYLATNFAVIDIGGKALYLRRPDSR |
| Ga0170823_140233811 | 3300031128 | Forest Soil | EVVVAHVSGDILLSKSTAESNAGVLGQDYLATNFAVIDMGGKALYLRRPDSR |
| Ga0307497_106207781 | 3300031226 | Soil | SGDILLSKSAAESNAGVLGEDYLATNFAVIDMGGRAIYLRRPDSR |
| Ga0170819_173454822 | 3300031469 | Forest Soil | LSKSAAESNAGVLGEDYLSTNFAVIDMSGRALYLRRPDSR |
| Ga0307469_123161572 | 3300031720 | Hardwood Forest Soil | EESNSGLFGAEYLAWNFAVIDVGGMALYLRHPDSR |
| Ga0307468_1002077002 | 3300031740 | Hardwood Forest Soil | AHVSRDILLSKSAAESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| Ga0307468_1023188211 | 3300031740 | Hardwood Forest Soil | AAESNAGVLGQDYLATNFAVIDMGGRALYLRRPDSR |
| Ga0318550_103316281 | 3300031797 | Soil | GAESNAGVLGQDYLATNFAIIDMGGKALYLRRPDSR |
| Ga0310892_112522591 | 3300031858 | Soil | EVAVAHVSGDILLSKSTSESNAGVLGQDYLATNFAVIDMGGKTLYLRHPDSR |
| Ga0306923_117883251 | 3300031910 | Soil | QSAAESNAGVLGQDYLSTNFAVIDMGGRALYLRHPDSR |
| Ga0306923_120980252 | 3300031910 | Soil | VLLSKSGAESNAGVLGQDYLATNFAIIDMGGKALYLRRPDSR |
| Ga0310916_112620341 | 3300031942 | Soil | EAESNAGVLGQDYLATNFAIIDMGGKALYLRRPDSR |
| Ga0310910_110947741 | 3300031946 | Soil | SAAESNAGVLGQDYLSTNFAVIDMGGRALYLRHPDSR |
| Ga0370484_0073296_713_871 | 3300034125 | Untreated Peat Soil | EVVVAHVSADILLSKSAEESNAGVLGEDYLSTNFAVIDMGGRALYLRRPDSR |
| ⦗Top⦘ |