Basic Information | |
---|---|
Family ID | F033542 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 177 |
Average Sequence Length | 43 residues |
Representative Sequence | NPDLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 177 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.56 % |
% of genes near scaffold ends (potentially truncated) | 99.44 % |
% of genes from short scaffolds (< 2000 bps) | 92.09 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.915 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.684 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.508 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.802 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.94% β-sheet: 13.89% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 177 Family Scaffolds |
---|---|---|
PF01571 | GCV_T | 12.43 |
PF07690 | MFS_1 | 2.26 |
PF08669 | GCV_T_C | 1.69 |
PF07786 | HGSNAT_cat | 1.69 |
PF12704 | MacB_PCD | 0.56 |
PF02518 | HATPase_c | 0.56 |
PF02055 | Glyco_hydro_30 | 0.56 |
PF01042 | Ribonuc_L-PSP | 0.56 |
PF07676 | PD40 | 0.56 |
PF00510 | COX3 | 0.56 |
PF01757 | Acyl_transf_3 | 0.56 |
PF13442 | Cytochrome_CBB3 | 0.56 |
PF13432 | TPR_16 | 0.56 |
PF10431 | ClpB_D2-small | 0.56 |
PF02347 | GDC-P | 0.56 |
PF01597 | GCV_H | 0.56 |
PF07995 | GSDH | 0.56 |
COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
---|---|---|---|
COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 1.69 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.56 |
COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.56 |
COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.56 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.56 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.56 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.56 |
COG5520 | O-Glycosyl hydrolase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.92 % |
Unclassified | root | N/A | 5.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_11240565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300001593|JGI12635J15846_10316302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100076925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3091 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100575968 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300002560|JGI25383J37093_10134011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300002908|JGI25382J43887_10333767 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300002914|JGI25617J43924_10037022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1755 | Open in IMG/M |
3300002917|JGI25616J43925_10081739 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300003352|JGI26345J50200_1015195 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300004082|Ga0062384_100097507 | Not Available | 1565 | Open in IMG/M |
3300004092|Ga0062389_103536185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300004268|Ga0066398_10225521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300005167|Ga0066672_10061056 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
3300005172|Ga0066683_10221965 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300005179|Ga0066684_10077576 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
3300005187|Ga0066675_10789271 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005447|Ga0066689_10658697 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300005529|Ga0070741_11296693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300005531|Ga0070738_10299859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300005536|Ga0070697_100282811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1424 | Open in IMG/M |
3300005537|Ga0070730_10940407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300005553|Ga0066695_10046879 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
3300005557|Ga0066704_10165538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
3300005610|Ga0070763_10055416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1898 | Open in IMG/M |
3300005617|Ga0068859_103004780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300005842|Ga0068858_100318697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1485 | Open in IMG/M |
3300006034|Ga0066656_11000631 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300006050|Ga0075028_100256032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
3300006162|Ga0075030_100163587 | Not Available | 1797 | Open in IMG/M |
3300006175|Ga0070712_100785097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300006797|Ga0066659_11228455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300006904|Ga0075424_100147429 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
3300007258|Ga0099793_10455817 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300009038|Ga0099829_10581702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
3300009038|Ga0099829_10720201 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300009038|Ga0099829_10994330 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300009038|Ga0099829_11047711 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300009088|Ga0099830_10079201 | All Organisms → cellular organisms → Bacteria | 2404 | Open in IMG/M |
3300009088|Ga0099830_10130789 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
3300009088|Ga0099830_11297799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300009088|Ga0099830_11647360 | Not Available | 535 | Open in IMG/M |
3300009089|Ga0099828_11190432 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300009089|Ga0099828_11623121 | Not Available | 569 | Open in IMG/M |
3300009137|Ga0066709_101226090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
3300009143|Ga0099792_10252235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
3300009698|Ga0116216_10074539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2086 | Open in IMG/M |
3300009698|Ga0116216_10232205 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300009792|Ga0126374_10619228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300010047|Ga0126382_10215998 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300010048|Ga0126373_10170315 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
3300010303|Ga0134082_10202904 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300010320|Ga0134109_10315672 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300010335|Ga0134063_10142202 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300010358|Ga0126370_11136574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
3300010359|Ga0126376_11732775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300010360|Ga0126372_10396124 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300010360|Ga0126372_12540781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300010361|Ga0126378_10991498 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300010361|Ga0126378_11235401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
3300010361|Ga0126378_12917449 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300010375|Ga0105239_11668832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300011120|Ga0150983_15592952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300011120|Ga0150983_15864798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300011270|Ga0137391_10544699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
3300011270|Ga0137391_11480595 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300011270|Ga0137391_11497330 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300011271|Ga0137393_11313286 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300012189|Ga0137388_11476989 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300012189|Ga0137388_11548266 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300012199|Ga0137383_11369936 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300012203|Ga0137399_10139672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1924 | Open in IMG/M |
3300012203|Ga0137399_11468037 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012205|Ga0137362_11028156 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300012206|Ga0137380_10790306 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300012207|Ga0137381_11125214 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300012211|Ga0137377_10668386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
3300012211|Ga0137377_11943327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300012361|Ga0137360_11713374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300012362|Ga0137361_11129610 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300012362|Ga0137361_11647343 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
3300012363|Ga0137390_10649385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1020 | Open in IMG/M |
3300012378|Ga0134025_1123844 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300012922|Ga0137394_11145057 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300012929|Ga0137404_11361946 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300012929|Ga0137404_11670248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300012929|Ga0137404_12105315 | Not Available | 527 | Open in IMG/M |
3300012929|Ga0137404_12225858 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012930|Ga0137407_11505543 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012930|Ga0137407_12103787 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300012948|Ga0126375_10487869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 915 | Open in IMG/M |
3300012971|Ga0126369_13306915 | Not Available | 528 | Open in IMG/M |
3300014150|Ga0134081_10355887 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300014157|Ga0134078_10255917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300014166|Ga0134079_10224977 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300015052|Ga0137411_1109144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
3300015241|Ga0137418_10620900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300015358|Ga0134089_10278284 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300017973|Ga0187780_10194943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
3300017975|Ga0187782_11538875 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300018058|Ga0187766_10000844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17507 | Open in IMG/M |
3300018086|Ga0187769_10469195 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300018468|Ga0066662_11737940 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300018468|Ga0066662_12493450 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300020034|Ga0193753_10140360 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300020140|Ga0179590_1144848 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300020170|Ga0179594_10007501 | All Organisms → cellular organisms → Bacteria | 2894 | Open in IMG/M |
3300020579|Ga0210407_10789622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300020579|Ga0210407_11011951 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300020580|Ga0210403_10435910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1068 | Open in IMG/M |
3300020581|Ga0210399_11342051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300020582|Ga0210395_10638088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300020582|Ga0210395_11014317 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300021171|Ga0210405_10690982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300021171|Ga0210405_10785849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300021401|Ga0210393_10755454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300021401|Ga0210393_11588258 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300021405|Ga0210387_10339094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1327 | Open in IMG/M |
3300021420|Ga0210394_10286000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1445 | Open in IMG/M |
3300021478|Ga0210402_10124203 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
3300021478|Ga0210402_10731437 | Not Available | 913 | Open in IMG/M |
3300021559|Ga0210409_10947458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300021560|Ga0126371_13778269 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300024287|Ga0247690_1003821 | Not Available | 1843 | Open in IMG/M |
3300024330|Ga0137417_1059795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300024331|Ga0247668_1056272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
3300025905|Ga0207685_10237813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
3300025939|Ga0207665_11511966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300026035|Ga0207703_10737295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
3300026277|Ga0209350_1099222 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300026285|Ga0209438_1071288 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300026298|Ga0209236_1159314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
3300026308|Ga0209265_1039767 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300026313|Ga0209761_1279180 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300026314|Ga0209268_1165850 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300026316|Ga0209155_1269485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300026318|Ga0209471_1308169 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300026323|Ga0209472_1202430 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300026333|Ga0209158_1283992 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300026498|Ga0257156_1038145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
3300026532|Ga0209160_1120445 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300026538|Ga0209056_10036847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4538 | Open in IMG/M |
3300026551|Ga0209648_10156668 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
3300026555|Ga0179593_1013473 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300026557|Ga0179587_10293948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300027635|Ga0209625_1049386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
3300027643|Ga0209076_1098320 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300027660|Ga0209736_1088654 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300027671|Ga0209588_1145413 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300027846|Ga0209180_10715900 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027857|Ga0209166_10406500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300027857|Ga0209166_10542238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300027889|Ga0209380_10188613 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300027903|Ga0209488_10067482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2649 | Open in IMG/M |
3300027903|Ga0209488_10353851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
3300028138|Ga0247684_1017299 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300028808|Ga0302228_10202297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
3300031057|Ga0170834_105396460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1690 | Open in IMG/M |
3300031057|Ga0170834_109343354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300031122|Ga0170822_14036616 | Not Available | 754 | Open in IMG/M |
3300031128|Ga0170823_10418856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300031128|Ga0170823_14403513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter lindaniclasticus | 997 | Open in IMG/M |
3300031469|Ga0170819_17605659 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300031715|Ga0307476_10735433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300031715|Ga0307476_11077879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300031718|Ga0307474_11182049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300031754|Ga0307475_10141663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1905 | Open in IMG/M |
3300031770|Ga0318521_10999383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300031798|Ga0318523_10152045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1151 | Open in IMG/M |
3300031879|Ga0306919_10148825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1705 | Open in IMG/M |
3300031880|Ga0318544_10009508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3030 | Open in IMG/M |
3300031910|Ga0306923_10335292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1726 | Open in IMG/M |
3300031962|Ga0307479_10408149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1343 | Open in IMG/M |
3300031962|Ga0307479_11382587 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300032174|Ga0307470_10018470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3084 | Open in IMG/M |
3300032828|Ga0335080_10860975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 932 | Open in IMG/M |
3300033004|Ga0335084_10598055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
3300034178|Ga0364934_0097546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.60% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.34% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.95% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.95% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.39% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.82% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.26% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.13% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.13% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.13% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.56% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_112405651 | 3300000789 | Soil | DLADLLSQAQVNPSGDRVVLRLSLTDDQMTSLIKKNTFALKM* |
JGI12635J15846_103163021 | 3300001593 | Forest Soil | MAQLLDSVRVTPAGDRVVLRMTLTDDQVTSLIRKNTFAFKM* |
JGIcombinedJ26739_1000769251 | 3300002245 | Forest Soil | DLAQLLDQARVTPGGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
JGIcombinedJ26739_1005759683 | 3300002245 | Forest Soil | NPDLAQLLDQARVTPGGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
JGI25383J37093_101340112 | 3300002560 | Grasslands Soil | LAQLIDGTRITPAGDRVELRLSLSDEQMTSLIKRNTFGFKM* |
JGI25382J43887_103337672 | 3300002908 | Grasslands Soil | KENPDLAQLLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFALKM* |
JGI25617J43924_100370221 | 3300002914 | Grasslands Soil | QKDNPDLAQLLDQARVVPAGDRVTIRMSLSDDQMATLIRKNTFALKM* |
JGI25616J43925_100817391 | 3300002917 | Grasslands Soil | AQKDNPDLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIQKNTFALKM* |
JGI26345J50200_10151953 | 3300003352 | Bog Forest Soil | NPDLAQLLDQVHITPAGDRVSMRTSLSDDQMSSLIKHNTFAIKM* |
Ga0062384_1000975071 | 3300004082 | Bog Forest Soil | ALLDQATVTPAGDRVSLRMSLSDAQMTSLIQHNTFALKM* |
Ga0062389_1035361851 | 3300004092 | Bog Forest Soil | DNPDLAQMLDQASVTPAGDRVVLHLSLSDAQMTSLIQHNTFALKM* |
Ga0066398_102255212 | 3300004268 | Tropical Forest Soil | DLLSQAQVNPAGDRVVLRLSLTDDQMTSLIKKNTFALKM* |
Ga0066672_100610563 | 3300005167 | Soil | YQAQKDNPDLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0066683_102219651 | 3300005172 | Soil | KENPELADLLDQARITPAGDRVALSMSLSDEQMTALIRRNTFALKM* |
Ga0066684_100775764 | 3300005179 | Soil | DLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0066675_107892711 | 3300005187 | Soil | PDLAQLLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFALKM* |
Ga0066689_106586971 | 3300005447 | Soil | NPELAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0070741_112966931 | 3300005529 | Surface Soil | MAQLLDQARITPAGDRMTLRMSVSDDQMSSLIQRNTFALKM* |
Ga0070738_102998591 | 3300005531 | Surface Soil | NPEMAQLLDQARITPAGDRMTLRMSVSDDQMSSLIQRNTFALKM* |
Ga0070697_1002828113 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PDMAQLLSQASVTPGGDRVTVRMTLNDDQITSLIRKNTFAFKM* |
Ga0070730_109404071 | 3300005537 | Surface Soil | PDLAALLDQVSITPGGDRVTLRMSLSDDQMTSLIKHNTFAFKM* |
Ga0066695_100468791 | 3300005553 | Soil | ELADLLDQARIVPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0066704_101655383 | 3300005557 | Soil | DLAQLLDQARVTPAGDRVTLRMSLSDDQMASLIRKNTFALKM* |
Ga0070763_100554161 | 3300005610 | Soil | RYQAQKDNPDLAQLLDQVRITPGGDRVTLHMSLSDDQMSSLIKHNTFSFKM* |
Ga0068859_1030047801 | 3300005617 | Switchgrass Rhizosphere | QAQNQDLADLLSQAQVNPSGDRVVLRLTLTDDQMTSLIKKNTFALKM* |
Ga0068858_1003186974 | 3300005842 | Switchgrass Rhizosphere | QNQDLADLLSQAQVSPSGDRVVLRLSLTDDQMTSLIKKNTFALKM* |
Ga0066656_110006311 | 3300006034 | Soil | SQASIIPAGDRVMVRMTLNDDQITALIRKNTFAFKM* |
Ga0075028_1002560321 | 3300006050 | Watersheds | QKDNPDLAALIDQARVTPAGDRLTIRMSLSDDQMTTLIRKNTFALKM* |
Ga0075030_1001635871 | 3300006162 | Watersheds | LLSQARITPSGDRVAISMTISDDQMTSLIQKKTFSLKM* |
Ga0070712_1007850973 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QQNPEMADLLGQAQVNPSGDRVVLRLALTDDQMSSLIKKNTFALKM* |
Ga0066659_112284551 | 3300006797 | Soil | QLLGQAQVTPGGDRVTLQMSLSDDQMAALIKKNTFALKM* |
Ga0075424_1001474295 | 3300006904 | Populus Rhizosphere | QTQNQDLADLLSQAQVSPSGDRVVLRLSLTDDQMTSLIKKNTFALKM* |
Ga0099793_104558171 | 3300007258 | Vadose Zone Soil | YQSQKDNPDLAQLLDQARVVPAGDRVTIRMSLSDDQMATLIRKNTFALKM* |
Ga0099829_105817021 | 3300009038 | Vadose Zone Soil | LDQARVTPAGDRVTLRMSLSDDQMTSLIQKNTFALKM* |
Ga0099829_107202011 | 3300009038 | Vadose Zone Soil | KRYQAQKDNPELAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0099829_109943301 | 3300009038 | Vadose Zone Soil | QKDNPDLAQLLDQARVTPAGDRVTLRMSLSDDQMAALIRKNTFALKM* |
Ga0099829_110477111 | 3300009038 | Vadose Zone Soil | QAQKDNPDLAQLLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFAFKM* |
Ga0099830_100792011 | 3300009088 | Vadose Zone Soil | PDLAQLLDQARVTPAGDRVTLRLSLSDDQMTSLIRKNTFALKM* |
Ga0099830_101307891 | 3300009088 | Vadose Zone Soil | DQARVTPAGDRVTLRMSLSDDQMTSLIQKNTFALKM* |
Ga0099830_112977991 | 3300009088 | Vadose Zone Soil | TKTDNPDLAQLLGQARITPSGDHVIIRMAISEEQMTSLIRNNSFALKM* |
Ga0099830_116473602 | 3300009088 | Vadose Zone Soil | NPDMAQLLSQASITPAGDRVMVRMTLNDEQITALIRKNTFAFKM* |
Ga0099828_111904321 | 3300009089 | Vadose Zone Soil | KDNPDMAQLLSQATITPAGDRVTVRMTLNDDQITSLIRKNTFAFKM* |
Ga0099828_116231211 | 3300009089 | Vadose Zone Soil | LAQLLDRAQIAPAGDRAVLRMSLSDEQMTSLIKRNTFALKL* |
Ga0066709_1012260901 | 3300009137 | Grasslands Soil | QQNQDLSQLLGQAQVTPGGDRVTLRMSLSDDQMAALIKKNTFALKM* |
Ga0099792_102522352 | 3300009143 | Vadose Zone Soil | AQKDNPDLAQLLDQARVTPGGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0116216_100745393 | 3300009698 | Peatlands Soil | IDQARVTPAGDRLTIRMSLSDDQMTTLIRKNTFALKM* |
Ga0116216_102322052 | 3300009698 | Peatlands Soil | LLDQATVAPSGDRLDIRISLTDDQMASLIRRNTFALKM* |
Ga0126374_106192281 | 3300009792 | Tropical Forest Soil | GQNQDLADLLSQAQVNPAGDRVVLRLSLTDDQMTSLIKKNTFALKM* |
Ga0126382_102159981 | 3300010047 | Tropical Forest Soil | NPELADLLDQAKIVPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0126373_101703151 | 3300010048 | Tropical Forest Soil | KDNPDLADLLDQARITPAGDRVTLRMSLSDAQMTALIRKNTFALKM* |
Ga0134082_102029041 | 3300010303 | Grasslands Soil | LAQLLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFALKM* |
Ga0134109_103156721 | 3300010320 | Grasslands Soil | NPDLAQLLDQARVTPAGDRVTLRMSLSNDQMTSLIRKNTFALKM* |
Ga0134063_101422021 | 3300010335 | Grasslands Soil | KRYQAQKDNPELADLLDQARITPAGDRVTLRMSLSDDQMTALIRKNTFALKM* |
Ga0126370_111365741 | 3300010358 | Tropical Forest Soil | QQNADLADLLGQAQVNPSGDRLVLHIALSDDQITTLVKKNTFALKM* |
Ga0126376_117327753 | 3300010359 | Tropical Forest Soil | VQVTPGGDRVTLRMSLSDDQMATLIKKNTFALKM* |
Ga0126372_103961243 | 3300010360 | Tropical Forest Soil | DLLDQARITPAGDRVTLSMSLSDDQMTSLIRKNTFALKM* |
Ga0126372_125407811 | 3300010360 | Tropical Forest Soil | NPDLAQLLGQVQVTPGGDRVTLRMSLSDDQMATLIKKNTFALKM* |
Ga0126378_109914983 | 3300010361 | Tropical Forest Soil | QAQKDNPDLADLLDQARITPAGDRVTLRMSLSDAQMTALIRKNTFALKM* |
Ga0126378_112354014 | 3300010361 | Tropical Forest Soil | LGQAQINPSGDRVVMHISLTDDQMTALIRKNTFALKM* |
Ga0126378_129174491 | 3300010361 | Tropical Forest Soil | AQKENPELADLLDQAKIVPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0105239_116688321 | 3300010375 | Corn Rhizosphere | QDLADLLSQAQVNPSGDRVVLRLTLTDDQMTSLIKKNTFALKM* |
Ga0150983_155929521 | 3300011120 | Forest Soil | LLDQVRITPGGDRVTLHMSLSDDQMSSLIKHNTFSFKM* |
Ga0150983_158647981 | 3300011120 | Forest Soil | DQVRITPGGDRVTLHMSLSDDQMSSLIKHNTFSFKM* |
Ga0137391_105446993 | 3300011270 | Vadose Zone Soil | LLDQARVTPAGDRVTLRMSLSDDQMTSLIQKNTFALKM* |
Ga0137391_114805951 | 3300011270 | Vadose Zone Soil | DNPDLAQLIDQARGTPAGDRVMLRMSLSDEQMTSLIRKNTFAFKM* |
Ga0137391_114973302 | 3300011270 | Vadose Zone Soil | RYQAQKDNPDLAQLLDQARVTPAGDRVTLRMSLTDDQMTSLIRKNTFALKM* |
Ga0137393_113132861 | 3300011271 | Vadose Zone Soil | NPDLAQLLDQARVTPGGDRVTLRVSLSDDQMTSLIRKNTFALKM* |
Ga0137388_114769892 | 3300012189 | Vadose Zone Soil | KRYQAQKDNPDLAQLLDQARVTPAGDRVTLRMSLTDDQMTSLIRKNTFALKM* |
Ga0137388_115482661 | 3300012189 | Vadose Zone Soil | KDNPDLAQLLDQARVTPAGDRVTLRMSLTDDQMTSLIRKNTFALKM* |
Ga0137383_113699362 | 3300012199 | Vadose Zone Soil | LDQARVTPAGDRVTLRMSLSDDQMASLIRKNTFAFKM* |
Ga0137399_101396723 | 3300012203 | Vadose Zone Soil | ADLLGRAQVNPAGDRVVLRLALTDDQITSLIKKNTFALKM* |
Ga0137399_114680371 | 3300012203 | Vadose Zone Soil | PDLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0137362_110281562 | 3300012205 | Vadose Zone Soil | AQLLDQARVTPAGDRVTLRLSLSDDQMTSLIRKNTFALKM* |
Ga0137380_107903062 | 3300012206 | Vadose Zone Soil | YQAQKDNPDLAQLLDQARVTPAGDRVMLRMSLTDDQMTSLIRKNTFALKM* |
Ga0137381_111252141 | 3300012207 | Vadose Zone Soil | LDQARVTPAGDRVMLRMSLSDDQMASLIRKNTFAFKM* |
Ga0137377_106683861 | 3300012211 | Vadose Zone Soil | KQQNQDLSQLLGQAQVTPGGDRVTLRMSLSDDQMAALIKKNTFALKM* |
Ga0137377_119433271 | 3300012211 | Vadose Zone Soil | AQLIDGTRITPAGDRVELRLSLSDEQMTSLIKRNTFGFKM* |
Ga0137360_117133742 | 3300012361 | Vadose Zone Soil | DLADLLGRAQVNPAGDRVVLRLALTDDQITSLIRKNTFALKM* |
Ga0137361_111296101 | 3300012362 | Vadose Zone Soil | KNDNPDMAQLLSQASITPAGDRVMVRMTLNDDQITSLIRKNTFAFKM* |
Ga0137361_116473431 | 3300012362 | Vadose Zone Soil | YQAKQQNPDLADLLSRAQVNPAGDRVVLRLALTDDQITSLIKKNTFALKM* |
Ga0137390_106493851 | 3300012363 | Vadose Zone Soil | LDQARVTPAGDRVTLRMSLTDDQMTSLIRKNTFALKM* |
Ga0134025_11238441 | 3300012378 | Grasslands Soil | QARVTPAGDRVTLRMSLSDDQMASLIRKNTFALKM* |
Ga0137394_111450572 | 3300012922 | Vadose Zone Soil | KNDNPDMAQLLSQASIIPAGDRVMVRMTLNDDQIAALIRKNTFAFKM* |
Ga0137404_113619461 | 3300012929 | Vadose Zone Soil | DNPDMAQLLSQASIIPAGDRVMVRMTLNDEQITALIRKNTFAFKM* |
Ga0137404_116702482 | 3300012929 | Vadose Zone Soil | GQAQVNPSGDRVVLRLALTDDQMTSLIKKNTFALKM* |
Ga0137404_121053151 | 3300012929 | Vadose Zone Soil | QQNAELADLLGQAQVNPAGDRLIVRLALTDDQMAALIKKNTFAFKM* |
Ga0137404_122258581 | 3300012929 | Vadose Zone Soil | KYQAQKDNPDLAALIDQARVTPAGDRLTIRMSLSDDQMATLIRKNTFALKM* |
Ga0137407_115055431 | 3300012930 | Vadose Zone Soil | PDMAQLLSQASIIPAGDRVMVRMTLNDDQITALIRKNTFAFKM* |
Ga0137407_121037871 | 3300012930 | Vadose Zone Soil | IDQARVTPAGDRLTIRMSLSDDQMATLIRKNTFALKM* |
Ga0126375_104878691 | 3300012948 | Tropical Forest Soil | KQQGQGQNQDLADLLGQAQINPSGDRVVLRLSLTDDQMTSLIKKNTFALKM* |
Ga0126369_133069151 | 3300012971 | Tropical Forest Soil | FLGAAQVNPSGDRVVLRLSLTDDQMTGLIKKNTFALKM* |
Ga0134081_103558871 | 3300014150 | Grasslands Soil | YQAQKENPDLADLLDQAKIVPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0134078_102559171 | 3300014157 | Grasslands Soil | NQDLSQLLGQAQVTPGGDRVTLRMSLSDDQMAALIKKNTFALKM* |
Ga0134079_102249771 | 3300014166 | Grasslands Soil | ENPDLADLLDQAKIVPAGDRVTLRMSLSDDQMTSLIRKNTFALKM* |
Ga0137411_11091443 | 3300015052 | Vadose Zone Soil | MAQLLSQASIIPAGDRVMVRMTLNDEQITSLIRKNTFAFKM* |
Ga0137418_106209001 | 3300015241 | Vadose Zone Soil | ARVTPAGDRLTLRMSLSDDQMTSLIQKNTFALKM* |
Ga0134089_102782841 | 3300015358 | Grasslands Soil | KDNPDLAQLLDQAKVTPGGDRVTIRMSLSDDQMATLIRKNTFALKM* |
Ga0187780_101949431 | 3300017973 | Tropical Peatland | QAQKDNPDLAQLLDQARVTPAGDRVTIRMSLSDDQMTSLIQKNTFALKM |
Ga0187782_115388751 | 3300017975 | Tropical Peatland | QKDNPDLAQLLDRATVTPGGDRVTIRLSLSDDQMTSLIQKNTFALKM |
Ga0187766_1000084418 | 3300018058 | Tropical Peatland | VKKYQASRDNPDLAQLLDQTNITPSGDRVVIGLSVTDDQMSSLIRRNTFALKM |
Ga0187769_104691953 | 3300018086 | Tropical Peatland | PDLAQLLDRATVTPGGDRVTIRLSLSDDQMTSLIQKNTFALKM |
Ga0066662_117379401 | 3300018468 | Grasslands Soil | PDLAQLLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFALKM |
Ga0066662_124934503 | 3300018468 | Grasslands Soil | NPDLAQLLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFAFKM |
Ga0193753_101403603 | 3300020034 | Soil | QKDNPDLAALLDQARVTPSGDRVTLGLSLSDDQMTSLIKKNTFALKM |
Ga0179590_11448482 | 3300020140 | Vadose Zone Soil | QAQKDNPDLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Ga0179594_100075013 | 3300020170 | Vadose Zone Soil | NPDLAQLLDQARVTPAGDRVTLRMSLSDDQMASLIRKNTFALKM |
Ga0210407_107896221 | 3300020579 | Soil | LDQVRITPGGDRVTLHMSLSDDQMSSLIKHNTFSFKM |
Ga0210407_110119512 | 3300020579 | Soil | KRYQTQKDNPDLAQLLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFALKM |
Ga0210403_104359101 | 3300020580 | Soil | LAALLDQVRITPGGDRVTLHMSLSDDQMTSLIKHNTFSFKM |
Ga0210399_113420512 | 3300020581 | Soil | GKDNPELAQLLDQARVTPAGDRVILRMTLSDDQMTSLIQHNTFALKN |
Ga0210395_106380881 | 3300020582 | Soil | LDQVRITPGGDRVTLHMSLSDDQMTSLIKHNTFSFKM |
Ga0210395_110143171 | 3300020582 | Soil | AQKDNPDLAQLLDQARVTPAGDRVTLRLSLSDDQMTSLIRKNTFALKM |
Ga0210405_106909821 | 3300021171 | Soil | GKDNPELAQLLDQARVTPTGDRVILRMALSDEQMTSLIQHNTFALKN |
Ga0210405_107858493 | 3300021171 | Soil | AALLDQVRITPGGDRVTLHMSLSDDQMTSLIKHNTFSFKM |
Ga0210393_107554541 | 3300021401 | Soil | LGQATVNPAGDRVVLRLALTDDQMTTLIKKNTFALKM |
Ga0210393_115882581 | 3300021401 | Soil | LDQLSVTPAGDRVVLRMSLSDAQMTSLIQHNTFALKM |
Ga0210387_103390943 | 3300021405 | Soil | ATKDNPELAALLDAANVTPAGDRVTLRLSLSDAQMTSLIQHNTFALKM |
Ga0210394_102860004 | 3300021420 | Soil | ELAQLLDQVRITPGGDRVTLHMSLSDDQMSSLIRHNTFSFKM |
Ga0210402_101242033 | 3300021478 | Soil | LAQLLDQARVTPGGDRVTIRMSLSDDQMATLIRKNTFALKM |
Ga0210402_107314371 | 3300021478 | Soil | DNPDLAQMLDQLQVTPAGDRLMMRLSLNDDQITALIRKNTFAFKM |
Ga0210409_109474582 | 3300021559 | Soil | LLGQARITPAGDRLEIRMDISDEQMTSLIRKNTFAFKM |
Ga0126371_137782691 | 3300021560 | Tropical Forest Soil | PDLAQLLDQARVTPGGDRVTITMSLSDDQMRSLIQKNTFAMKM |
Ga0247690_10038214 | 3300024287 | Soil | AQKDNPDLAELLDQVRITPGGDRVTLRMSLSDDQMTSLIKRNTFAFKM |
Ga0137417_10597951 | 3300024330 | Vadose Zone Soil | RRRIQENPDLAQLLDQARVTPAGDRLTLRMSLSDDQMTSLIQKNTFALKM |
Ga0247668_10562721 | 3300024331 | Soil | QAQVNPSGDRVVLRLSLTDDQMTSLIKKNTFALKM |
Ga0207685_102378131 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GQAQVNPSGDRVVLRLALTDDQMSSLIKKNTFALKM |
Ga0207665_115119662 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YQAKQQNQDLSQLLGQAQVTPGGDRVTLRMSLSDDQMAALIKKNTFALKM |
Ga0207703_107372951 | 3300026035 | Switchgrass Rhizosphere | AKQQGQTQNQDLADLLSQAQVSPSGDRVVLRLSLTDDQMTSLIKKNTFALKM |
Ga0209350_10992221 | 3300026277 | Grasslands Soil | YQAQKDNPDLAQLLDQARVTPAGDRVTLRMSLSNDQMTSLIRKNTFALKM |
Ga0209438_10712881 | 3300026285 | Grasslands Soil | QAQKENPDLAQLLDQARVTPAGDRLTLRMSLSDDQMTSLIQKNTFALKM |
Ga0209236_11593141 | 3300026298 | Grasslands Soil | PDLAQLIDGTRITPAGDRVELRLSLSDEQMTSLIKRNTFGFKM |
Ga0209265_10397673 | 3300026308 | Soil | DQAKIVPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Ga0209761_12791801 | 3300026313 | Grasslands Soil | DNPDLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Ga0209268_11658502 | 3300026314 | Soil | LDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Ga0209155_12694852 | 3300026316 | Soil | DLADLLDQAKIVPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Ga0209471_13081692 | 3300026318 | Soil | LLDQARVTPAGDRVMLRMSLSDDQMTSLIRKNTFALKM |
Ga0209472_12024302 | 3300026323 | Soil | QARITPAGDRVALSMSLSDEQMTALIRRNTFALKM |
Ga0209158_12839921 | 3300026333 | Soil | QARVTPAGDRVMLRMSLSDDQMTSLIRKNTFALKM |
Ga0257156_10381453 | 3300026498 | Soil | AQLLGQAQVSPGGDRVTLRMSLSDDQMAQLIKKNTFALKM |
Ga0209160_11204451 | 3300026532 | Soil | LAQLLDQARVTPAGDRVTLRMSLSDDQMASLIRKNTFALKM |
Ga0209056_100368471 | 3300026538 | Soil | KRYQAQKDNPDLAQLLDQARVTPAGDRVTLRMSLSDDQMASLIRKNTFALKM |
Ga0209648_101566681 | 3300026551 | Grasslands Soil | DQARVTPAGDRVTLRMSLSDDQMASLIRKNTFALKM |
Ga0179593_10134731 | 3300026555 | Vadose Zone Soil | QAKVTPAGDRVTIRMSLSDDQMATLIRKNTFALKM |
Ga0179587_102939481 | 3300026557 | Vadose Zone Soil | NPDLAALIDQARVTPAGDRLTIRMSLSDDQMATLIRKNTFALKM |
Ga0209625_10493861 | 3300027635 | Forest Soil | QDNPEMAQLLDSVRVTPAGDRVVLRMTLTDDQVTSLIRKNTFAFKM |
Ga0209076_10983201 | 3300027643 | Vadose Zone Soil | DLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Ga0209736_10886541 | 3300027660 | Forest Soil | QLLDQARVTPSGDRIVVHMTLTDDQMTSLIRRNTFALKM |
Ga0209588_11454132 | 3300027671 | Vadose Zone Soil | LLDQAKVTPAGDRVTIRMSLSDDQMATLIRKNTFALKM |
Ga0209180_107159002 | 3300027846 | Vadose Zone Soil | IDQARVTPAGDRVMLRMSLSDEQMTSLIRKNTFAFKM |
Ga0209166_104065002 | 3300027857 | Surface Soil | SQLLGQAQVTPGGDRVTLRMSLSDDQMAALIKKNTFALKM |
Ga0209166_105422382 | 3300027857 | Surface Soil | QKDNPDLAQLMDQVRITPGGDRVTLRMSLNDDQMTSLIKHNTFAFKM |
Ga0209380_101886134 | 3300027889 | Soil | PDLAQLLDQVRITPGGDRVTLHMSLSDDQMTSLIKHNTFSFKM |
Ga0209488_100674821 | 3300027903 | Vadose Zone Soil | KNDNPDMAQLLSQASITPAGDRVMVRMTLNDEQITALIRKNTFAFKM |
Ga0209488_103538512 | 3300027903 | Vadose Zone Soil | KYQTQKDNPDLAQLLDQARVTPAGDRVTLRMSLSDDQMTALIRKNTFALKM |
Ga0247684_10172991 | 3300028138 | Soil | ELLDQVSITPGGDRVTLRMSLSDDQMTSLIKHNTFAFKM |
Ga0302228_102022972 | 3300028808 | Palsa | LLDQATVTPAGDRVTLRMNLSDAQMTSLIQHNTFALKM |
Ga0170834_1053964601 | 3300031057 | Forest Soil | DLLGRAQVNPAGDRVVLRLALTDDQITSLIKKNTFALKM |
Ga0170834_1093433541 | 3300031057 | Forest Soil | NPDLAQLLDQVRITPGGDRVTLHMSLSDDQMTALIKHNTFTFKM |
Ga0170822_140366162 | 3300031122 | Forest Soil | LLGRAQVNPAGDRVVLRLALTDDQITSLIKKNTFALKM |
Ga0170823_104188561 | 3300031128 | Forest Soil | AQLLTQASVTPSGDRIVVHMTLTDDQMASLIKRNTFAFKM |
Ga0170823_144035131 | 3300031128 | Forest Soil | RAQVNPAGDRVVLRLALTDDQITSLIKKNTFALKM |
Ga0170819_176056591 | 3300031469 | Forest Soil | KDNPEMAALLDQARVSPSGDRVVLRLTLTDEQVTSLIRHNTFAFKM |
Ga0307476_107354331 | 3300031715 | Hardwood Forest Soil | QTQNPDLADLLGQAQVNPTGDRVVLHLALTDDQMSSLIKKNTFALKM |
Ga0307476_110778792 | 3300031715 | Hardwood Forest Soil | KDNPDLAALLDQVRIIPGGDRVTLRMSLSDDQMTSLIKHNTFAFKM |
Ga0307474_111820491 | 3300031718 | Hardwood Forest Soil | NPELAQLLDQAKVTPAGDRVTLRMSLSDDQMTSLIRSNTFTMKM |
Ga0307475_101416631 | 3300031754 | Hardwood Forest Soil | AQKDNPDLAQLLDQARVTPAGDRLTLRMSLSDDQMASLIRKNTFALKM |
Ga0318521_109993832 | 3300031770 | Soil | QQGQAQNQDLADLLSQAQVNPSGDRVVLHLSLTDDQMSSLIKKNTFALKM |
Ga0318523_101520451 | 3300031798 | Soil | ADLLGGAQINPSGDRVVLRLSLTDDQMTALIKKNTFALKM |
Ga0306919_101488254 | 3300031879 | Soil | DKQQGQAQNQDLADLLSQAQVNPSGDRVVLHLSLTDDQMSSLIKKNTFALKM |
Ga0318544_100095086 | 3300031880 | Soil | QKENPELADLLDQARITPAGDRVTLNMSLSDEQMTALIRKNTFALKM |
Ga0306923_103352921 | 3300031910 | Soil | GAAQVNPSGDRVVLRLSLTDDQMTGLIKKNTFALKM |
Ga0307479_104081494 | 3300031962 | Hardwood Forest Soil | KQQNPDLADLLGHAQVNPAGDRVVLRLALTDDQMTSLIKKNTFALKM |
Ga0307479_113825871 | 3300031962 | Hardwood Forest Soil | NPDLAQLLDQARVTPAGDRVTLRMSLSDDQMTSLIRKNTFALKM |
Ga0307470_100184706 | 3300032174 | Hardwood Forest Soil | KQQNPDLADLLGHAQVNPTGDRVVLRLALTDDQMTSLIKKNTFALKM |
Ga0335080_108609752 | 3300032828 | Soil | RYQAQKDNPDLAQLLDQVHITPAGDRVSMRTSLSDDQISSLIKHNTFAFKM |
Ga0335084_105980554 | 3300033004 | Soil | LLNQAQIQPAGDRVTLRLSLSDDQMTSLIKKNTFAFKM |
Ga0364934_0097546_1_144 | 3300034178 | Sediment | GQKNPEFAQLLDQARITPAGDRVELRMTLSDEQMSSLIRRNTFAIKM |
⦗Top⦘ |