Basic Information | |
---|---|
Family ID | F033427 |
Family Type | Metagenome |
Number of Sequences | 177 |
Average Sequence Length | 40 residues |
Representative Sequence | MSDPILGTFHDAETGETITRELTPEEIAALPEPSEPIE |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 177 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 77.40 % |
% of genes near scaffold ends (potentially truncated) | 21.47 % |
% of genes from short scaffolds (< 2000 bps) | 70.62 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (48.588 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (26.554 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.198 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.893 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.58% β-sheet: 18.18% Coil/Unstructured: 74.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 177 Family Scaffolds |
---|---|---|
PF00535 | Glycos_transf_2 | 1.69 |
PF04586 | Peptidase_S78 | 1.69 |
PF08774 | VRR_NUC | 1.13 |
PF04404 | ERF | 1.13 |
PF05065 | Phage_capsid | 1.13 |
PF03354 | TerL_ATPase | 0.56 |
PF07460 | NUMOD3 | 0.56 |
PF01555 | N6_N4_Mtase | 0.56 |
PF13884 | Peptidase_S74 | 0.56 |
PF13704 | Glyco_tranf_2_4 | 0.56 |
PF07691 | PA14 | 0.56 |
PF01844 | HNH | 0.56 |
COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
---|---|---|---|
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.69 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.13 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.56 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.56 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.97 % |
Unclassified | root | N/A | 35.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003499|JGI25930J51415_1067655 | Not Available | 599 | Open in IMG/M |
3300005581|Ga0049081_10016456 | All Organisms → Viruses → Predicted Viral | 2795 | Open in IMG/M |
3300005581|Ga0049081_10039436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1794 | Open in IMG/M |
3300005581|Ga0049081_10345080 | Not Available | 506 | Open in IMG/M |
3300005664|Ga0073685_1030248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1573 | Open in IMG/M |
3300005805|Ga0079957_1119993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1392 | Open in IMG/M |
3300006030|Ga0075470_10002543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5683 | Open in IMG/M |
3300006030|Ga0075470_10003449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4924 | Open in IMG/M |
3300006030|Ga0075470_10009922 | Not Available | 2931 | Open in IMG/M |
3300006030|Ga0075470_10051438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
3300006030|Ga0075470_10082559 | Not Available | 970 | Open in IMG/M |
3300006030|Ga0075470_10087492 | Not Available | 938 | Open in IMG/M |
3300006030|Ga0075470_10087493 | Not Available | 938 | Open in IMG/M |
3300006030|Ga0075470_10161121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300006030|Ga0075470_10201062 | Not Available | 570 | Open in IMG/M |
3300006484|Ga0070744_10049105 | Not Available | 1239 | Open in IMG/M |
3300006641|Ga0075471_10026750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3361 | Open in IMG/M |
3300006641|Ga0075471_10065267 | Not Available | 2000 | Open in IMG/M |
3300006641|Ga0075471_10182120 | Not Available | 1100 | Open in IMG/M |
3300006802|Ga0070749_10033905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3166 | Open in IMG/M |
3300006802|Ga0070749_10104144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1676 | Open in IMG/M |
3300006802|Ga0070749_10131488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
3300006802|Ga0070749_10198867 | Not Available | 1149 | Open in IMG/M |
3300006802|Ga0070749_10219298 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
3300006802|Ga0070749_10222488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
3300006802|Ga0070749_10445056 | Not Available | 710 | Open in IMG/M |
3300006802|Ga0070749_10495967 | Not Available | 665 | Open in IMG/M |
3300006805|Ga0075464_10010916 | All Organisms → Viruses → Predicted Viral | 4471 | Open in IMG/M |
3300006805|Ga0075464_10301630 | Not Available | 964 | Open in IMG/M |
3300006805|Ga0075464_10361176 | Not Available | 879 | Open in IMG/M |
3300006805|Ga0075464_10768414 | Not Available | 598 | Open in IMG/M |
3300006875|Ga0075473_10004153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5814 | Open in IMG/M |
3300006917|Ga0075472_10141464 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
3300006917|Ga0075472_10215687 | Not Available | 944 | Open in IMG/M |
3300006917|Ga0075472_10215688 | Not Available | 944 | Open in IMG/M |
3300006917|Ga0075472_10318931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300006920|Ga0070748_1255913 | Not Available | 629 | Open in IMG/M |
3300007169|Ga0102976_1111381 | All Organisms → Viruses → Predicted Viral | 1571 | Open in IMG/M |
3300007541|Ga0099848_1078367 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
3300007559|Ga0102828_1022262 | Not Available | 1386 | Open in IMG/M |
3300007647|Ga0102855_1052580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
3300007708|Ga0102859_1057206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
3300007735|Ga0104988_10357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13940 | Open in IMG/M |
3300008055|Ga0108970_10574310 | Not Available | 628 | Open in IMG/M |
3300008117|Ga0114351_1088643 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
3300008117|Ga0114351_1220987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
3300008266|Ga0114363_1006719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5730 | Open in IMG/M |
3300008450|Ga0114880_1000734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20169 | Open in IMG/M |
3300008450|Ga0114880_1095259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1161 | Open in IMG/M |
3300009152|Ga0114980_10060082 | All Organisms → Viruses → Predicted Viral | 2295 | Open in IMG/M |
3300009155|Ga0114968_10238614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1038 | Open in IMG/M |
3300009158|Ga0114977_10440367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300009159|Ga0114978_10082737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2146 | Open in IMG/M |
3300009159|Ga0114978_10203947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
3300009163|Ga0114970_10060004 | All Organisms → Viruses → Predicted Viral | 2431 | Open in IMG/M |
3300009165|Ga0105102_10590198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300009181|Ga0114969_10103587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1830 | Open in IMG/M |
3300009181|Ga0114969_10654598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300010354|Ga0129333_10323032 | Not Available | 1377 | Open in IMG/M |
3300010354|Ga0129333_10496616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
3300010354|Ga0129333_10607352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 949 | Open in IMG/M |
3300010370|Ga0129336_10020991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3964 | Open in IMG/M |
3300010885|Ga0133913_10601751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2886 | Open in IMG/M |
3300010885|Ga0133913_10852964 | Not Available | 2369 | Open in IMG/M |
3300010885|Ga0133913_12204593 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
3300010885|Ga0133913_12227416 | Not Available | 1350 | Open in IMG/M |
3300011334|Ga0153697_1536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11055 | Open in IMG/M |
3300011336|Ga0153703_1688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10682 | Open in IMG/M |
3300011338|Ga0153699_1642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13418 | Open in IMG/M |
3300013004|Ga0164293_10062153 | All Organisms → Viruses → Predicted Viral | 2967 | Open in IMG/M |
3300013005|Ga0164292_10553828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
3300013372|Ga0177922_10204320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1442 | Open in IMG/M |
3300013372|Ga0177922_10299248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300017707|Ga0181363_1040960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300017707|Ga0181363_1061872 | Not Available | 656 | Open in IMG/M |
3300017707|Ga0181363_1063260 | Not Available | 647 | Open in IMG/M |
3300017707|Ga0181363_1085968 | Not Available | 535 | Open in IMG/M |
3300017747|Ga0181352_1004942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4550 | Open in IMG/M |
3300017747|Ga0181352_1044109 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
3300017747|Ga0181352_1045505 | Not Available | 1289 | Open in IMG/M |
3300017747|Ga0181352_1124701 | Not Available | 692 | Open in IMG/M |
3300017747|Ga0181352_1149586 | Not Available | 618 | Open in IMG/M |
3300017777|Ga0181357_1013618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3239 | Open in IMG/M |
3300017778|Ga0181349_1253180 | Not Available | 587 | Open in IMG/M |
3300017784|Ga0181348_1297850 | Not Available | 541 | Open in IMG/M |
3300017785|Ga0181355_1018277 | Not Available | 3066 | Open in IMG/M |
3300017785|Ga0181355_1050227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1773 | Open in IMG/M |
3300017785|Ga0181355_1197590 | Not Available | 792 | Open in IMG/M |
3300017785|Ga0181355_1380042 | Not Available | 514 | Open in IMG/M |
3300019784|Ga0181359_1047609 | Not Available | 1656 | Open in IMG/M |
3300019784|Ga0181359_1112770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
3300019784|Ga0181359_1215515 | Not Available | 608 | Open in IMG/M |
3300020205|Ga0211731_10495485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300020205|Ga0211731_10916387 | Not Available | 647 | Open in IMG/M |
3300020205|Ga0211731_10971459 | All Organisms → Viruses → Predicted Viral | 2145 | Open in IMG/M |
3300021438|Ga0213920_1011252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2597 | Open in IMG/M |
3300021438|Ga0213920_1096063 | Not Available | 567 | Open in IMG/M |
3300021956|Ga0213922_1025399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
3300021956|Ga0213922_1032041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300021956|Ga0213922_1036856 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
3300021961|Ga0222714_10212830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
3300021962|Ga0222713_10244703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
3300021962|Ga0222713_10599221 | Not Available | 643 | Open in IMG/M |
3300021963|Ga0222712_10159036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1516 | Open in IMG/M |
3300021963|Ga0222712_10385623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300021963|Ga0222712_10531882 | Not Available | 690 | Open in IMG/M |
3300022179|Ga0181353_1009393 | Not Available | 2429 | Open in IMG/M |
3300022179|Ga0181353_1014268 | All Organisms → Viruses → Predicted Viral | 2046 | Open in IMG/M |
3300022179|Ga0181353_1059589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300022179|Ga0181353_1084096 | Not Available | 800 | Open in IMG/M |
3300022179|Ga0181353_1086179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300022179|Ga0181353_1088108 | Not Available | 776 | Open in IMG/M |
3300022179|Ga0181353_1142879 | Not Available | 556 | Open in IMG/M |
3300022190|Ga0181354_1098881 | Not Available | 952 | Open in IMG/M |
3300022407|Ga0181351_1068744 | All Organisms → Viruses → Predicted Viral | 1439 | Open in IMG/M |
3300022407|Ga0181351_1154722 | Not Available | 820 | Open in IMG/M |
3300022747|Ga0228703_1001308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15443 | Open in IMG/M |
3300022748|Ga0228702_1102989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300023184|Ga0214919_10001927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33283 | Open in IMG/M |
3300023184|Ga0214919_10005479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18001 | Open in IMG/M |
3300023184|Ga0214919_10136930 | Not Available | 1976 | Open in IMG/M |
3300023184|Ga0214919_10444498 | Not Available | 821 | Open in IMG/M |
3300024298|Ga0255178_1023263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1283 | Open in IMG/M |
3300025585|Ga0208546_1001268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7961 | Open in IMG/M |
3300025585|Ga0208546_1002449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5508 | Open in IMG/M |
3300025585|Ga0208546_1004309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4050 | Open in IMG/M |
3300025585|Ga0208546_1050343 | Not Available | 990 | Open in IMG/M |
3300025585|Ga0208546_1053546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
3300025585|Ga0208546_1053547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
3300025635|Ga0208147_1012472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. BK022 | 2337 | Open in IMG/M |
3300025732|Ga0208784_1004141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5452 | Open in IMG/M |
3300025732|Ga0208784_1009240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3383 | Open in IMG/M |
3300025848|Ga0208005_1011321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2723 | Open in IMG/M |
3300025889|Ga0208644_1141133 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
3300025889|Ga0208644_1148376 | Not Available | 1079 | Open in IMG/M |
3300025889|Ga0208644_1246727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300025889|Ga0208644_1300219 | Not Available | 638 | Open in IMG/M |
3300025889|Ga0208644_1327339 | Not Available | 596 | Open in IMG/M |
3300025896|Ga0208916_10379873 | Not Available | 616 | Open in IMG/M |
3300027138|Ga0255064_1026938 | Not Available | 965 | Open in IMG/M |
3300027193|Ga0208800_1026301 | Not Available | 776 | Open in IMG/M |
3300027608|Ga0208974_1094529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → Dongia mobilis | 803 | Open in IMG/M |
3300027754|Ga0209596_1036026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2731 | Open in IMG/M |
3300027759|Ga0209296_1019165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3926 | Open in IMG/M |
3300027759|Ga0209296_1080701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1603 | Open in IMG/M |
3300027782|Ga0209500_10117587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1292 | Open in IMG/M |
3300027804|Ga0209358_10159672 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
3300027808|Ga0209354_10289942 | Not Available | 652 | Open in IMG/M |
3300028025|Ga0247723_1097618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300029930|Ga0119944_1006953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1780 | Open in IMG/M |
3300031758|Ga0315907_10562184 | Not Available | 891 | Open in IMG/M |
3300031857|Ga0315909_10006119 | All Organisms → cellular organisms → Bacteria | 13661 | Open in IMG/M |
3300031857|Ga0315909_10031450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5142 | Open in IMG/M |
3300031857|Ga0315909_10119696 | All Organisms → Viruses → Predicted Viral | 2229 | Open in IMG/M |
3300031857|Ga0315909_10308829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
3300031857|Ga0315909_10463794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300031857|Ga0315909_10503652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300032050|Ga0315906_10730288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300033233|Ga0334722_10088056 | All Organisms → Viruses → Predicted Viral | 2372 | Open in IMG/M |
3300033482|Ga0316627_102405131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493 | 554 | Open in IMG/M |
3300033978|Ga0334977_0001204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15168 | Open in IMG/M |
3300033978|Ga0334977_0019795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3842 | Open in IMG/M |
3300033996|Ga0334979_0375371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300034021|Ga0335004_0185076 | Not Available | 1312 | Open in IMG/M |
3300034061|Ga0334987_0042185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3866 | Open in IMG/M |
3300034064|Ga0335001_0005904 | All Organisms → cellular organisms → Bacteria | 7320 | Open in IMG/M |
3300034073|Ga0310130_0044654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 1334 | Open in IMG/M |
3300034082|Ga0335020_0001785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14927 | Open in IMG/M |
3300034082|Ga0335020_0006731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7191 | Open in IMG/M |
3300034082|Ga0335020_0619529 | Not Available | 505 | Open in IMG/M |
3300034093|Ga0335012_0129084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1393 | Open in IMG/M |
3300034096|Ga0335025_0020202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4628 | Open in IMG/M |
3300034101|Ga0335027_0150438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1709 | Open in IMG/M |
3300034103|Ga0335030_0187354 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
3300034104|Ga0335031_0597627 | Not Available | 652 | Open in IMG/M |
3300034106|Ga0335036_0223941 | All Organisms → Viruses → Predicted Viral | 1289 | Open in IMG/M |
3300034106|Ga0335036_0314841 | Not Available | 1035 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 26.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.43% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.04% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.52% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 3.95% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.39% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.39% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.26% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.26% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.26% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.69% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.69% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.13% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.56% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.56% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.56% |
Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.56% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.56% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.56% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.56% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300011338 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25930J51415_10676551 | 3300003499 | Freshwater Lake | MGDMKEPMLEVVYDAETGETITRELTPEEIAALPEPSEPIE* |
Ga0049081_100164562 | 3300005581 | Freshwater Lentic | MSNTEPFMGTWHDCLTGETITRELTPEEIAALPEPAPPLGE* |
Ga0049081_100394365 | 3300005581 | Freshwater Lentic | MSDPIIGTFHDAATGETITRELTAEEIAALPEPTEPLE* |
Ga0049081_103450801 | 3300005581 | Freshwater Lentic | MEPLLGTFHDALTGETITRELTAEEIAALPEPTPPLGE* |
Ga0073685_10302482 | 3300005664 | Aquatic | MSNTEPLLGTFHDAITGETITRELTAEEIAALPAPAEPLEP* |
Ga0079957_11199932 | 3300005805 | Lake | VSNPILGTFHDAATGETVTRELTPEEIAALPEPSDDPAKPQ* |
Ga0075470_100025433 | 3300006030 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEASEPIE* |
Ga0075470_100034496 | 3300006030 | Aqueous | MTMSDPILGTFHDAETGETITRELTAEEIAALPEPAEPLITE* |
Ga0075470_100099226 | 3300006030 | Aqueous | MDNPRIEMFHNAETGETVTRELTPEEIAALPTPSETPNDAPEPL* |
Ga0075470_100514382 | 3300006030 | Aqueous | MSDPIVGTFHDAETGETITRKLTAEELAVIQTPENPNLPTE* |
Ga0075470_100825591 | 3300006030 | Aqueous | MNEYTCTIHDAETGETVTRELTAEEIAALPEPGEPLITE* |
Ga0075470_100874924 | 3300006030 | Aqueous | VRIPKGLAMSDPILGTFHDAETGETITRELTPEEIAALPAPTETPE* |
Ga0075470_100874934 | 3300006030 | Aqueous | VRIPKGLAMSDPILGTFHDAETGETITRELTPEEIAALPEPTESPE* |
Ga0075470_101611212 | 3300006030 | Aqueous | MSDPVIGTFHDAETGETITRKLTAEELAVIQTPENPNLPTK* |
Ga0075470_102010621 | 3300006030 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEPTESPE* |
Ga0070744_100491052 | 3300006484 | Estuarine | MEPLLGTFHDAITGETITRELTAEEVAALPEPTEPLE* |
Ga0075471_100267501 | 3300006641 | Aqueous | MTMSDPILGTFHDAETGETITRELTAEEIAALPEPGEPLITE* |
Ga0075471_100652672 | 3300006641 | Aqueous | MSDPIIGTFHDARTGQTITRELTPEEIAALPEPTEPLEPE* |
Ga0075471_101821204 | 3300006641 | Aqueous | GLAMSDPILGTFHDAETGETITRELTPEEIAALPEPTETPNDAPEPV* |
Ga0070749_100339052 | 3300006802 | Aqueous | MSDLIIGTFHDAETGETITRELTPEEIAALPETTDDNSEPH* |
Ga0070749_101041445 | 3300006802 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEANNDTPEPL* |
Ga0070749_101314883 | 3300006802 | Aqueous | MSDPMLITIHDAETGETIIRELTPEEIASVVEPYEPVIE* |
Ga0070749_101988674 | 3300006802 | Aqueous | HRVRIPKGLTMSDPILGTFHDAETGETITRELTPEEIAALPEPTESPE* |
Ga0070749_102192981 | 3300006802 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEASN |
Ga0070749_102224882 | 3300006802 | Aqueous | MPDPILGTFHDAATGETVTRELTPDEIAALPEPSDDPAEPK* |
Ga0070749_104450562 | 3300006802 | Aqueous | MEPILGTFHDAETGETITRELTPEEIAALPEATNDTPEP |
Ga0070749_104959671 | 3300006802 | Aqueous | MSDPITGTFHDAETGETITRELTPEEIAALPETTDDNSEPH* |
Ga0075464_1001091612 | 3300006805 | Aqueous | MSNTEPIWTTIHDAITGITITRELTAEEVAALPEPTEPLE* |
Ga0075464_103016302 | 3300006805 | Aqueous | VEPKYGTFHDAETNETITRELTDEEIAALPSATGDLIPE* |
Ga0075464_103611761 | 3300006805 | Aqueous | VTMSDPILGTFHDAETGETITRELTPEEIAALPEPTETPE* |
Ga0075464_107684142 | 3300006805 | Aqueous | MSNTEPIWTTIHDAITGITITRELTPEEVAALPEPTEPLE* |
Ga0075473_100041531 | 3300006875 | Aqueous | RIQKGLAMSDPILGTFHDAETGETITRELTPEEIAALPEASEPIE* |
Ga0075472_101414644 | 3300006917 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEPTETPNDAPEPV* |
Ga0075472_102156871 | 3300006917 | Aqueous | RVRIPKGLAMSDPILGTFHDAETGETITRELTPEEIAALPEPTESPE* |
Ga0075472_102156881 | 3300006917 | Aqueous | RVRIPKGLAMSDPILGTFHDAETGETITRELTPEEIAALPAPTETPE* |
Ga0075472_103189312 | 3300006917 | Aqueous | MSEPLTGTFHDAETGETVTRELTAEEIAALPEPSEPLPE* |
Ga0070748_12559132 | 3300006920 | Aqueous | MTNLKGTFHDAETGETIIRELTAEEIAALNQSPEVVENAE* |
Ga0102976_11113812 | 3300007169 | Freshwater Lake | MEPLTGTFHDAETGETVTRELTAEEIAALPEPSDPLE* |
Ga0099848_10783673 | 3300007541 | Aqueous | MSDPITGTFHDAATGETVTRKLTAEEIAALPEPTAPLT |
Ga0102828_10222622 | 3300007559 | Estuarine | MEPLLGTFHDAITGETITRELTAEEIAALPEPTEPLE* |
Ga0102855_10525803 | 3300007647 | Estuarine | DLPYGTFHDALTGETFTRKLTPEEAALLPEPTEPLE* |
Ga0102859_10572063 | 3300007708 | Estuarine | MEPLLGTFHDAITGETITRELTPEEVAALPEPTEPLQ* |
Ga0104988_1035719 | 3300007735 | Freshwater | MSDPIYGTFHDAATGETITRELTAEEIAALPEPSEPLTGPE* |
Ga0108970_105743101 | 3300008055 | Estuary | MEPRIESFIDVSTGETITRELTAEEIAALPEPTEPLE* |
Ga0114351_10886433 | 3300008117 | Freshwater, Plankton | MSDPIIGTFHDAETGETITRELTPEEIAALPEPSEPIE* |
Ga0114351_12209871 | 3300008117 | Freshwater, Plankton | MSDPRIEIFYNAETGETITRELTPEEIAALPEATNDTSEPQ* |
Ga0114363_10067194 | 3300008266 | Freshwater, Plankton | MSDPLIGTFHDAATGETITRELTAEEIAALPEPTEPLE* |
Ga0114880_100073416 | 3300008450 | Freshwater Lake | MSDPIIGTFHDAATGETITRELTAEEIAALPEPGEALTPAPAD* |
Ga0114880_10952592 | 3300008450 | Freshwater Lake | MSDPIIGTFHDALTGETVTRELTAEEIAALPEPTEPLDSE* |
Ga0114980_100600822 | 3300009152 | Freshwater Lake | MNNLELIIGTFHDALTGETITRELTAEEIACLPESVEPLEPE* |
Ga0114968_102386142 | 3300009155 | Freshwater Lake | MEPLLGTFHDAATGVTVTRELTAEEIAALPEPTLLLRESDAS* |
Ga0114977_104403672 | 3300009158 | Freshwater Lake | MEKKYGTFHDAETGVTVTRELTKEEVAALPKPTDEVALTAD* |
Ga0114978_100827372 | 3300009159 | Freshwater Lake | MEKKYGTFHDAETGVTVTRELTKEEVAALPKPTNEVAPTAD* |
Ga0114978_102039473 | 3300009159 | Freshwater Lake | MEPKYGIFHDAETNETITRELTDEEIAALPSATGDPIPE* |
Ga0114970_100600042 | 3300009163 | Freshwater Lake | MSNTEPKYGTFHDAETGETITRELTGEEVAALPEPIGLLRNN* |
Ga0105102_105901982 | 3300009165 | Freshwater Sediment | MEKIYGTFHDAQTGETIVRELTKKEIEELPESTIED* |
Ga0114969_101035872 | 3300009181 | Freshwater Lake | MSNEQEKKYGQFYDALTGEMTTRELTPEEIAALPKPLPPLAE* |
Ga0114969_106545982 | 3300009181 | Freshwater Lake | MEPLLGTFHDAITGETITRELTADEVAALPEPTPPLGEN* |
Ga0129333_103230323 | 3300010354 | Freshwater To Marine Saline Gradient | MTMSDPILGTFHDAETGETITRELTAEEIAALPELGEPLITE* |
Ga0129333_104966162 | 3300010354 | Freshwater To Marine Saline Gradient | MEPLTGTFHDALTGETVTRELTAEEIAALPEPTEPLGSE* |
Ga0129333_106073523 | 3300010354 | Freshwater To Marine Saline Gradient | MSDPIIGTFHDAATGETVTRELTAEEIAALPEPTEPLDPE* |
Ga0129336_100209916 | 3300010370 | Freshwater To Marine Saline Gradient | MSDPRIEIFYNAETGETITRELTPEEIAALPEASNDTP |
Ga0133913_106017514 | 3300010885 | Freshwater Lake | MEPLKGTFHDAITGETIVRELTEQEIALLPEPTPPLGSPQ* |
Ga0133913_108529645 | 3300010885 | Freshwater Lake | MEPLLGTFHDALTGETTTRELTAEEIAALPEPAPPLGE* |
Ga0133913_122045932 | 3300010885 | Freshwater Lake | MNNLELIIGTFHDAVTGETITRELTAEEIACLPESVEPLEPE* |
Ga0133913_122274162 | 3300010885 | Freshwater Lake | MSNEQEKKYGQFYDALTGEMITRELTPEEIAALLPEPTPPSGDPE* |
Ga0153697_153613 | 3300011334 | Freshwater | MSNHMITIHDAQTGESVTRELTPEEIAELPEAQDALA* |
Ga0153703_168812 | 3300011336 | Freshwater | MSNNEPLMGCFYDHSTGETITRELTAEEIAELSQPSEDAK* |
Ga0153699_164212 | 3300011338 | Freshwater | MEPKHGTFHDAQTGETITRELTAEETEELPEAQDALA* |
Ga0164293_100621532 | 3300013004 | Freshwater | MSNIEPKYGTFHDALTGKTITRELTAEEVAELPEPVEPLGNNQ* |
Ga0164292_105538281 | 3300013005 | Freshwater | SFHDAITGETIVRELTPEEFDAIPKEIITEPLEPE* |
Ga0177922_102043203 | 3300013372 | Freshwater | MSNPILGTFHDAETGETITRELTPEEIAALPEATNDTPEPQ* |
Ga0177922_102992482 | 3300013372 | Freshwater | MEPILGTFHDAITGETITRELTAEEIAALPEPAPPLGE* |
Ga0181363_10409602 | 3300017707 | Freshwater Lake | MSDPIIGTFHDAETGETITRELTPEEIAALPEASNDTPEPQ |
Ga0181363_10618721 | 3300017707 | Freshwater Lake | TEMGDMKEPMLEVVYDAETGETITRELTPEEIAALPEPTESQE |
Ga0181363_10632602 | 3300017707 | Freshwater Lake | MSEPLTGTFHDAETGETITRELTPEEIAALPEPSEPIE |
Ga0181363_10859682 | 3300017707 | Freshwater Lake | MSDPILGTFHDAETGETITRELTPEEIAALPEATNDTPEPQ |
Ga0181352_10049421 | 3300017747 | Freshwater Lake | MSEPTLGTFHDAETGETITRELTPEEIAALPEATNDT |
Ga0181352_10441093 | 3300017747 | Freshwater Lake | MGDMKEPMLEVVYDAETGETITRELTPEEIAALPE |
Ga0181352_10455052 | 3300017747 | Freshwater Lake | MSDPILGTFHDAETGETITRELTPEEIAALPDTTESPE |
Ga0181352_11247011 | 3300017747 | Freshwater Lake | MSDPIFGAFHDAETGETITRELTPEEIAALPEPSEPIE |
Ga0181352_11495861 | 3300017747 | Freshwater Lake | EPMLEVVYDAETGETITRELTPEEIAALPEPTESPE |
Ga0181357_10136186 | 3300017777 | Freshwater Lake | MEPLLGTFHDAITGETITRELTAEEVAALPEPTEPLEPE |
Ga0181349_12531802 | 3300017778 | Freshwater Lake | MEPLLGTFHDAITGETITRELTDEEIAALPEPTEP |
Ga0181348_12978501 | 3300017784 | Freshwater Lake | MEPLLGTFQDAITGETITRELTAEEVAALPESTAPLVPE |
Ga0181355_10182776 | 3300017785 | Freshwater Lake | MEPMIGTFHDAETGETITRELTPEEIAALPEPTESPE |
Ga0181355_10502273 | 3300017785 | Freshwater Lake | MSEPLTGTFHDAETGETITRELTAEEIAALPEASELLPE |
Ga0181355_11975904 | 3300017785 | Freshwater Lake | MEPMIGTFHDAETGETITRELTPEEIAALPEPTETPE |
Ga0181355_13800422 | 3300017785 | Freshwater Lake | MSDPRIEIFYDAETGETITRELTPEEIAALPEPSEPIE |
Ga0181359_10476093 | 3300019784 | Freshwater Lake | MSDPIYGTFHDARTGETVTRELTPEEIAALPERGEPLIPTEPA |
Ga0181359_11127702 | 3300019784 | Freshwater Lake | MEPLLGTFHDALTGETITRELTAEEIAALPEPTPLPAE |
Ga0181359_12155152 | 3300019784 | Freshwater Lake | MEPLLGTFHDALTGETITRELTAEEVAALPEPTEPLQ |
Ga0211731_104954852 | 3300020205 | Freshwater | LWVQAIMSNAEPMWTTIHDALTGETITRELTPEEVAALPEPTEPLGEN |
Ga0211731_109163871 | 3300020205 | Freshwater | MEPLLGTFHDAITGETITRELTPEEVAALPEPTEPLE |
Ga0211731_109714593 | 3300020205 | Freshwater | MEPLLGTFHDAITGETITRELTPEEVAALPEPTEPLT |
Ga0213920_10112524 | 3300021438 | Freshwater | MSDPILGTFHDAETGETITRELTQEEIDALPTSSDSVSE |
Ga0213920_10960632 | 3300021438 | Freshwater | MSDPILGTFHDAETGETITRELTQEEIDALSTSSDSVSE |
Ga0213922_10253993 | 3300021956 | Freshwater | MTDPILGTFHDAETGETITRELTAEEIAALPQPSEPLTPTE |
Ga0213922_10320412 | 3300021956 | Freshwater | MSDPILGTFHDAVTGQTVTRELTAEEIAALPEPGEPLPLANPE |
Ga0213922_10368563 | 3300021956 | Freshwater | MSDPILGTFHDAETGETITRELTQEEIDALPTDSNPLSE |
Ga0222714_102128302 | 3300021961 | Estuarine Water | MNDPIYGTFHDAATGETITRELTPEEIAALPEPTELPTGLE |
Ga0222713_102447033 | 3300021962 | Estuarine Water | MERLYGTFHDAITGETITRELTPEEVAALPEPTEPLE |
Ga0222713_105992211 | 3300021962 | Estuarine Water | MEALYGTFHDAITGETITRELTAEEVAALPEPTEPLE |
Ga0222712_101590363 | 3300021963 | Estuarine Water | MEPLLGTFHDAITGETITRELTAEEVAALPEPTEPLE |
Ga0222712_103856231 | 3300021963 | Estuarine Water | MERLYGTFHDAITGETITRELTAEEVAALPEPTEPLE |
Ga0222712_105318821 | 3300021963 | Estuarine Water | MEPLMITFHDAITGETITRELTPEEVAALPEPTEPLE |
Ga0181353_10093933 | 3300022179 | Freshwater Lake | MSDPILGTFHDAETGETITRELTPEEIAALPEPTESPE |
Ga0181353_10142683 | 3300022179 | Freshwater Lake | MGDMKEPMLEVVYDAETGETITRELTPEEIAALPEPSEPIE |
Ga0181353_10595891 | 3300022179 | Freshwater Lake | MSDPILGTFHDAETGETITRELTPEEIAALPEPSEPIE |
Ga0181353_10840963 | 3300022179 | Freshwater Lake | MSDPIFGAFHDAETGETITRELTPEEIAALPKPSEPIE |
Ga0181353_10861792 | 3300022179 | Freshwater Lake | MSDPIYGTFHDARTGETVTRELTPEEIAALPEPGDSANIPEPE |
Ga0181353_10881082 | 3300022179 | Freshwater Lake | MSDPILGTFHDARTGETITRELTPEEIAALPEPGEPLIPTEPE |
Ga0181353_11428793 | 3300022179 | Freshwater Lake | MKEPMLEVVYDAETGETITRELTPEEIAALPEPTESQE |
Ga0181354_10988812 | 3300022190 | Freshwater Lake | MEPLLGTFHDALTGETITRELTAEEIAALPEPSPPLGE |
Ga0181351_10687443 | 3300022407 | Freshwater Lake | MEPLIGTFHDAITGETITRELTAEEVAALPEPTALPE |
Ga0181351_11547222 | 3300022407 | Freshwater Lake | MEPLLGTFHDAITGETITRELTAEEIAALPEPTEPLQ |
Ga0228703_100130813 | 3300022747 | Freshwater | MTMSDPILGTFHDAETGETVTRELTAEEIAALPESGEPLTLPE |
Ga0228702_11029892 | 3300022748 | Freshwater | MFDPIFITIHDALTGQTVTRELTAEEIAEFPTFGEAPTADPE |
Ga0214919_100019273 | 3300023184 | Freshwater | MEPIFGTFHDALTGETITRELTAEEIAALPEPTEPLTELE |
Ga0214919_1000547930 | 3300023184 | Freshwater | MSNEQEPILGTFHDALTGETITRELTPEEIAALPEPAPPLGE |
Ga0214919_101369302 | 3300023184 | Freshwater | MEPLLGTFHDALTGETITRELTPEEIAALPEPAPPLGE |
Ga0214919_104444983 | 3300023184 | Freshwater | MEPLLGIFHDALTGETIERELTPEEIAALPEAAELSNNA |
Ga0255178_10232632 | 3300024298 | Freshwater | MTVSDPIKAHVHDAATGETYERELTAEEIAALPGPEISEPLE |
Ga0208546_100126810 | 3300025585 | Aqueous | MDNPRIEMFHNAETGETVTRELTPEEIAALPTPSETPNDAPEPL |
Ga0208546_10024493 | 3300025585 | Aqueous | MTMSDPILGTFHDAETGETITRELTAEEIAALPEPAEPLITE |
Ga0208546_10043093 | 3300025585 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEASEPIE |
Ga0208546_10503431 | 3300025585 | Aqueous | HCVRIPKGVTMSDPILGTFHDAETGETITRELTPEEIAALPEPTESPE |
Ga0208546_10535462 | 3300025585 | Aqueous | MSDPIVGTFHDAETGETITRKLTAEELAVIQTPENPNLPTE |
Ga0208546_10535472 | 3300025585 | Aqueous | MSDPVIGTFHDAETGETITRKLTAEELAVIQTPENPNLPTK |
Ga0208147_10124726 | 3300025635 | Aqueous | IPKGLAMSDPILGTFHDAETGETITRELTPEEIAALPAPTETPE |
Ga0208784_10041411 | 3300025732 | Aqueous | RIQKGLAMSDPILGTFHDAETGETITRELTPEEIAALPEASEPIE |
Ga0208784_10092406 | 3300025732 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEPTETPNDAPEPV |
Ga0208005_10113211 | 3300025848 | Aqueous | IQKGLAMSDPILGTFHDAETGETITRELTPEEIAALPEPTETPNDAPEPV |
Ga0208644_11411334 | 3300025889 | Aqueous | HCVRIQKGLAMSDPILGTFHDAETGETITRELTPEEIAALPEASEPIE |
Ga0208644_11483761 | 3300025889 | Aqueous | SDPILGTFHDAETGETITRELTPEEIAALPEPTETPNDAPEPV |
Ga0208644_12467271 | 3300025889 | Aqueous | MSDPILGTFHDAETGETITRELTPEEIAALPEANNDTP |
Ga0208644_13002191 | 3300025889 | Aqueous | DPILGTFHDAETGETITRELTPEEIAALPEPTESPE |
Ga0208644_13273392 | 3300025889 | Aqueous | MSDPITGTFHDAETGETITRELTPEEIAALPETTDDNSEPH |
Ga0208916_103798732 | 3300025896 | Aqueous | MEPILGTFHDAVTGETITRELTPEEIAALPEPAPPLGE |
Ga0255064_10269381 | 3300027138 | Freshwater | MEPKYGTFHDAETGETITRELTAEEIQAIGKPSDALAG |
Ga0208800_10263012 | 3300027193 | Estuarine | MEPLLGTFHDAITGETITRELTAEEVAALPEPTEAPER |
Ga0208974_10945292 | 3300027608 | Freshwater Lentic | MSNTEPFMGTWHDCLTGETITRELTPEEIAALPEPAPPLGE |
Ga0209596_10360267 | 3300027754 | Freshwater Lake | MEPLLGTFHDAATGVTVTRELTAEEIAALPEPTLLLRESDAS |
Ga0209296_10191657 | 3300027759 | Freshwater Lake | MEPKYGIFHDAETNETITRELTDEEIAALPSATGDPIPE |
Ga0209296_10807014 | 3300027759 | Freshwater Lake | MEKKYGTFHDAETGVTVTRELTKEEVAALPKPTNEVAPTAD |
Ga0209500_101175873 | 3300027782 | Freshwater Lake | MEPLLGTFHDAATGVTVTRELTAEEVAALPEPTPPLGSPQ |
Ga0209358_101596723 | 3300027804 | Freshwater Lake | MGDMKEPMLEVVYDAETGETITRELTPEEIAALPEPTESQE |
Ga0209354_102899422 | 3300027808 | Freshwater Lake | MEPLLGTFHDALTGETITRKLTAEEIAALPEPTPLPAE |
Ga0247723_10976182 | 3300028025 | Deep Subsurface Sediment | MEPLLGTFHDAATGVTVTRELTAEEIAALPEPTPLLGISDAS |
Ga0119944_10069533 | 3300029930 | Aquatic | MDWRRSDRVRLSEGLTMSDPILGTFHDAETGETVTRELTAEEIAALPEPGEPLE |
Ga0315907_105621841 | 3300031758 | Freshwater | MSDPIIGTFHDAETGETITRELTPEEIAALPEPSEPIE |
Ga0315909_1000611919 | 3300031857 | Freshwater | MSDPIIGTFHDAATGETITRELTAEEIAALPEPGEALTPAPAD |
Ga0315909_1003145015 | 3300031857 | Freshwater | LPKGLTMSDPIIGTFHDAETGETITRELTPEEIAALPEPSEPIE |
Ga0315909_101196962 | 3300031857 | Freshwater | MSDPLIGTFHDAATGETITRELTAEEIAALPEPTEPLE |
Ga0315909_103088292 | 3300031857 | Freshwater | MSDPIIGTFHDAATGETITRELTAEEIAALPEPTDPLGDNK |
Ga0315909_104637941 | 3300031857 | Freshwater | MSDPIIGTFHDAETGETITRELTPEEIAALPEPSE |
Ga0315909_105036522 | 3300031857 | Freshwater | MSDPRIEIFYNAETGETITRELTPEEIAALPEATNDTPEPL |
Ga0315906_107302883 | 3300032050 | Freshwater | MSDPRIEIFYNAETGETITRELTPEEIAALPEATNDTPEP |
Ga0334722_100880563 | 3300033233 | Sediment | MELPYGTFHDAITGETFTRKLTPEEVAALPEPTEPLE |
Ga0316627_1024051312 | 3300033482 | Soil | MSDPILGTFHDAETGETITRELTAEEIAALPEPSEPLPE |
Ga0334977_0001204_2243_2359 | 3300033978 | Freshwater | MSDPILGTFHNAETGETITRELTPEEIAALPEPTESPE |
Ga0334977_0019795_3663_3788 | 3300033978 | Freshwater | MSDPILGTFHDAETGETITRELTPEEIAALPEATNDTPEPL |
Ga0334979_0375371_623_754 | 3300033996 | Freshwater | MSNIEPKYGTFHDALTGKTITRELTAEEVAELPEPVEPLGNNQ |
Ga0335004_0185076_519_644 | 3300034021 | Freshwater | MSDSRIEIFYDAETGETITRELTPEEIAALPEATNDTPEPL |
Ga0334987_0042185_3599_3712 | 3300034061 | Freshwater | MDKKYGTFHDALTGETITRELTPEEIAELPEPSEPLP |
Ga0335001_0005904_1129_1245 | 3300034064 | Freshwater | MEPLLGTFHDALTGETITRELTPEEIAALPEPPPPLGE |
Ga0310130_0044654_978_1109 | 3300034073 | Fracking Water | MNTEPIYGTFHDALTGDTVVRELTAEEIDKMPKPTELGSDNDN |
Ga0335020_0001785_13975_14091 | 3300034082 | Freshwater | MEPLLGTFHDALTGETITRELTAEEIAALPEPEPPLGE |
Ga0335020_0006731_6175_6306 | 3300034082 | Freshwater | MSNIEPLIGIFHDVITGEIITRELTAEEIATLPEPAPKLDGDS |
Ga0335020_0619529_334_504 | 3300034082 | Freshwater | HHGQHHRVWLQNGVTMSDPILGTFHDAETGETITRELTPEEIAALPEATNDTPEPL |
Ga0335012_0129084_121_249 | 3300034093 | Freshwater | MEPILGTFHDAVTGVTVTRELTAEEIAALPEPTPLLGESDAS |
Ga0335025_0020202_4057_4185 | 3300034096 | Freshwater | MDPLYGIFHNARTGETVTRELTPEEIAALPAPGDSLIPTEPE |
Ga0335027_0150438_1376_1492 | 3300034101 | Freshwater | MSDPLIGTFHDAATGETITRELTAEEIAALPETTEPLE |
Ga0335030_0187354_736_858 | 3300034103 | Freshwater | MSDPIIGTFHDAATGETITRELTAEEIAALPEPTDPLDSE |
Ga0335031_0597627_512_628 | 3300034104 | Freshwater | MSDPIIGTFHDAATGETVTRELTAEEIAALPEPTEPLE |
Ga0335036_0223941_391_516 | 3300034106 | Freshwater | MSDPRIEIFYNAETGETITRELTPEEIAALPEATHDTPEPQ |
Ga0335036_0314841_45_170 | 3300034106 | Freshwater | MSDPIFGTFHDAETGETITRELTPEEIAALPEATNDTPEPQ |
⦗Top⦘ |