| Basic Information | |
|---|---|
| Family ID | F033536 |
| Family Type | Metagenome |
| Number of Sequences | 177 |
| Average Sequence Length | 44 residues |
| Representative Sequence | NVPGGVYEVTKQLPHNGREFEYRIKSANEEHERVARESELTKA |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.34 % |
| % of genes near scaffold ends (potentially truncated) | 82.49 % |
| % of genes from short scaffolds (< 2000 bps) | 91.53 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.655 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.384 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.119 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.107 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.04% β-sheet: 23.94% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 5.65 |
| PF00903 | Glyoxalase | 2.82 |
| PF03797 | Autotransporter | 2.26 |
| PF03401 | TctC | 2.26 |
| PF00571 | CBS | 1.69 |
| PF01925 | TauE | 1.13 |
| PF05598 | DUF772 | 1.13 |
| PF08734 | GYD | 1.13 |
| PF01068 | DNA_ligase_A_M | 1.13 |
| PF04545 | Sigma70_r4 | 1.13 |
| PF00574 | CLP_protease | 0.56 |
| PF13751 | DDE_Tnp_1_6 | 0.56 |
| PF13763 | DUF4167 | 0.56 |
| PF13683 | rve_3 | 0.56 |
| PF08241 | Methyltransf_11 | 0.56 |
| PF01070 | FMN_dh | 0.56 |
| PF07508 | Recombinase | 0.56 |
| PF00657 | Lipase_GDSL | 0.56 |
| PF13193 | AMP-binding_C | 0.56 |
| PF13817 | DDE_Tnp_IS66_C | 0.56 |
| PF14023 | DUF4239 | 0.56 |
| PF00296 | Bac_luciferase | 0.56 |
| PF13460 | NAD_binding_10 | 0.56 |
| PF00313 | CSD | 0.56 |
| PF07969 | Amidohydro_3 | 0.56 |
| PF00378 | ECH_1 | 0.56 |
| PF02371 | Transposase_20 | 0.56 |
| PF12625 | Arabinose_bd | 0.56 |
| PF07859 | Abhydrolase_3 | 0.56 |
| PF04075 | F420H2_quin_red | 0.56 |
| PF00497 | SBP_bac_3 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 5.65 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.26 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.13 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.13 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.13 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.13 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.13 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.13 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.56 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.56 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.56 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.56 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.66 % |
| Unclassified | root | N/A | 7.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01BCZBH | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1047917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300000956|JGI10216J12902_109958939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300000956|JGI10216J12902_115241641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300001661|JGI12053J15887_10221748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300002908|JGI25382J43887_10219626 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300002910|JGI25615J43890_1006169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1851 | Open in IMG/M |
| 3300004479|Ga0062595_100015988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2672 | Open in IMG/M |
| 3300005184|Ga0066671_10169570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1289 | Open in IMG/M |
| 3300005332|Ga0066388_100958463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1425 | Open in IMG/M |
| 3300005332|Ga0066388_102008368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1037 | Open in IMG/M |
| 3300005332|Ga0066388_102949013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 869 | Open in IMG/M |
| 3300005332|Ga0066388_103309736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 823 | Open in IMG/M |
| 3300005332|Ga0066388_103359340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300005332|Ga0066388_103623509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300005332|Ga0066388_104569658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
| 3300005332|Ga0066388_105783070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300005332|Ga0066388_106216504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300005355|Ga0070671_101706150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300005435|Ga0070714_102035788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 560 | Open in IMG/M |
| 3300005437|Ga0070710_10207750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1240 | Open in IMG/M |
| 3300005439|Ga0070711_100594529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300005439|Ga0070711_101635574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300005454|Ga0066687_10779611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300005536|Ga0070697_101072908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300005557|Ga0066704_10985361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300005560|Ga0066670_11020270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300005576|Ga0066708_10298677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300005598|Ga0066706_10902873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 688 | Open in IMG/M |
| 3300005713|Ga0066905_100400929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1113 | Open in IMG/M |
| 3300005713|Ga0066905_100944093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 757 | Open in IMG/M |
| 3300005713|Ga0066905_101621212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 592 | Open in IMG/M |
| 3300005764|Ga0066903_101217133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1400 | Open in IMG/M |
| 3300005764|Ga0066903_103259895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 877 | Open in IMG/M |
| 3300005764|Ga0066903_103711853 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005764|Ga0066903_104019990 | Not Available | 788 | Open in IMG/M |
| 3300005764|Ga0066903_104743783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300005764|Ga0066903_104805825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300005764|Ga0066903_106249533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300005764|Ga0066903_106920621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300005764|Ga0066903_108944520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 507 | Open in IMG/M |
| 3300005983|Ga0081540_1192337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 751 | Open in IMG/M |
| 3300006028|Ga0070717_10308164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1409 | Open in IMG/M |
| 3300006028|Ga0070717_10618893 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300006050|Ga0075028_100535595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300006175|Ga0070712_101891722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300006880|Ga0075429_100749129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300009012|Ga0066710_101696935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 961 | Open in IMG/M |
| 3300009090|Ga0099827_10246118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1501 | Open in IMG/M |
| 3300009092|Ga0105250_10516389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300009094|Ga0111539_12055846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 663 | Open in IMG/M |
| 3300009100|Ga0075418_11248911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300009147|Ga0114129_12896742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300009148|Ga0105243_12068399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300009156|Ga0111538_10505937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1531 | Open in IMG/M |
| 3300009792|Ga0126374_10112509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1572 | Open in IMG/M |
| 3300010043|Ga0126380_10813251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300010043|Ga0126380_11344719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 624 | Open in IMG/M |
| 3300010046|Ga0126384_10517167 | Not Available | 1031 | Open in IMG/M |
| 3300010047|Ga0126382_11680856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300010325|Ga0134064_10165110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300010333|Ga0134080_10014576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2847 | Open in IMG/M |
| 3300010337|Ga0134062_10511017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300010359|Ga0126376_10883199 | Not Available | 882 | Open in IMG/M |
| 3300010359|Ga0126376_11767158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300010361|Ga0126378_12196120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300010362|Ga0126377_12845969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300010366|Ga0126379_12333461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300010366|Ga0126379_12696251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300010376|Ga0126381_100416124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1877 | Open in IMG/M |
| 3300010398|Ga0126383_11545145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300010398|Ga0126383_11965399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300011269|Ga0137392_10495060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300012200|Ga0137382_10083530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 2076 | Open in IMG/M |
| 3300012201|Ga0137365_11189789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300012204|Ga0137374_10701116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300012208|Ga0137376_10999646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300012208|Ga0137376_11076372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300012208|Ga0137376_11328272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300012211|Ga0137377_10327573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1467 | Open in IMG/M |
| 3300012211|Ga0137377_10816186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 865 | Open in IMG/M |
| 3300012212|Ga0150985_108123352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300012349|Ga0137387_11258770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300012350|Ga0137372_10772186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300012354|Ga0137366_10156081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1716 | Open in IMG/M |
| 3300012357|Ga0137384_11262327 | Not Available | 585 | Open in IMG/M |
| 3300012360|Ga0137375_10114175 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300012361|Ga0137360_11031796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300012362|Ga0137361_10310567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1443 | Open in IMG/M |
| 3300012922|Ga0137394_10368730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1225 | Open in IMG/M |
| 3300012938|Ga0162651_100085336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300012971|Ga0126369_13072392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300012976|Ga0134076_10116735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1071 | Open in IMG/M |
| 3300013308|Ga0157375_11594261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300016270|Ga0182036_10200811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1461 | Open in IMG/M |
| 3300016270|Ga0182036_10959883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 703 | Open in IMG/M |
| 3300016319|Ga0182033_10257440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1421 | Open in IMG/M |
| 3300016319|Ga0182033_10818069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300016341|Ga0182035_10535721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 1004 | Open in IMG/M |
| 3300016341|Ga0182035_12133085 | Not Available | 509 | Open in IMG/M |
| 3300016404|Ga0182037_10826107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 800 | Open in IMG/M |
| 3300016404|Ga0182037_11050264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300016422|Ga0182039_11748228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 569 | Open in IMG/M |
| 3300016445|Ga0182038_11410995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300018028|Ga0184608_10194364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300018062|Ga0187784_10969274 | Not Available | 676 | Open in IMG/M |
| 3300018066|Ga0184617_1030319 | Not Available | 1276 | Open in IMG/M |
| 3300018468|Ga0066662_10760411 | Not Available | 934 | Open in IMG/M |
| 3300019876|Ga0193703_1016236 | Not Available | 1134 | Open in IMG/M |
| 3300020199|Ga0179592_10221147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300021082|Ga0210380_10533319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300021168|Ga0210406_10198123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1666 | Open in IMG/M |
| 3300021170|Ga0210400_11112495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300025905|Ga0207685_10527947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 625 | Open in IMG/M |
| 3300025906|Ga0207699_11207332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300025910|Ga0207684_10054772 | All Organisms → cellular organisms → Bacteria | 3384 | Open in IMG/M |
| 3300025915|Ga0207693_10120897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2057 | Open in IMG/M |
| 3300025915|Ga0207693_10317701 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300025928|Ga0207700_10889243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300025928|Ga0207700_10925424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 780 | Open in IMG/M |
| 3300025939|Ga0207665_11170918 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026277|Ga0209350_1156653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300026322|Ga0209687_1224631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300026523|Ga0209808_1130166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1014 | Open in IMG/M |
| 3300026551|Ga0209648_10781553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300026557|Ga0179587_10412765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 881 | Open in IMG/M |
| 3300027603|Ga0209331_1005937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3313 | Open in IMG/M |
| 3300027651|Ga0209217_1010336 | All Organisms → cellular organisms → Bacteria | 3056 | Open in IMG/M |
| 3300027654|Ga0209799_1005434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2634 | Open in IMG/M |
| 3300028714|Ga0307309_10038397 | Not Available | 1005 | Open in IMG/M |
| 3300028719|Ga0307301_10070184 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300028755|Ga0307316_10272289 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300028799|Ga0307284_10286446 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300028811|Ga0307292_10148341 | Not Available | 946 | Open in IMG/M |
| 3300028881|Ga0307277_10393154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300028884|Ga0307308_10537870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300030336|Ga0247826_11792751 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → unclassified Rhodothermales → Rhodothermales bacterium | 502 | Open in IMG/M |
| 3300031170|Ga0307498_10353279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031543|Ga0318516_10267197 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300031573|Ga0310915_10109751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1874 | Open in IMG/M |
| 3300031573|Ga0310915_11221503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300031668|Ga0318542_10252952 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031681|Ga0318572_10037391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2560 | Open in IMG/M |
| 3300031713|Ga0318496_10048684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2190 | Open in IMG/M |
| 3300031719|Ga0306917_10152046 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300031724|Ga0318500_10246196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300031768|Ga0318509_10262847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 964 | Open in IMG/M |
| 3300031771|Ga0318546_10086201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2036 | Open in IMG/M |
| 3300031779|Ga0318566_10110995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1349 | Open in IMG/M |
| 3300031781|Ga0318547_10495191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300031781|Ga0318547_10505567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300031819|Ga0318568_10968766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300031832|Ga0318499_10294912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300031833|Ga0310917_10382425 | Not Available | 956 | Open in IMG/M |
| 3300031833|Ga0310917_10864716 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031879|Ga0306919_10004996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6980 | Open in IMG/M |
| 3300031879|Ga0306919_10710305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 774 | Open in IMG/M |
| 3300031880|Ga0318544_10081476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1204 | Open in IMG/M |
| 3300031890|Ga0306925_10500249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1294 | Open in IMG/M |
| 3300031890|Ga0306925_10540713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1236 | Open in IMG/M |
| 3300031890|Ga0306925_11681260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300031890|Ga0306925_12171874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni | 517 | Open in IMG/M |
| 3300031910|Ga0306923_10383236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1601 | Open in IMG/M |
| 3300031912|Ga0306921_10849065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300031941|Ga0310912_10700621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031945|Ga0310913_10736519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300031946|Ga0310910_10202194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1541 | Open in IMG/M |
| 3300031954|Ga0306926_10957501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1021 | Open in IMG/M |
| 3300032001|Ga0306922_10599485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300032035|Ga0310911_10265375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 984 | Open in IMG/M |
| 3300032035|Ga0310911_10267187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 981 | Open in IMG/M |
| 3300032051|Ga0318532_10005631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3650 | Open in IMG/M |
| 3300032060|Ga0318505_10043884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1891 | Open in IMG/M |
| 3300032063|Ga0318504_10294780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300032065|Ga0318513_10045348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1953 | Open in IMG/M |
| 3300032180|Ga0307471_100687858 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.47% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.13% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.56% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.56% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_08259590 | 2170459005 | Grass Soil | LVGISGKAGGVYEVIKHLPGDGEYEYRIKSANELHERVARESELTKA |
| AF_2010_repII_A100DRAFT_10479172 | 3300000655 | Forest Soil | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESELIKP* |
| JGI10216J12902_1099589392 | 3300000956 | Soil | VTKQLPHNGREFEYRIRSANRIRSANEEHERVARESELSKP* |
| JGI10216J12902_1152416412 | 3300000956 | Soil | MVRPAISRNIPGGAYEVTKQLPHNGREFEYRIKSANEEHERVAGENELTKL* |
| JGI12053J15887_102217483 | 3300001661 | Forest Soil | MLKGSVSRNVPGGVYEVVRQLPHNGREFEYHIKNSNESHERVAGESELTRA* |
| JGI25382J43887_102196261 | 3300002908 | Grasslands Soil | VPGGVYEITKQLPENRGEFEYRIKSVNELHERVARESELTKA* |
| JGI25615J43890_10061691 | 3300002910 | Grasslands Soil | PGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP* |
| Ga0062595_1000159884 | 3300004479 | Soil | PRGRRNAPWGVYEVVKVLPGSREPEYRIKSANEEHERVARESELIRA* |
| Ga0066671_101695703 | 3300005184 | Soil | VYVRPAISRNLPGGAYTVTKQLPYNGREFEYRIKSASEEHERVAGESALTKA* |
| Ga0066388_1009584632 | 3300005332 | Tropical Forest Soil | MLRPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPHERIAGESELIKP* |
| Ga0066388_1020083681 | 3300005332 | Tropical Forest Soil | STYRDVPVGVCIVTRVLPDHNGEREYRVKNANEPHERIAGESELELA* |
| Ga0066388_1029490132 | 3300005332 | Tropical Forest Soil | MRAAISRNVPGGVYEVIKQLPHNRREYQYRIKSANEEHERVAGEGELTKA* |
| Ga0066388_1033097362 | 3300005332 | Tropical Forest Soil | SRNVPGGVYEVIKQLPHNGREYEYFIKSANEEHARVAGEGELTNA* |
| Ga0066388_1033593401 | 3300005332 | Tropical Forest Soil | YEVIKQLPHNGREYEYRIKSANEEYARIAGERELTKPKET* |
| Ga0066388_1036235092 | 3300005332 | Tropical Forest Soil | SRNVPGGVYEVTKQLPHNGREFEYRIKSANEPYERIAGERELIKP* |
| Ga0066388_1045696582 | 3300005332 | Tropical Forest Soil | VRGLYEVTKQLPHNGREYEYRIKSQYEEHARSARESQLSNE* |
| Ga0066388_1057830702 | 3300005332 | Tropical Forest Soil | PGGVYEVIKQLPHNGREYEYRIKSANEEFERIAGERELTRA* |
| Ga0066388_1062165041 | 3300005332 | Tropical Forest Soil | ALSRNVPGGVYEITKQLPENRGEFEYRIKSVNELHERVARESELTKA* |
| Ga0070671_1017061501 | 3300005355 | Switchgrass Rhizosphere | AISRNVPGGVYEVTKRLPHNGREYEYRIKSANEEHERIAGEGELTKA* |
| Ga0070714_1020357882 | 3300005435 | Agricultural Soil | MVRPAISRNIPGGAYKVTKQLPHNGREFEYLIKSASEEHERVAGESELTRL* |
| Ga0070710_102077502 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKPAISRNVPGGVYEVTKRLPHNGREYEYRIKSANEEHERIAGEGELTKA* |
| Ga0070711_1005945291 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GGVYEVIKQLPHNGREYEYRIKSANEEYERIAGERELTKV* |
| Ga0070711_1016355741 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GGVYEVIKQLPHNGREYEYRIKSANEEYERIAGERELTKA* |
| Ga0066687_107796111 | 3300005454 | Soil | IRSISRNVAGGIYQVTKQLPHNGLDFEYHIKSANEEHQRVAGERELTKV* |
| Ga0070697_1010729082 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP* |
| Ga0066704_109853611 | 3300005557 | Soil | VPARAFCPSGGTYEVTKQLPHNGREFEYRVKSASEDHERVMPESELTKA* |
| Ga0066670_110202702 | 3300005560 | Soil | GDSVMLKPSVSHNVPGGVYEVIKQLPHNGREYEYRIKSANEEYQRIVGERELTKA* |
| Ga0066708_102986772 | 3300005576 | Soil | GIYQVTKQLPHNGLEFEYHIKSANEQHQRVARESELTKA* |
| Ga0066706_109028733 | 3300005598 | Soil | KPSVSHNVPGGVYEVIKQLPHNGREYEYRIKSANEEYQRIVGERELTKA* |
| Ga0066905_1004009291 | 3300005713 | Tropical Forest Soil | VTKQLPHNGREFEYRIKSVNEPHERVAGESELTRD* |
| Ga0066905_1009440932 | 3300005713 | Tropical Forest Soil | MLRPAVSRNVPGGVYEVTKQLPHNGREYEYRIKSANEPYERIAGESELIKL* |
| Ga0066905_1016212122 | 3300005713 | Tropical Forest Soil | VPGGLYEVTKQLPHNGREFEYRIKSVNESHERVAGESELTRD* |
| Ga0066903_1012171331 | 3300005764 | Tropical Forest Soil | RNVPAGAYEVVKRLPHNGREFEYRIKSTNEEHQRVAGESELTKL* |
| Ga0066903_1032598953 | 3300005764 | Tropical Forest Soil | GVYQVTKQLPHDGREFEYRIKSANEEHERVARESELTKDRST* |
| Ga0066903_1037118533 | 3300005764 | Tropical Forest Soil | RNVPGGVYEVIKQLPHNGREYEYRIKSANEEYERIAGERELTKA* |
| Ga0066903_1040199901 | 3300005764 | Tropical Forest Soil | VPGGVYEVTKQLPHNGLSEYRIKSVNEPYERVAGESE* |
| Ga0066903_1047437831 | 3300005764 | Tropical Forest Soil | EVIKQLPHNGREYEYRIKSANEEYERIAGERELTKA* |
| Ga0066903_1048058252 | 3300005764 | Tropical Forest Soil | RHVSGGIYQVTKQLPHNGRDFEYHIKSAHEQHQRVASESELTKA* |
| Ga0066903_1062495332 | 3300005764 | Tropical Forest Soil | RNVPGGVYEVTKQLPHDGREFEYRIKSANEEHERVAREGELTKA* |
| Ga0066903_1069206213 | 3300005764 | Tropical Forest Soil | YQVVRQLPHNGLDFEYHIKSANERQQRLARESELTKA* |
| Ga0066903_1089445201 | 3300005764 | Tropical Forest Soil | LIPSISRNVSGGIYQVTKQLPHNGRDFEYHIKSANEQHQRVAGERELTKA* |
| Ga0081540_11923372 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGES |
| Ga0070717_103081643 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VMRAISRNVPGGAYEVTKQLPHNGREFEYRVKSASEEHERVMRESELTKA* |
| Ga0070717_106188931 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ISRNVPGGVYEVTKRLPHNGREYEYRIKSANEEHERIAGEGELTKA* |
| Ga0075028_1005355951 | 3300006050 | Watersheds | VPGGVYEVTKQLPHSGHEFEYRIKSVNEPHERVALQLKPVPLAQ* |
| Ga0070712_1018917222 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IKQLPHNGREYEYRIKSANEEYERIAGERELTKA* |
| Ga0075429_1007491291 | 3300006880 | Populus Rhizosphere | DPGGVYEITKQLSENRGEFEYRVKSVNELHERVARESELAKA* |
| Ga0066710_1016969353 | 3300009012 | Grasslands Soil | NVPGGVYQVIKQLPHNGRDFEYLIKSAREDHQRIAGESELTKA |
| Ga0099827_102461181 | 3300009090 | Vadose Zone Soil | AYEVTKQLPHNGREFEYRVKSASEEHERVMRESELTKA* |
| Ga0105250_105163891 | 3300009092 | Switchgrass Rhizosphere | YVRPAISRNLPGGAYTVTKQLPYNGREFEYRIKSASEEHERVVGESALTKA* |
| Ga0111539_120558462 | 3300009094 | Populus Rhizosphere | VPGGAYEVTKQLPHNGREFEYRIKSASEEHERVAGESELIKP* |
| Ga0075418_112489112 | 3300009100 | Populus Rhizosphere | AYVVTKQLPHNGRELEYRIKSASEEHERVVRESELAKA* |
| Ga0114129_128967422 | 3300009147 | Populus Rhizosphere | MCQAGAYEVTKQLPHNGREFEYRIKSANEEHERVAQESKLTGA* |
| Ga0105243_120683991 | 3300009148 | Miscanthus Rhizosphere | GEGVMLKPAISRNVPGGVYEVTKRLPHNGREYEYRIKSANEEHERIAGEGELTKA* |
| Ga0111538_105059371 | 3300009156 | Populus Rhizosphere | TKQLPHNGREFEYRIKSANEEHERVVRESELTKA* |
| Ga0126374_101125091 | 3300009792 | Tropical Forest Soil | IKQLPYNGREYEYRIKSANEEYERIAGERELTKV* |
| Ga0126380_108132512 | 3300010043 | Tropical Forest Soil | VKKQLPHNGSEFEYRIKSAAEEHERVARESELTKS* |
| Ga0126380_113447192 | 3300010043 | Tropical Forest Soil | GVYEVTKQLPHDGREFGYRIKSANEEHERVAREGELTKA* |
| Ga0126384_105171672 | 3300010046 | Tropical Forest Soil | SRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP* |
| Ga0126382_116808561 | 3300010047 | Tropical Forest Soil | VTKHLPHNGIEFEYHIKSANEPYERIAGESELIKP* |
| Ga0134064_101651102 | 3300010325 | Grasslands Soil | YEVIKELPHNGREYEYRIKSASEEHQRIAGEGELTKA* |
| Ga0134080_100145761 | 3300010333 | Grasslands Soil | VYEVTKQHPHNGREFEYRIKSASESHERVAQESELTKA* |
| Ga0134062_105110171 | 3300010337 | Grasslands Soil | ISRNVPGGVYEVIKQLPHNGREYEYRIKSASEEHQRIAGEGELTKA* |
| Ga0126376_108831991 | 3300010359 | Tropical Forest Soil | TKKLPHNGQEYEYRIKSAHEEHERTARESQLSGA* |
| Ga0126376_117671583 | 3300010359 | Tropical Forest Soil | GGVYEVIKQLPHNGREYEYRIKSANEEFERIAGERELTKA* |
| Ga0126378_121961201 | 3300010361 | Tropical Forest Soil | IVTIRPALSRNVPGGLYEVTKQLPHNGHEFEYRISVNEPHERVARESELTRD* |
| Ga0126377_128459691 | 3300010362 | Tropical Forest Soil | GLYEVTKQLPHNGREYEYRIKSQYEEHERSARESQLSNE* |
| Ga0126379_123334612 | 3300010366 | Tropical Forest Soil | RPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP* |
| Ga0126379_126962512 | 3300010366 | Tropical Forest Soil | VTKQLPHNGREFEYRIKSANEEHERVVRESELTKA* |
| Ga0126381_1004161241 | 3300010376 | Tropical Forest Soil | VTKQLPHNGHEFEYRIKSVNEPHERVARESELTKN* |
| Ga0126383_115451451 | 3300010398 | Tropical Forest Soil | GAYVVTKQLPHNGREFEYRIKSASEEHERVVRESELAKA* |
| Ga0126383_119653991 | 3300010398 | Tropical Forest Soil | IPSVKSKNVSDGIYEVTKQLPHNGSEFEYHVKSATERHQRAARESELAKT* |
| Ga0137392_104950601 | 3300011269 | Vadose Zone Soil | VTIRPALSRNVPGGVYEITKQLPENRGEFEYRIKSVNELHERVARESELTKA* |
| Ga0137382_100835303 | 3300012200 | Vadose Zone Soil | YVVTKRLPYNGLEFEYRIKSASEAHERVVRESELAKA* |
| Ga0137365_111897891 | 3300012201 | Vadose Zone Soil | VTKQLPHNGREFEYLIKSANEAHERVAGESELTKL* |
| Ga0137374_107011161 | 3300012204 | Vadose Zone Soil | VVTKQLPHNGREFEYRIKSANEEHERVVRESELTKA* |
| Ga0137376_109996461 | 3300012208 | Vadose Zone Soil | IVYVLRAISRNAPGGAYEVTKQLPHNGREFEYRIKVANEEHERVAWESELTRA* |
| Ga0137376_110763722 | 3300012208 | Vadose Zone Soil | IVSLRRAVSRNVPGGAYEVTKRLPHNGREFEYRIKSVNEEHERVAGESELTKL* |
| Ga0137376_113282722 | 3300012208 | Vadose Zone Soil | RNVPGGAYEVTKHLPHNGREFEYHIKSANEEHESVARESELTKA* |
| Ga0137377_103275733 | 3300012211 | Vadose Zone Soil | YEVTKQLPHNGREFEYHIKSANEEHERVARESELTKA* |
| Ga0137377_108161861 | 3300012211 | Vadose Zone Soil | NAPGGAYKVTKQLPHNGREFEYLIKSANEEHERVAGESELTKL* |
| Ga0150985_1081233522 | 3300012212 | Avena Fatua Rhizosphere | GQSVTLIPATSRNVPGGIYEITKKLPENHGEFEYRIKSLGEVHERVARESELAKP* |
| Ga0137387_112587701 | 3300012349 | Vadose Zone Soil | TKQLPHNGLEFEYHIKSANEQHQRVARESELTKA* |
| Ga0137372_107721861 | 3300012350 | Vadose Zone Soil | NVPGGVYEVTKQLPHNGREFEYRIKSANEEHERVARESELTKA* |
| Ga0137366_101560815 | 3300012354 | Vadose Zone Soil | VYTVTKQLPENHGEFEYRIKSADEVHERVARESELIKA* |
| Ga0137384_112623271 | 3300012357 | Vadose Zone Soil | VTIRLALSRNVPGGVYTVTKQLSENHGEFEYRIKSVDEVHERVARESELIKA* |
| Ga0137375_101141756 | 3300012360 | Vadose Zone Soil | VTIRLALSRNVPGGVYTVTKQLPENHGEFEYRIKSADEVHERVARESELIKA* |
| Ga0137360_110317962 | 3300012361 | Vadose Zone Soil | PGLYEVTKQLPHDGREYEYRIKSAHEEHERTARERQLSSA* |
| Ga0137361_103105671 | 3300012362 | Vadose Zone Soil | VTIRLALSRNVPGGVYTVTKQLPENHGEFEYRIKSVDEVHERVARESELIKA* |
| Ga0137394_103687301 | 3300012922 | Vadose Zone Soil | TSAIRNVPGGVYGVTKLLPHNGSEFEYRIKSASEEHERVARESEMTRA* |
| Ga0162651_1000853361 | 3300012938 | Soil | LRPVVSRNVPGGAYEVTKQLPHNGREFEYRIKSASEEHERVALESELTKT* |
| Ga0126369_130723921 | 3300012971 | Tropical Forest Soil | YEVIKQLPHNGREYEYRIKSANEEFERIAGERELTKA* |
| Ga0134076_101167352 | 3300012976 | Grasslands Soil | ESVTLRPAISRNMPGGVYEVTKQLPHNGLEFEYRIKSVNELHERVARESELTKA* |
| Ga0157375_115942611 | 3300013308 | Miscanthus Rhizosphere | VPGGAYEVTKKLPHNGHEFEYRIKSASEEHERIALESELGWS* |
| Ga0182036_102008111 | 3300016270 | Soil | SVMLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0182036_109598831 | 3300016270 | Soil | RPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPHERIAGESELIKP |
| Ga0182033_102574403 | 3300016319 | Soil | GVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0182033_108180693 | 3300016319 | Soil | GGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0182035_105357211 | 3300016341 | Soil | ESVMLRPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPHERIAGESELIKP |
| Ga0182035_121330851 | 3300016341 | Soil | MRHAGHEITKQLPHNGTEYEYRIKSQYEEHERIARESQLSSA |
| Ga0182037_108261072 | 3300016404 | Soil | YEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0182037_110502641 | 3300016404 | Soil | QIVTIKPALSRNVPGGVYTVTKQLPENRGEFEYRIKSMDEVHERIARESELTKA |
| Ga0182039_117482282 | 3300016422 | Soil | FTIIKQLPGNDEPEYRIKSSNEPHERVVRESELTKA |
| Ga0182038_114109951 | 3300016445 | Soil | LIPSISRHVSGGIYQVTKQLPHNGRDFEYHIKSAHEQHQRVARESELTKA |
| Ga0184608_101943642 | 3300018028 | Groundwater Sediment | PGGAYEVTKQLPHNGREFEYRIKSASEEHERVALESELTKA |
| Ga0187784_109692741 | 3300018062 | Tropical Peatland | YEVTKRLPHNGQEYEYRIKSAREEHERTTRESQLSIA |
| Ga0184617_10303194 | 3300018066 | Groundwater Sediment | GLYDVTKPKLLPHNDHEFEYRIKSASEEHERVARESELTRA |
| Ga0066662_107604111 | 3300018468 | Grasslands Soil | MPSHKFKISLDVQGCIYEVTKQLAGEGECQYRIKSANEPHERVARESELTKA |
| Ga0193703_10162361 | 3300019876 | Soil | VPGGLYDVTKPKLLPHNGHEFEYRIKSASEEHERVARESELTRA |
| Ga0179592_102211473 | 3300020199 | Vadose Zone Soil | RAARGPYEVTKRLPHNGREYEYRIKSQYEEHERIAMESQLSSA |
| Ga0210380_105333192 | 3300021082 | Groundwater Sediment | MVALKPAVSRNVPGGIFEVVKQLPGNGEREYRIKSANEPHERIALESEPIPGV |
| Ga0210406_101981231 | 3300021168 | Soil | PTLSRNVSGGVYIVTKQLPENQGEFEYRIKGVEEVHEHIARESELTKA |
| Ga0210400_111124951 | 3300021170 | Soil | IYEVTKQLPHNGREYEYRIKSANEEHERIAGEGELTKA |
| Ga0207685_105279471 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YEVIKQLPHNGREYEYRIKSANEEYERIAGERELTKA |
| Ga0207699_112073321 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YVVIKHLPGIGEYEYRIKSANEAHERVARESELTKV |
| Ga0207684_100547726 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VILSPASRNVPGGVYEVTKQLPHNGHEFEYRIKSSNESHERVVGESELTRA |
| Ga0207693_101208972 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRPAISRNIPGGAYKVTKQLPHNGREFEYLIKSASEEHERVAGESELTRL |
| Ga0207693_103177012 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GGAYEVTKQLPHNGREFEYRIKSANEDHERVARESELTKA |
| Ga0207700_108892431 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGGVYEVIKKLPHNGREYEYRIKSANEEYERIAGERELTKA |
| Ga0207700_109254242 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PGYEVIKQLPHNGREYEYRIKSANEEYERIAGERELTKA |
| Ga0207665_111709181 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGGAYEVTKQLPHNGREFEYRIKSANEDHERVARESELTKA |
| Ga0209350_11566532 | 3300026277 | Grasslands Soil | RHVPGGVYEVTKQLPHNGREFEYRIKSANEEHERVARESELTKA |
| Ga0209687_12246312 | 3300026322 | Soil | VTLIRSISRNVAGGIYQVTKQLPHNGLDFEYHIKSANEEHQRVAGERELTKV |
| Ga0209808_11301661 | 3300026523 | Soil | VSHNVPGGVYEVIKQLPHNGREYEYRIKSANEEYQRIVGERELTKA |
| Ga0209648_107815532 | 3300026551 | Grasslands Soil | GLYEVTKRLPHNGREYEYRIKSQYEEHERIAMESQLSSA |
| Ga0179587_104127652 | 3300026557 | Vadose Zone Soil | RPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0209331_10059376 | 3300027603 | Forest Soil | MLARRMVTKQLPENRGEFEYRTKSVEEVHERVARESELTKA |
| Ga0209217_10103365 | 3300027651 | Forest Soil | KPALSRNVPGGVYIVTKQLPENRGEFEYRIKSVEEVHERVARESELTKA |
| Ga0209799_10054343 | 3300027654 | Tropical Forest Soil | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0307309_100383971 | 3300028714 | Soil | GGLYDVTKPKLLPHNDHEFEYRIKSASEEHERVARESELTRA |
| Ga0307301_100701842 | 3300028719 | Soil | GGAYEVTKQLPHNGREFEYRIKSASEEHERVALESELTKA |
| Ga0307316_102722891 | 3300028755 | Soil | YEVTKQLPHNGREFEYRIKSASEEHERVALESELTKA |
| Ga0307284_102864461 | 3300028799 | Soil | AYEVTKQLPHNGREFEYRIKSASEEHERVALESELTKA |
| Ga0307292_101483414 | 3300028811 | Soil | GLYDVTKPKLLPHNGHEFEYRIKSASEEHERVARESELTRA |
| Ga0307277_103931541 | 3300028881 | Soil | SRNVPGGVYEVIKRLPHNGREYEYRIKSANEEYERIAGERELTKA |
| Ga0307308_105378701 | 3300028884 | Soil | GGVYGVTKLLPHNGSEFEYRIKSASEEHERVARESEMTRA |
| Ga0247826_117927511 | 3300030336 | Soil | PGGAYEIVQRLPENNGEFEYRIKSATESHQRVARENELTRM |
| Ga0307498_103532792 | 3300031170 | Soil | AYEVTKQLPHNGREFEYRIKSAGEEHERVAGESELNRP |
| Ga0318516_102671971 | 3300031543 | Soil | MCQAGFMTKQLSHDGREFEYRIKSANEEHERVAREGELTKA |
| Ga0310915_101097512 | 3300031573 | Soil | MLRPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPHERIAGESELIKP |
| Ga0310915_112215032 | 3300031573 | Soil | VPGGVYTVTKQLPENRGEFEYRIKSMDEVHERIARESELTKA |
| Ga0318542_102529521 | 3300031668 | Soil | PGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0318572_100373912 | 3300031681 | Soil | MLRAAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0318560_104591133 | 3300031682 | Soil | YTVTKQLPENRGEFEYRIKSMDEVHERIARESELTKA |
| Ga0318496_100486841 | 3300031713 | Soil | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERI |
| Ga0306917_101520462 | 3300031719 | Soil | MTKQLSHDGREFEYRIKSANEEHERVAREGELTKA |
| Ga0318500_102461961 | 3300031724 | Soil | LRAAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0318509_102628471 | 3300031768 | Soil | LRPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPHERIAGESELIKP |
| Ga0318546_100862014 | 3300031771 | Soil | SISRHVSGGIYQVTKQLPHNGRDFEYHIKSAHEQHQRVARESELTKA |
| Ga0318566_101109951 | 3300031779 | Soil | MLRAAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPHERIAGESELIKP |
| Ga0318547_104951911 | 3300031781 | Soil | SQRARLYEVTKQLPHNGREFEYRIKSVNEPHERVAGESELTRD |
| Ga0318547_105055672 | 3300031781 | Soil | MLRPAVSRNVPGGVYEVTKQLPHNGLEFEYRINSANEPYERIAGESELIKP |
| Ga0318568_109687661 | 3300031819 | Soil | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESEL |
| Ga0318499_102949122 | 3300031832 | Soil | RNVSGGIYQVTKQLPHNGLEFEYHIKSADEQHQRVARECDLTKA |
| Ga0310917_103824253 | 3300031833 | Soil | VMLRAAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0310917_108647161 | 3300031833 | Soil | EVIQQLPHNGREYEYRIKSAHEEHVRGATEGQLTGM |
| Ga0306919_100049961 | 3300031879 | Soil | GESVMLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0306919_107103053 | 3300031879 | Soil | IAHAARGPYEVIKQLPHNGREHEYRIKSAHEEHVRSATESQLTSM |
| Ga0318544_100814761 | 3300031880 | Soil | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESE |
| Ga0306925_105002494 | 3300031890 | Soil | GESVMLRPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0306925_105407133 | 3300031890 | Soil | CRHVSGGIYQVTKQLPHNGRDFEYHIKSAHEQHQRVARESELTKA |
| Ga0306925_116812601 | 3300031890 | Soil | GQIVTIKPALSRNVPGGVYTVTKQLPENRGEFEYRIKSMDEVHERIARESELTKA |
| Ga0306925_121718741 | 3300031890 | Soil | RIGESVMLKPAVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPHERIAGESELIKP |
| Ga0306923_103832363 | 3300031910 | Soil | PGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0306921_108490654 | 3300031912 | Soil | SLKPAISRNVPGGVFEVIKHLPGTSEPEYRIKSANEPHERVALESELTKA |
| Ga0310912_107006211 | 3300031941 | Soil | AARGPYEVIKQLPHNGREYEYRIKSAHEEHVRSATESQLTSM |
| Ga0310913_107365192 | 3300031945 | Soil | EVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0310910_102021943 | 3300031946 | Soil | YEVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0306926_109575013 | 3300031954 | Soil | VSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0306922_105994854 | 3300032001 | Soil | AVSRNVPGGVYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELIKP |
| Ga0310911_102653751 | 3300032035 | Soil | EVTKQLPHNGREFEYRIKSVNEPHERVAGESELTRD |
| Ga0310911_102671871 | 3300032035 | Soil | EVTKQLPHDGREFEYRIKSANEEHERVAREGELTKA |
| Ga0318532_100056315 | 3300032051 | Soil | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIGGE |
| Ga0318505_100438843 | 3300032060 | Soil | MLRPAVSRNVPGGVYEVTKHLPHNGLEFEYRIKSANEPYERIAGESELIK |
| Ga0318504_102947802 | 3300032063 | Soil | GGYAVTKQLPHNGREFEYRIKSASEEHERVVRESELTKA |
| Ga0318513_100453482 | 3300032065 | Soil | VYEVTKQLPHNGLEFEYRIKSANEPYERIAGESELVKP |
| Ga0307471_1006878582 | 3300032180 | Hardwood Forest Soil | GAYEVTKQLPHNGREFEYRIKSANEDHERVARESELTKA |
| ⦗Top⦘ |