| Basic Information | |
|---|---|
| Family ID | F033429 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYREED |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.18 % |
| % of genes near scaffold ends (potentially truncated) | 23.16 % |
| % of genes from short scaffolds (< 2000 bps) | 82.49 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.887 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (22.034 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.401 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.655 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 76.74% β-sheet: 0.00% Coil/Unstructured: 23.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF03819 | MazG | 3.95 |
| PF13155 | Toprim_2 | 3.39 |
| PF01503 | PRA-PH | 2.26 |
| PF08291 | Peptidase_M15_3 | 1.13 |
| PF00476 | DNA_pol_A | 1.13 |
| PF03237 | Terminase_6N | 0.56 |
| PF13455 | MUG113 | 0.56 |
| PF02867 | Ribonuc_red_lgC | 0.56 |
| PF12236 | Head-tail_con | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 1.13 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.89 % |
| All Organisms | root | All Organisms | 40.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 22.03% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.08% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.30% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 6.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 6.21% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 6.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.65% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.39% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.82% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 2.26% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.13% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.13% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.13% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.13% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.56% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.56% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.56% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.56% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024340 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027191 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100291066 | 3300000101 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED* |
| DelMOSum2010_101243794 | 3300000101 | Marine | MITDNTTENDLLAETIDELGQSLTELQQVINDIKEQVNYREES* |
| DelMOSum2010_101346792 | 3300000101 | Marine | MVVDNSTENDLLAETIEELGQSLTELQQVINDIKEQVNYREES* |
| DelMOSum2010_101600481 | 3300000101 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEETA* |
| DelMOSum2010_102329172 | 3300000101 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYREES* |
| DelMOSum2011_100204832 | 3300000115 | Marine | MITDNTTENDLLAETIDELGQSLTELQQVIADIKQQVNYREES* |
| DelMOSum2011_101012955 | 3300000115 | Marine | ENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEEN* |
| DelMOSum2011_102192583 | 3300000115 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRG |
| DelMOSpr2010_100660445 | 3300000116 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEEN* |
| DelMOSpr2010_100808686 | 3300000116 | Marine | MITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED* |
| BBAY92_100157897 | 3300000947 | Macroalgal Surface | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRPEGE* |
| BBAY92_100305203 | 3300000947 | Macroalgal Surface | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYKEED* |
| BBAY94_100605973 | 3300000949 | Macroalgal Surface | MITDNTTENDLLAETIDELGQSLTELQQVIADIKEQVNYREED* |
| BBAY93_101446471 | 3300000973 | Macroalgal Surface | MITDNSTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEDTQ* |
| JGI20154J14316_100635302 | 3300001348 | Pelagic Marine | MIIDNSTENDLLAETIDELGQSLSELQQVIADIKEQVNYREES* |
| JGI20154J14316_100664082 | 3300001348 | Pelagic Marine | MITDNTTENDLLAETIEGLGQSLTELQQIIDNLKIGVNYVEDGETE* |
| JGI20153J14318_101712452 | 3300001351 | Pelagic Marine | YILMITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEGN* |
| Water_1048875 | 3300002930 | Estuary Water | MITDNTTENDLLAETIEELGQSLTELQLVINDIKEQVNYRTEDN* |
| Ga0066224_11796322 | 3300004457 | Marine | MITDNSTENDLLAETIDELGQSLTELAQVIADIKQQVNYRED* |
| Ga0070743_100261414 | 3300005941 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRGEDRQ* |
| Ga0070743_100417696 | 3300005941 | Estuarine | MIIDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYREED* |
| Ga0070743_100512413 | 3300005941 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRTEVD* |
| Ga0070743_101242183 | 3300005941 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQLVINDIKEQVNYREED* |
| Ga0070742_101828052 | 3300005942 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEHVNYRTEEN* |
| Ga0075466_10009467 | 3300006029 | Aqueous | MITDNTTENDLLAETIDELGQSLTELQQVIADIKQQVNYRGED* |
| Ga0075466_11063173 | 3300006029 | Aqueous | MITDNSTENDLLAETIEELGQSLTELQQVINDIKEQVNYRGED* |
| Ga0070744_100248026 | 3300006484 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRGED* |
| Ga0098048_12139862 | 3300006752 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRTEAD* |
| Ga0098048_12506783 | 3300006752 | Marine | MITDNTTENDLVAETIEELGQSLTELQQVIADIKEQVNYRTE |
| Ga0098054_10301917 | 3300006789 | Marine | MITDNTTDNDLLAETIEELGQSLTELQQVIADIKEQVNYRTEVD* |
| Ga0070749_102977474 | 3300006802 | Aqueous | MITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGEEN* |
| Ga0075467_103827174 | 3300006803 | Aqueous | TENDLLAETIEELGQSLTELQQVINDIKEQVNYRGED* |
| Ga0075467_105100552 | 3300006803 | Aqueous | MITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYREES* |
| Ga0075467_106141162 | 3300006803 | Aqueous | MITDNTTENDLLAETIDELGQSLTELQQVINDIKEQVNYRGED* |
| Ga0070754_101997712 | 3300006810 | Aqueous | MITDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYRGED* |
| Ga0070746_102324373 | 3300006919 | Aqueous | MITDNTAENDLLAETIEELGQSLTELQQVIADIKEQVNYREESE* |
| Ga0070748_12856782 | 3300006920 | Aqueous | MITDNSAENDLLAETIDELGQSLTELQQVINDIKEQVNYRGED* |
| Ga0075468_101773074 | 3300007229 | Aqueous | MITDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYR |
| Ga0075468_102084511 | 3300007229 | Aqueous | CSTLKNGRYILMITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEETA* |
| Ga0070747_12696212 | 3300007276 | Aqueous | MITDNSKENDLLAETIEELGQSLTELQQVINDIKAQVNYRGEEN* |
| Ga0099847_100663811 | 3300007540 | Aqueous | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRPEEN* |
| Ga0099847_12061973 | 3300007540 | Aqueous | RRRDKMITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED* |
| Ga0102823_11036311 | 3300007692 | Estuarine | TTENDLLAETIEELGQSLTELQQVIADIKEQVNYRGEDRQ* |
| Ga0105737_11283432 | 3300007862 | Estuary Water | SSEEKMITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRGED* |
| Ga0102810_10064878 | 3300009002 | Estuarine | MITDNTTENDLLAETIAELGQSLTELQQVIADIKEQVNYRPEGE* |
| Ga0102813_10327246 | 3300009003 | Estuarine | MITDNTAENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREED* |
| Ga0102813_12935542 | 3300009003 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQLVINDIKEQVN |
| Ga0102811_12407393 | 3300009024 | Estuarine | KKMITDNTTENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREED* |
| Ga0102829_10570064 | 3300009026 | Estuarine | MITDNTTENDLLAETIDELGQSLTELQQVIADIKEQVNYRPEGE* |
| Ga0102826_10802331 | 3300009054 | Estuarine | GKEAMITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRGEDRQ* |
| Ga0102826_11499942 | 3300009054 | Estuarine | MIIDNSTENDLLVETIDELGQSLTELQQVIADIKQQVNYREED* |
| Ga0115549_10466446 | 3300009074 | Pelagic Marine | MITDNTTENDLLAETIDELGQSLTELQQVIADIKEQVNYRGED* |
| Ga0115549_10838612 | 3300009074 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQLVIADIKEQVNYRTEDTQ* |
| Ga0115549_11327482 | 3300009074 | Pelagic Marine | MITDNSKENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREEDT* |
| Ga0115549_12317072 | 3300009074 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVIAGIKQQVNYRPEETE* |
| Ga0115550_10827233 | 3300009076 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEGN* |
| Ga0115550_11052832 | 3300009076 | Pelagic Marine | MITDNTTENDLLAETIDELGQSLTELQQVINDIKEQVNYRPEETA* |
| Ga0115550_11135302 | 3300009076 | Pelagic Marine | MITDNSKENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREEDTQ* |
| Ga0115550_12049931 | 3300009076 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLSELQQVIADIKEHVNYREES* |
| Ga0115550_12420891 | 3300009076 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQLVIADIKEQVNYRTEDN* |
| Ga0102815_103710161 | 3300009080 | Estuarine | EGGGMITDNTAENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREED* |
| Ga0115548_10689875 | 3300009423 | Pelagic Marine | MITDSTKENDLLAETIDELGQSLTELQQVIADIKQQVNYRGED* |
| Ga0115548_10951584 | 3300009423 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEEAA* |
| Ga0115548_12039971 | 3300009423 | Pelagic Marine | LKRKRRRDKMITDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYREES* |
| Ga0115547_10860174 | 3300009426 | Pelagic Marine | MITDNTTENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREEDT* |
| Ga0115547_10914054 | 3300009426 | Pelagic Marine | MITDNSKENDLLAEAIEGLGQSLTELQQIIDNLKIEVNYREEDT* |
| Ga0115547_11200382 | 3300009426 | Pelagic Marine | MITDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYREES* |
| Ga0115547_11729583 | 3300009426 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRGED* |
| Ga0115547_12902571 | 3300009426 | Pelagic Marine | KRRRSKMITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEETA* |
| Ga0115562_10157059 | 3300009434 | Pelagic Marine | MIIDNSTENDLLAETIDELGQSLTELAQVIADIKQQVNYREEDT* |
| Ga0115562_10209901 | 3300009434 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYR |
| Ga0115562_11534531 | 3300009434 | Pelagic Marine | ITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED* |
| Ga0115559_10455981 | 3300009438 | Pelagic Marine | MIIDNSTENDLLSETIDELGQSLSELQQVIADIKQQVNYRGED* |
| Ga0115559_11426172 | 3300009438 | Pelagic Marine | MIIDNSTENDLLAETIDELGQSLSELQQVIADIKQQVNYRGED* |
| Ga0115563_11411672 | 3300009442 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVIAEIKEQVNHREES* |
| Ga0115572_100077226 | 3300009507 | Pelagic Marine | MITDNTTENALLAETIEELGQSLTELQLVIADIKEQVNYRTEDTQ* |
| Ga0115572_101825031 | 3300009507 | Pelagic Marine | MITDNTTENDLLAETIDELGQSLTELQQVIADIKQQVNYRE |
| Ga0098049_10901401 | 3300010149 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRTEVD* |
| Ga0098056_10600811 | 3300010150 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRT |
| Ga0129324_102541783 | 3300010368 | Freshwater To Marine Saline Gradient | MITDNTAENDLLAETIEELGQSLTELQQVINDIKQQVNYREES* |
| Ga0129324_102789052 | 3300010368 | Freshwater To Marine Saline Gradient | MITDNTTENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREED* |
| Ga0129324_103811591 | 3300010368 | Freshwater To Marine Saline Gradient | KRKRRRDKMITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED* |
| Ga0118731_1121388853 | 3300010392 | Marine | MITDNTTENDLLGEVIEGLGQSLTELQQIIDNLKIEVNYREEETQ* |
| Ga0118733_1050215872 | 3300010430 | Marine Sediment | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGEEN* |
| Ga0151669_1099315 | 3300011128 | Marine | MITDNTTENNLLEKTIEGLGQSLTELQQIIDNLKIGVNYVEDGETE* |
| Ga0151671_10106471 | 3300011253 | Marine | MITDNTTENDLLAETIDELGQSLTELQQVINDIKEQVNYRPE |
| Ga0129327_102813103 | 3300013010 | Freshwater To Marine Saline Gradient | MITDNSTENDLLAETIDELGQSLTELAQVIADIKQQVNYREES* |
| Ga0180120_104214751 | 3300017697 | Freshwater To Marine Saline Gradient | ITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGEEN |
| Ga0181377_10050214 | 3300017706 | Marine | MITDNTTENDLLAEAIEGLGQSLTELQQIIDNLKIEVNYREEGEQ |
| Ga0181377_10095113 | 3300017706 | Marine | MITDNSKENDLLAETIEGLGQSLTELQQIIDNLKIGVNYVEEED |
| Ga0181377_10241393 | 3300017706 | Marine | MITDNTAENNLLAETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0181377_10350455 | 3300017706 | Marine | MITDNTKENDLLAETIDELGQSLTELQQVIADIKQQVNY |
| Ga0181377_10439811 | 3300017706 | Marine | EMITDNTKENDLLAETIDELGQSLTELQQVIADIKQQVNYRPEGEQXLYGR |
| Ga0181387_11177763 | 3300017709 | Seawater | MVVDNSTENDLLAETIDELGQSLTELQQVIADIKEQVNYRPEEN |
| Ga0181391_10722853 | 3300017713 | Seawater | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYIEED |
| Ga0181390_10188482 | 3300017719 | Seawater | MITDNTAENNLLAETIDELGQSLTELQQVIADIKEQVNYIEED |
| Ga0181388_100182511 | 3300017724 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0181388_10067607 | 3300017724 | Seawater | MITDNTAENDLLAEAIEGLGQSLTELQQIIDNLKIEVNYREEGEQ |
| Ga0181388_10290726 | 3300017724 | Seawater | MVVDNSTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEEN |
| Ga0181419_10248747 | 3300017728 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVIADIKEQVNYRPEGEQ |
| Ga0181399_10447422 | 3300017742 | Seawater | MITDNTKENDLLAETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0181402_10187325 | 3300017743 | Seawater | MITDNTAENDLLAETIDELGQSLTELQQVIADIKEQVNYRPEGE |
| Ga0181389_10741291 | 3300017746 | Seawater | TTENDLLAETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0181389_11661202 | 3300017746 | Seawater | MVVDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYRPEEN |
| Ga0181393_11772141 | 3300017748 | Seawater | KMITDNTTENDLLAETIDELGQSLTELQQVIADIKEQVNYRGED |
| Ga0181392_11004842 | 3300017749 | Seawater | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRTEVN |
| Ga0181407_10867384 | 3300017753 | Seawater | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRPEGE |
| Ga0181430_11924703 | 3300017772 | Seawater | DNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0181424_103019303 | 3300017786 | Seawater | ITDNTTENDLLAEAIEGLGQSLTELQQIIDNLKIEVNYREED |
| Ga0188867_10001933 | 3300018642 | Freshwater Lake | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEHVNYRTEDN |
| Ga0188867_10032023 | 3300018642 | Freshwater Lake | MITDNTTENDLLAETIEELGQSLTELQLVIADIKEQVNYREES |
| Ga0206125_100103905 | 3300020165 | Seawater | MITDNTTENDLLAETIEGLGQSLTELQQIIDNLKIGVNYVEEREES |
| Ga0206125_100108598 | 3300020165 | Seawater | MITDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYREES |
| Ga0206125_100753525 | 3300020165 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVIADIKQQVNYREES |
| Ga0206125_102234693 | 3300020165 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVINDIKEQVNYRPEETA |
| Ga0206125_102575452 | 3300020165 | Seawater | MITDNSKENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREEDT |
| Ga0206125_103521722 | 3300020165 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVIADIKEQVNYRGED |
| Ga0206128_11413213 | 3300020166 | Seawater | MITDNTTENDLLAETIEELGQSLTELQLVIADIKEQVNYRTEDTQ |
| Ga0206127_11961333 | 3300020169 | Seawater | CSTLKNGRYILMITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEGN |
| Ga0206127_12730233 | 3300020169 | Seawater | MITDNSKENDLLAETIEGLGQSLTELQQIIDNLKIEVNYR |
| Ga0206127_12840651 | 3300020169 | Seawater | LKNGRYILMITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEDTQ |
| Ga0206126_103552201 | 3300020595 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVINDIKEQVNYRPEDTQ |
| Ga0213865_101672643 | 3300021373 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVINDIKQQVNYRPENTQ |
| Ga0213869_100130533 | 3300021375 | Seawater | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRPEEN |
| Ga0212030_10381582 | 3300022053 | Aqueous | MITDNSTENDLLAETIDELGQSLTELAQVIADIKQQVNYREES |
| Ga0212030_10395363 | 3300022053 | Aqueous | MITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYREES |
| Ga0212030_10454302 | 3300022053 | Aqueous | MITDNTTENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREED |
| Ga0212030_10606901 | 3300022053 | Aqueous | MITDNSKENDLLAETIEELGQSLTELQQVINDIKAQVNYRGEEN |
| Ga0212023_10372433 | 3300022061 | Aqueous | MITDNSTENDLLAETIEELGQSLTELAQVIADIKQQVNYREES |
| Ga0196889_10128696 | 3300022072 | Aqueous | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED |
| Ga0196889_10195921 | 3300022072 | Aqueous | MITDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYREE |
| Ga0224906_10175978 | 3300022074 | Seawater | MITDNTTENDLLAETIDELGQSLTELQQVIADIKQQVNYRGED |
| Ga0212022_10789331 | 3300022164 | Aqueous | MITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED |
| Ga0196887_10570423 | 3300022178 | Aqueous | MITDNTAENDLLAETIEELGQSLTELQQVINDIKQQVNYREES |
| Ga0224502_100006718 | 3300022218 | Sediment | MIIDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0224504_104402131 | 3300022308 | Sediment | MITDNTTENDLLAETIEELGQSLTELQLVINDIKEQVNYRTEDN |
| (restricted) Ga0255040_100410893 | 3300024059 | Seawater | MITDNSAENDLLAEIIDELGQSLTELAQIIADIKQQVNYRED |
| (restricted) Ga0255040_102190252 | 3300024059 | Seawater | MITDNTAENDLLAETIEELGQSLTELQQVIADIKEQVNYRGEEN |
| (restricted) Ga0233444_103792452 | 3300024264 | Seawater | MIIDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED |
| (restricted) Ga0255042_102128972 | 3300024340 | Seawater | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYREED |
| Ga0244775_100880196 | 3300024346 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRGED |
| Ga0244775_101517242 | 3300024346 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQLVINDIKEQVNYREED |
| Ga0244775_101655736 | 3300024346 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRGEDRQ |
| Ga0244775_101915265 | 3300024346 | Estuarine | MITDNTAENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREED |
| Ga0244775_102776443 | 3300024346 | Estuarine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRTEVD |
| Ga0244775_103838433 | 3300024346 | Estuarine | MITDNTTENDLLAETIDELGQSLTELQQVIADIKEQVNYRPEGE |
| Ga0208791_10469121 | 3300025083 | Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYRTEV |
| Ga0208148_10376445 | 3300025508 | Aqueous | MITDNSTENDLLAETIEELGQSLTELQQVINDIKEQVNYRGED |
| Ga0208148_10992111 | 3300025508 | Aqueous | MITDNSAENDLLAETIDELGQSLTELQQVINDIKEQVN |
| Ga0208303_10213775 | 3300025543 | Aqueous | MITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGEEN |
| Ga0208303_10730993 | 3300025543 | Aqueous | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYKEED |
| Ga0209304_100285212 | 3300025577 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKQQVNYREES |
| Ga0209304_10381324 | 3300025577 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRGED |
| Ga0209304_10422835 | 3300025577 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEEAA |
| Ga0209304_10584601 | 3300025577 | Pelagic Marine | MITDNSKENDLLAETIEGLGQSLTELQQIIDNLKIEVNYREEDTQ |
| Ga0209405_10313422 | 3300025620 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNYREES |
| Ga0209405_10853203 | 3300025620 | Pelagic Marine | MIIDNSTENDLLAETIDELGQSLSELQQVIADIKEQVNYREES |
| Ga0209405_11292792 | 3300025620 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEETA |
| Ga0209504_10285598 | 3300025621 | Pelagic Marine | LLAETIEGLGQSLTELQQIIDNLKIEVNYREEDTQ |
| Ga0209504_10880192 | 3300025621 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEGN |
| Ga0209504_11223762 | 3300025621 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLSELQQVIADIKEHVNYREES |
| Ga0209197_10026227 | 3300025637 | Pelagic Marine | MIIDNSTENDLLAETIDELGQSLSELQQVIADIKQQVNYREEDT |
| Ga0209198_10538752 | 3300025640 | Pelagic Marine | MIIDNSTENDLLAETIDELGQSLSELQQVIADIKQQVNYRGED |
| Ga0209198_11152971 | 3300025640 | Pelagic Marine | MITDNTTENDLLAETIDELGQSLTELAQVIADIKQQVNYREEDT |
| Ga0208643_100352613 | 3300025645 | Aqueous | MITDNTTENDLLAETIDELGQSLTELQQVIADIKQQVNYRGE |
| Ga0208643_10221281 | 3300025645 | Aqueous | NSTENDLLAETIEELGQSLTELQQVINDIKEQVNYRGED |
| Ga0208643_11599182 | 3300025645 | Aqueous | MITDNSAENDLLAETIDELGQSLTELQQVINDIKEQVNYRGED |
| Ga0209196_10030707 | 3300025654 | Pelagic Marine | MIIDNSTENDLLAETIDELGQSLTELAQVIADIKQQVNYREEDT |
| Ga0208545_10370846 | 3300025806 | Aqueous | MITDNTTENDLLAETIEELGQSLTELQQVIAGIKQQVNYRPEETE |
| Ga0209533_10464724 | 3300025874 | Pelagic Marine | MITDNTTENDLLAETIEGLGQSLTELQQIIDNLKIGVNYVEDGETE |
| Ga0209533_13032793 | 3300025874 | Pelagic Marine | MITDNTTENDLLAETIEELGQSLTELQQVIADIKEQVNY |
| Ga0209456_104319992 | 3300025883 | Pelagic Marine | MITDNSTENDLLAETIEELGQSLTELQQVINDIKEQVNYRPEETA |
| Ga0208544_102428233 | 3300025887 | Aqueous | RRDKMITDNSTENDLLAETIEELGQSLTELQQVIADIKQQVNYRGED |
| Ga0208021_10465011 | 3300027191 | Estuarine | MIIDNSTENDLLVETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0256368_10083562 | 3300028125 | Sea-Ice Brine | MITDNSTENDLLAETIDELGQSLTELAQVIADIKQQVNYRED |
| Ga0315332_106087241 | 3300031773 | Seawater | MITDRTKENDLLAETIDELGQSLTELQQVIADIKQQVNYREED |
| Ga0316201_103791001 | 3300032136 | Worm Burrow | MITDNSTENDLLAETIDELGQSLTELQQVIADIKQQVNYRGED |
| ⦗Top⦘ |