Basic Information | |
---|---|
Family ID | F033426 |
Family Type | Metagenome |
Number of Sequences | 177 |
Average Sequence Length | 46 residues |
Representative Sequence | ELKKLSDKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 177 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.31 % |
% of genes from short scaffolds (< 2000 bps) | 82.49 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (51.412 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (25.989 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.927 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (80.226 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 177 Family Scaffolds |
---|---|---|
PF13186 | SPASM | 3.95 |
PF12849 | PBP_like_2 | 2.82 |
PF03401 | TctC | 1.69 |
PF01242 | PTPS | 1.69 |
PF13394 | Fer4_14 | 1.69 |
PF01467 | CTP_transf_like | 1.13 |
PF08241 | Methyltransf_11 | 1.13 |
PF01176 | eIF-1a | 1.13 |
PF13640 | 2OG-FeII_Oxy_3 | 1.13 |
PF00117 | GATase | 1.13 |
PF10902 | WYL_2 | 1.13 |
PF04055 | Radical_SAM | 1.13 |
PF00149 | Metallophos | 1.13 |
PF01583 | APS_kinase | 0.56 |
PF01370 | Epimerase | 0.56 |
PF01592 | NifU_N | 0.56 |
PF03851 | UvdE | 0.56 |
PF10504 | DUF2452 | 0.56 |
PF01521 | Fe-S_biosyn | 0.56 |
PF02777 | Sod_Fe_C | 0.56 |
PF07733 | DNA_pol3_alpha | 0.56 |
PF00383 | dCMP_cyt_deam_1 | 0.56 |
PF13489 | Methyltransf_23 | 0.56 |
PF00081 | Sod_Fe_N | 0.56 |
PF00497 | SBP_bac_3 | 0.56 |
PF14090 | HTH_39 | 0.56 |
COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
---|---|---|---|
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 1.69 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.69 |
COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 1.13 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.13 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.56 |
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.56 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.56 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.56 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.32 % |
Unclassified | root | N/A | 27.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000176|TB03JUN2009E_c047801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1024467 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
3300003277|JGI25908J49247_10017033 | All Organisms → Viruses → Predicted Viral | 2198 | Open in IMG/M |
3300003277|JGI25908J49247_10048694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1116 | Open in IMG/M |
3300003277|JGI25908J49247_10163530 | Not Available | 516 | Open in IMG/M |
3300004125|Ga0066182_10014911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1537 | Open in IMG/M |
3300004128|Ga0066180_10093163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
3300004128|Ga0066180_10273157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300004684|Ga0065168_1074824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300004684|Ga0065168_1082758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300004691|Ga0065176_1023823 | Not Available | 592 | Open in IMG/M |
3300005517|Ga0070374_10210757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300005517|Ga0070374_10235663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300005517|Ga0070374_10240512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 927 | Open in IMG/M |
3300005582|Ga0049080_10089777 | Not Available | 1049 | Open in IMG/M |
3300005582|Ga0049080_10167407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300005582|Ga0049080_10190942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300005583|Ga0049085_10094783 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
3300005583|Ga0049085_10275634 | Not Available | 549 | Open in IMG/M |
3300005662|Ga0078894_10324457 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
3300005662|Ga0078894_11163183 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005941|Ga0070743_10060977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → unclassified Pseudobdellovibrionaceae → Pseudobdellovibrionaceae bacterium | 1282 | Open in IMG/M |
3300006071|Ga0007876_1092400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300006100|Ga0007806_1079135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300006101|Ga0007810_1000393 | All Organisms → cellular organisms → Bacteria | 13257 | Open in IMG/M |
3300006101|Ga0007810_1053979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300006108|Ga0007862_1004949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3309 | Open in IMG/M |
3300006108|Ga0007862_1104690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300006112|Ga0007857_1041330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
3300006115|Ga0007816_1002824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4654 | Open in IMG/M |
3300006115|Ga0007816_1004061 | All Organisms → cellular organisms → Bacteria | 3797 | Open in IMG/M |
3300006484|Ga0070744_10057283 | Not Available | 1139 | Open in IMG/M |
3300007165|Ga0079302_1057207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
3300007522|Ga0105053_10927398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300007545|Ga0102873_1104043 | Not Available | 859 | Open in IMG/M |
3300007624|Ga0102878_1181157 | Not Available | 607 | Open in IMG/M |
3300008052|Ga0102893_1044116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1357 | Open in IMG/M |
3300008110|Ga0114343_1121490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300008113|Ga0114346_1002014 | Not Available | 15601 | Open in IMG/M |
3300008116|Ga0114350_1066704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1760 | Open in IMG/M |
3300008120|Ga0114355_1259800 | Not Available | 504 | Open in IMG/M |
3300009024|Ga0102811_1203595 | Not Available | 739 | Open in IMG/M |
3300009026|Ga0102829_1006802 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
3300009026|Ga0102829_1141435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300009068|Ga0114973_10024996 | Not Available | 3669 | Open in IMG/M |
3300009079|Ga0102814_10367395 | Not Available | 783 | Open in IMG/M |
3300009151|Ga0114962_10331560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
3300009151|Ga0114962_10394124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300009158|Ga0114977_10404277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → unclassified Peptococcaceae → Peptococcaceae bacterium CEB3 | 760 | Open in IMG/M |
3300009159|Ga0114978_10807011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300009160|Ga0114981_10498873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300009161|Ga0114966_10573422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300009164|Ga0114975_10013793 | All Organisms → cellular organisms → Bacteria | 4982 | Open in IMG/M |
3300009164|Ga0114975_10282466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
3300009180|Ga0114979_10248407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300009180|Ga0114979_10484751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 716 | Open in IMG/M |
3300009180|Ga0114979_10754725 | Not Available | 548 | Open in IMG/M |
3300009182|Ga0114959_10524928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300009182|Ga0114959_10608490 | Not Available | 521 | Open in IMG/M |
3300009183|Ga0114974_10126233 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
3300009184|Ga0114976_10196883 | All Organisms → Viruses → Predicted Viral | 1112 | Open in IMG/M |
3300009419|Ga0114982_1052586 | Not Available | 1285 | Open in IMG/M |
3300010157|Ga0114964_10000537 | Not Available | 29220 | Open in IMG/M |
3300010158|Ga0114960_10059139 | All Organisms → Viruses → Predicted Viral | 2242 | Open in IMG/M |
3300010158|Ga0114960_10224512 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300010158|Ga0114960_10460128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300010160|Ga0114967_10274152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300010885|Ga0133913_10041233 | Not Available | 12408 | Open in IMG/M |
3300010885|Ga0133913_10711917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2626 | Open in IMG/M |
3300010885|Ga0133913_11525706 | All Organisms → cellular organisms → Bacteria | 1691 | Open in IMG/M |
3300010885|Ga0133913_12378136 | Not Available | 1297 | Open in IMG/M |
3300010885|Ga0133913_13634853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
3300011009|Ga0129318_10269683 | Not Available | 569 | Open in IMG/M |
3300011011|Ga0139556_1033823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300012663|Ga0157203_1011522 | Not Available | 1438 | Open in IMG/M |
3300012663|Ga0157203_1017942 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
3300012663|Ga0157203_1019392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300013014|Ga0164295_11111636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300013014|Ga0164295_11381320 | Not Available | 546 | Open in IMG/M |
3300013295|Ga0170791_11160495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300013372|Ga0177922_10139497 | Not Available | 509 | Open in IMG/M |
3300013372|Ga0177922_10235902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300013372|Ga0177922_10785381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300013372|Ga0177922_10802147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1502 | Open in IMG/M |
3300017777|Ga0181357_1009158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3947 | Open in IMG/M |
3300017778|Ga0181349_1166508 | Not Available | 782 | Open in IMG/M |
3300017778|Ga0181349_1297434 | Not Available | 524 | Open in IMG/M |
3300017784|Ga0181348_1162266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300018790|Ga0187842_1160037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300019093|Ga0187843_10382549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300020161|Ga0211726_10877317 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
3300020205|Ga0211731_11327908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300020205|Ga0211731_11702379 | Not Available | 580 | Open in IMG/M |
3300020205|Ga0211731_11718913 | Not Available | 1024 | Open in IMG/M |
3300020527|Ga0208232_1038713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300020539|Ga0207941_1047237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300020562|Ga0208597_1047632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300020562|Ga0208597_1087510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300020715|Ga0214254_1040961 | Not Available | 572 | Open in IMG/M |
3300020733|Ga0214172_1047529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300021141|Ga0214163_1092963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300021142|Ga0214192_1070614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
3300021354|Ga0194047_10171051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
3300021602|Ga0194060_10301341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300021956|Ga0213922_1069658 | Not Available | 746 | Open in IMG/M |
3300021962|Ga0222713_10563954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 670 | Open in IMG/M |
3300023429|Ga0222710_1083405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300024346|Ga0244775_10131138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2121 | Open in IMG/M |
3300025162|Ga0209083_1145763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
3300025381|Ga0208871_1053295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300025383|Ga0208250_1008575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1979 | Open in IMG/M |
3300025387|Ga0207959_1024215 | Not Available | 992 | Open in IMG/M |
3300025392|Ga0208380_1026983 | Not Available | 915 | Open in IMG/M |
3300025401|Ga0207955_1009281 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
3300025410|Ga0208875_1047763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300025413|Ga0208614_1011686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1561 | Open in IMG/M |
3300025423|Ga0208746_1003345 | Not Available | 3882 | Open in IMG/M |
3300025426|Ga0208739_1002965 | All Organisms → cellular organisms → Bacteria | 3879 | Open in IMG/M |
3300025450|Ga0208744_1060432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300025451|Ga0208426_1040605 | Not Available | 715 | Open in IMG/M |
3300025598|Ga0208379_1105198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300025723|Ga0208741_10019484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1679 | Open in IMG/M |
3300025789|Ga0208499_1006608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2581 | Open in IMG/M |
3300025789|Ga0208499_1015917 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
3300027146|Ga0255104_1039873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300027147|Ga0255113_1025473 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300027260|Ga0208027_1095879 | Not Available | 561 | Open in IMG/M |
3300027329|Ga0255109_1084127 | Not Available | 669 | Open in IMG/M |
3300027595|Ga0255122_1009630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1963 | Open in IMG/M |
3300027596|Ga0255119_1042235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300027608|Ga0208974_1104970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Thermoanaerobacterales → Thermoanaerobacterales Family III. Incertae Sedis → Caldicellulosiruptor | 751 | Open in IMG/M |
3300027627|Ga0208942_1161765 | Not Available | 597 | Open in IMG/M |
3300027631|Ga0208133_1061536 | Not Available | 897 | Open in IMG/M |
3300027644|Ga0209356_1084475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300027679|Ga0209769_1177922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300027708|Ga0209188_1115600 | Not Available | 1054 | Open in IMG/M |
3300027708|Ga0209188_1145991 | Not Available | 897 | Open in IMG/M |
3300027710|Ga0209599_10135073 | Not Available | 654 | Open in IMG/M |
3300027710|Ga0209599_10161151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300027710|Ga0209599_10198242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1017688 | Not Available | 5596 | Open in IMG/M |
3300027747|Ga0209189_1001828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15478 | Open in IMG/M |
3300027753|Ga0208305_10180157 | Not Available | 766 | Open in IMG/M |
3300027763|Ga0209088_10103152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1305 | Open in IMG/M |
3300027763|Ga0209088_10181556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
3300027763|Ga0209088_10280477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300027770|Ga0209086_10430773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300027777|Ga0209829_10056054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2059 | Open in IMG/M |
3300027777|Ga0209829_10321125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300027782|Ga0209500_10045049 | All Organisms → Viruses → Predicted Viral | 2392 | Open in IMG/M |
3300027782|Ga0209500_10253488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300027798|Ga0209353_10023476 | Not Available | 2888 | Open in IMG/M |
3300027798|Ga0209353_10132866 | Not Available | 1116 | Open in IMG/M |
3300027798|Ga0209353_10163632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 987 | Open in IMG/M |
3300027808|Ga0209354_10178855 | Not Available | 863 | Open in IMG/M |
3300027896|Ga0209777_10705326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300027963|Ga0209400_1237548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300027963|Ga0209400_1254773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300027963|Ga0209400_1352910 | Not Available | 543 | Open in IMG/M |
3300027969|Ga0209191_1064861 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300028178|Ga0265593_1024750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1867 | Open in IMG/M |
3300028392|Ga0304729_1016165 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 3291 | Open in IMG/M |
3300028392|Ga0304729_1246951 | Not Available | 537 | Open in IMG/M |
3300028393|Ga0304728_1000630 | Not Available | 29141 | Open in IMG/M |
3300028393|Ga0304728_1140744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Coraliomargarita → unclassified Coraliomargarita → Coraliomargarita sp. TMED73 | 883 | Open in IMG/M |
3300028394|Ga0304730_1052297 | All Organisms → Viruses → Predicted Viral | 1972 | Open in IMG/M |
3300031784|Ga0315899_10176359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2167 | Open in IMG/M |
3300031787|Ga0315900_10467392 | Not Available | 969 | Open in IMG/M |
3300031787|Ga0315900_10954726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300032560|Ga0316223_1061195 | Not Available | 1435 | Open in IMG/M |
3300032561|Ga0316222_1042434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 2156 | Open in IMG/M |
3300032722|Ga0316231_1042135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio → Bdellovibrio exovorus → Pseudobdellovibrio exovorus JSS | 2576 | Open in IMG/M |
3300033816|Ga0334980_0133452 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
3300033816|Ga0334980_0411624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300034013|Ga0334991_0270110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300034117|Ga0335033_0218094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
3300034279|Ga0335052_0000855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18900 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 14.12% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.86% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.08% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.52% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.95% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.82% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.26% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.26% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.69% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.69% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.13% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.13% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.56% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.56% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.56% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
3300004691 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (version 2) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020715 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUL2009 hypolimnion | Environmental | Open in IMG/M |
3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300023429 | Saline water microbial communities from Ace Lake, Antarctica - #1696 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025387 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027329 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027596 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB03JUN2009E_0478012 | 3300000176 | Freshwater | GGKLSFNEPKDPALKKASDKAHKLLQKIEKAYEDEDEAMMIRLIKVRQSLWT* |
TBL_comb48_EPIDRAFT_10244671 | 3300000439 | Freshwater | ASRLANGGKLNFGDDKTPELETMCNIAHQKLQEIEKAYEKEDEEMMIRLIKVRQSLWT* |
JGI25908J49247_100170334 | 3300003277 | Freshwater Lake | CEASRVANGGKLSWMGRDKTPELQEMSDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
JGI25908J49247_100486943 | 3300003277 | Freshwater Lake | SWMGSDKTPELRKMADKALKLTTKIEAAYDKEDTEMMVRLIKARDSLWT* |
JGI25908J49247_101635301 | 3300003277 | Freshwater Lake | RIANGGRMSFGNNKTPELKKMCDKSHKLLQKIEAAYEKDDEEMMIRLIRIRTSLWT* |
Ga0066182_100149112 | 3300004125 | Freshwater Lake | SGDKDPVLKKASDKAHKLLQKIEAAYEAEDEAMMIRLIKIRQSLWT* |
Ga0066180_100931631 | 3300004128 | Freshwater Lake | KTPELKKASTQAHKELQKIEKAYEKEDEAMMIRLIKARDSLWT* |
Ga0066180_102731571 | 3300004128 | Freshwater Lake | EASRIANGGKLNWGREKDPVLKKASDKAHELLQKIEADYEKEDEAMMIRLIKARDSLWT*PIYVNVYEV* |
Ga0065168_10748242 | 3300004684 | Freshwater | SNGGQLSLGEKDSPELKKASKLALKELQKMEQAYEKEEEAMMIRLIKVRQGLWT* |
Ga0065168_10827581 | 3300004684 | Freshwater | LHFGIEKDPTLKKASVRARKLLDKIEKAYEAEDEAMMIRLIKIRGSLWT* |
Ga0065176_10238231 | 3300004691 | Freshwater | LSWGVEKDPVLKKASDKAHKLLQKIEKSYEEEEEAMMIRLIKIRQSLWT* |
Ga0070374_102107571 | 3300005517 | Freshwater Lake | LKKQGNQALKLTTKIEKQYADEDEAMMIRLIKARDSLWT* |
Ga0070374_102356631 | 3300005517 | Freshwater Lake | SDKSPELKEMSDKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0070374_102405123 | 3300005517 | Freshwater Lake | KSPELKAMSDKSHKLLQEIESAYEAEDEAMMIRLIKARDSLWT* |
Ga0049080_100897774 | 3300005582 | Freshwater Lentic | KDKTPELEEMSNRSHKLLQEIEAAYEAEDEVMMIRLIKARDSLWT* |
Ga0049080_101674071 | 3300005582 | Freshwater Lentic | GKLSWSGSDKSPELKAMSDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0049080_101909421 | 3300005582 | Freshwater Lentic | RLFGSKKTPELEKLSNKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0049085_100947833 | 3300005583 | Freshwater Lentic | GRMSFGNNKTPELKKMCDKSHKLLQKIEAAYEKDDEEMMIRLIRIRSSLWT* |
Ga0049085_102756341 | 3300005583 | Freshwater Lentic | KDKTPELQEMSDKSHALLQEIETAYEAEDEVMMIRLIKARDSLWT* |
Ga0078894_103244575 | 3300005662 | Freshwater Lake | LKKACNAAHKELRKIEAAYAKEEEQMMIRLIKIRESLWT* |
Ga0078894_111631831 | 3300005662 | Freshwater Lake | SFGGQDKSPELRKMGDKALKLSQKIEKQYNDEDEAMMIRLIKVRDSLWT* |
Ga0070743_100609771 | 3300005941 | Estuarine | ELKAMSDKSHALLQEIESAYQAEDEAMMIRLIKARDSLWT* |
Ga0007876_10924001 | 3300006071 | Freshwater | ANGGRLNFGGEKDPMLKKQSNKAHKLLQKIEADYEKEDTEMLIRLIKIRQSLWT* |
Ga0007806_10791351 | 3300006100 | Freshwater | ETMCNIAHQKLQEIEKAYEEEDEAMMIRLIKIRQSLWT* |
Ga0007810_10003931 | 3300006101 | Freshwater | IANGGRLSFSAEKDPVLKKASDKAHKLLQKIEKAYEDEDEAMMIRLIRIRHSLWT* |
Ga0007810_10539791 | 3300006101 | Freshwater | PTLKKASDRARKLLDKIEKAYEAEDEAMMIRLIKIRGSLWT* |
Ga0007862_10049491 | 3300006108 | Freshwater | EKDPVLKKASDKAHKLLQKIEKSYEEEEEAMMIRLIKIRQSLWT* |
Ga0007862_11046902 | 3300006108 | Freshwater | VLKAMCDTAHNKLRDIEKAYEEEEELMMIRLIKIRQALWT* |
Ga0007857_10413303 | 3300006112 | Freshwater | SRRLLDTLHDLEAKYEAEDEEMMIRLIKVRNGLWT* |
Ga0007816_100282412 | 3300006115 | Freshwater | SDKAHKLLQKIEAAYEKEDEAMMIRLIKIRQSLWT* |
Ga0007816_10040615 | 3300006115 | Freshwater | CNIAHQKLQEIEKAYEKEDEEMMIRLIKVRQSLWT* |
Ga0070744_100572831 | 3300006484 | Estuarine | KSPELEAMSDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0079302_10572071 | 3300007165 | Deep Subsurface | NKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0105053_109273981 | 3300007522 | Freshwater | QAQNKSLKLLQKIEAAYEKEDERMMTRLIRARHSLWT* |
Ga0102873_11040431 | 3300007545 | Estuarine | ASRIANGGKLSFSGDRSPELEAMSDKSHALLQEIESAYEAEDEAMMIRLIKARDSLWT* |
Ga0102878_11811571 | 3300007624 | Estuarine | FGSKETDELRKQGDKALKLSSKIEKQYADEDERMMIRLIKARDSLWT* |
Ga0102893_10441161 | 3300008052 | Estuarine | NDRSPELEEMSNKSHKLLREIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114343_11214901 | 3300008110 | Freshwater, Plankton | MSTKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0114346_100201414 | 3300008113 | Freshwater, Plankton | DPVLKKASDKAHKLLQKIESDYEKEDEAMMIRLIKARDSLWT* |
Ga0114350_10667041 | 3300008116 | Freshwater, Plankton | ASDKAHKLLRKIEAAYEKEDEAMMIRLIKIRESLWT* |
Ga0114355_12598003 | 3300008120 | Freshwater, Plankton | KMSTKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0102811_12035951 | 3300009024 | Estuarine | NGGKLSFSGDRSPELEAMSDKSHALLQEIESAYEAEDEAMMIRLIKARDSLWT* |
Ga0102829_10068024 | 3300009026 | Estuarine | RIANGGKLSFSGDRSPELEAMSDKSHALLQEIESAYEAEDEAMMIRLIKARDSLWT* |
Ga0102829_11414351 | 3300009026 | Estuarine | KLSFSTPKDPVLKKAQDKAHKLLQKIEETYEKEDEAMMIRLIKARDSLWT* |
Ga0114973_1002499612 | 3300009068 | Freshwater Lake | DKTPELEEMSNRSHTLLEEIKAAYEAEDTEMLIRLIKIRDGLWT* |
Ga0102814_103673952 | 3300009079 | Estuarine | EKSPELEAMSDKSHALLQEIESAYEAEDEAMMIRLIKARDSLWT* |
Ga0114962_103315602 | 3300009151 | Freshwater Lake | GKKALKLTTKIEQAYDKEDEAMMIRLIKARDSLWT* |
Ga0114962_103941241 | 3300009151 | Freshwater Lake | KLRFSEEKDPALKKANDKAHKLLQKIEVAYEKEDEQMMIRLIKARDSLWT* |
Ga0114977_104042773 | 3300009158 | Freshwater Lake | RAANGGKLSWMSSDKTPELKAMSDAAHEKLREIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114978_108070111 | 3300009159 | Freshwater Lake | NGGRLSFSGEKDPVLKKQSDKAHKLLQKIEKQYADEDEKMMIRLIKARDSLWT* |
Ga0114981_104988731 | 3300009160 | Freshwater Lake | MSDKAHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114966_105734221 | 3300009161 | Freshwater Lake | SDKSHKLLQKIEAAYEKEDEAMMIRLIKIRQSLWT* |
Ga0114975_100137936 | 3300009164 | Freshwater Lake | WLGSDKSPELKEMSDKTHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114975_102824661 | 3300009164 | Freshwater Lake | KAMSDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114979_102484073 | 3300009180 | Freshwater Lake | FSTPKDPVLKKAQDKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0114979_104847511 | 3300009180 | Freshwater Lake | GSDKTPELKKMSEESHKKLQEIETSYEAEDEAMMIRLIKARDSLWT* |
Ga0114979_107547251 | 3300009180 | Freshwater Lake | SDKSPELKAMSDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114959_105249282 | 3300009182 | Freshwater Lake | GGRRRFSKEKDPALKKASDKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0114959_106084901 | 3300009182 | Freshwater Lake | FRNDRSPELEEMSNKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114974_101262331 | 3300009183 | Freshwater Lake | STPKDPVLKKASDKAHKLLQKIEEGYEKEDEAMMIRLIKARDSLWT* |
Ga0114976_101968833 | 3300009184 | Freshwater Lake | ANGGKLSFSTPKDPVLKKAQDKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0114982_10525861 | 3300009419 | Deep Subsurface | ISSKNPETEKLGKKALNLTTKIEAAYDKEDEQMMIRLIKARDSLWT* |
Ga0114964_1000053717 | 3300010157 | Freshwater Lake | GKLSFRNDRSPELEEMSNKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0114960_100591391 | 3300010158 | Freshwater Lake | RLANGGKLSWLGSDKTPELKAMSDKSHALLQEIEAAYEAEDEVMMIRLIKARDSLWT* |
Ga0114960_102245123 | 3300010158 | Freshwater Lake | GDRALKLTTKIEAAYDKEDEQMMIRLIRARDSLWT* |
Ga0114960_104601282 | 3300010158 | Freshwater Lake | DKALKLTTKIEAAYDKEDTEMMIRLIKIRDSLWT* |
Ga0114967_102741521 | 3300010160 | Freshwater Lake | KASNKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0133913_1004123310 | 3300010885 | Freshwater Lake | MSDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0133913_107119173 | 3300010885 | Freshwater Lake | GKLRFSSEKSPELEAMSDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0133913_115257061 | 3300010885 | Freshwater Lake | ELKKMSDKAHKLLQRLENDYEKEDEAMMIRLIKIRNSLWT* |
Ga0133913_123781361 | 3300010885 | Freshwater Lake | SKNPETEKLGKKALKLTTKIEQAYDKEDEAMMIRLIKARDSLWT* |
Ga0133913_136348535 | 3300010885 | Freshwater Lake | SEKDPASRNASTKAIKLLDKIEKAYEKEDTDMMIRLIRARDSLWT* |
Ga0129318_102696832 | 3300011009 | Freshwater To Marine Saline Gradient | EKSHALLQEIEAAYEADDEAMMIRLIKARDSLWT* |
Ga0139556_10338231 | 3300011011 | Freshwater | YCEQARILNDGRLFGSKSTPELKKLSDKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0157203_10115221 | 3300012663 | Freshwater | DKAHKLLQKIEAAYEKEDEEMMIRLIKIRQSLWT* |
Ga0157203_10179421 | 3300012663 | Freshwater | DKAHKLLQKIEADYEKEDEAMMIRLIKARDSLWT* |
Ga0157203_10193921 | 3300012663 | Freshwater | DKAHKLLQKIEAAYEKEDEEMMIRLIKARDSLWT* |
Ga0164295_111116362 | 3300013014 | Freshwater | KEMSDKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0164295_113813202 | 3300013014 | Freshwater | DYCEASRIANGGKLSFSGDKSPELTAMSDKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT* |
Ga0170791_111604951 | 3300013295 | Freshwater | GGKLSFSSPKDPVLKKASDKAHKLLQKIEAEYTKEDEAMMIRLIKIRESLWT* |
Ga0177922_101394972 | 3300013372 | Freshwater | STRSHEMLQKIEADYAAEDEAMMIRLIKARDSLWT* |
Ga0177922_102359021 | 3300013372 | Freshwater | ASRIANGGKLNWGREKDPVLKKASDKAHKLLQKIEPDYEKEDEAMMIRLIKARDSLWT* |
Ga0177922_107853813 | 3300013372 | Freshwater | ELKKLSDKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT* |
Ga0177922_108021471 | 3300013372 | Freshwater | LKKMSDKAHKLLRKIEAAYEKEDEQMMIRLIRVRESLWT* |
Ga0181357_10091588 | 3300017777 | Freshwater Lake | EEMSDKAHKLLGEIEAAYEQEDTIMMKKLIDCRQSLWT |
Ga0181349_11665083 | 3300017778 | Freshwater Lake | EAARLANGGKLSWMGSDKTPELRKMADKALKLTTKIEAAYDKEDTEMMIRLIKARDSLWT |
Ga0181349_12974341 | 3300017778 | Freshwater Lake | KLSWSGSDKSPELKAMSDAAHEKLREIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0181348_11622662 | 3300017784 | Freshwater Lake | KVSDKAHKLLQKIEAAYEKEDEEMMIRLIKARDSLWT |
Ga0187842_11600372 | 3300018790 | Freshwater | SMLSQPQSQELKEMGDKTHKLLQEIETAYETEDESMMIRLIKARGSLWT |
Ga0187843_103825492 | 3300019093 | Freshwater | LKEMSDKAHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0211726_108773174 | 3300020161 | Freshwater | LFGGKSTPELKKLSDKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0211731_113279081 | 3300020205 | Freshwater | STKAMKLLDKIERAYEKEDEEMMIRLIKARDSLWT |
Ga0211731_117023791 | 3300020205 | Freshwater | KKQGNQALKLTTKIEKQYADEDEAMMIRLIKARDSLWT |
Ga0211731_117189131 | 3300020205 | Freshwater | ELEALSTRSHELLQKIEADYAAEDEAMLIRLIKARDSLWT |
Ga0208232_10387131 | 3300020527 | Freshwater | CEQARILNGGKLFGGKSTPELKKLSDKSHKLLQKIEAAYEKEDEVMMIRLIKARDSLWT |
Ga0207941_10472373 | 3300020539 | Freshwater | ASNKAHKLLSKIEKAYEKEDEEMMIRLIKIRESLWT |
Ga0208597_10476323 | 3300020562 | Freshwater | PELKKLSDKSHKLLQKIEAAYEKEDEVMMIRLIKARDSLWT |
Ga0208597_10875103 | 3300020562 | Freshwater | DRKASNKAHKLLSKIEKAYEKEDEEMMIRLIKIRESLWT |
Ga0214254_10409611 | 3300020715 | Freshwater | SKALRKASDLAHKELRKIEAAHAKEEEQMMIRLIKIRESLWT |
Ga0214172_10475293 | 3300020733 | Freshwater | NGGRLSLGEKDSPELKKASKLALKELQKMEQAYEKEEEAMMIRLIKVRQGLWT |
Ga0214163_10929633 | 3300021141 | Freshwater | PELKKLSNKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0214192_10706144 | 3300021142 | Freshwater | PEMKKASKMALKELRKIEAAYEKEDEAMMIRLIKVRQSLWT |
Ga0194047_101710513 | 3300021354 | Anoxic Zone Freshwater | CEKSREMNGGRLSFSTPKELKKEHDLAYKLLTKMEAEYEKEDEAMMISLIKVRNSLWT |
Ga0194060_103013414 | 3300021602 | Anoxic Zone Freshwater | FNTPKDPVLKKAQDKAHKLLQKIEAAYEKEDEAMMIRLIKIRQSLWT |
Ga0213922_10696584 | 3300021956 | Freshwater | FSGDKSPELKKMSNKSHKLLRKIEADYAKEEEQMMIRLIKIRESLWT |
Ga0222713_105639542 | 3300021962 | Estuarine Water | KTPELKKASNLAHKELQKIEKAYEKEDEAMMIRLIKVRDSLWT |
Ga0222710_10834052 | 3300023429 | Saline Water | MSNNTHKLLRKIEAAYEKEDEAMLIRLIKIRGSLWT |
Ga0244775_101311381 | 3300024346 | Estuarine | CEASRIANGGKLNWGQEKDPILKKASDKAHKLLQKIEAAYEKEDEEMMIRLIKARDSLWT |
Ga0209083_11457631 | 3300025162 | Freshwater | KTPDMQEMSKTALAKLQEIESAYEAEDEAMMVRLIKLRKSLWA |
Ga0208871_10532952 | 3300025381 | Freshwater | ASRIANGGRLSFSAEKDPVLKKASDKAHKLLQKIEKAYEDEDEAMMIRLIRIRHSLWT |
Ga0208250_10085751 | 3300025383 | Freshwater | DPVLRKQSDKAHKLLQKIEAAYEKEDEAMMIRLIKIRQSLWT |
Ga0207959_10242152 | 3300025387 | Freshwater | EKDPVLKKASDKAHKLLQKIEKSYEEEEEAMMIRLIKIRQSLWT |
Ga0208380_10269832 | 3300025392 | Freshwater | ASDKAHKLLQKIEKSYEEEEEAMMIRLIKIRQSLWT |
Ga0207955_10092815 | 3300025401 | Freshwater | RLSNGGQLSLGEKDSPELKKASKLALKELQKMEQAYEKEEEAMMIRLIKVRQGLWT |
Ga0208875_10477632 | 3300025410 | Freshwater | GGKETPELKRSSNLALKELRKIEAAYAKEDESMMIRLIKVRESLWT |
Ga0208614_10116865 | 3300025413 | Freshwater | LHFGIEKDPTLKKASVRARKLLDKIEKAYEAEDEAMMIRLIKIRGSLWT |
Ga0208746_10033455 | 3300025423 | Freshwater | KKASDKAHKLLQKIEKAYEDEDEAMMIRLIKIRQSLWT |
Ga0208739_10029655 | 3300025426 | Freshwater | YCEASRLANGGKLNFGDDKTPELETMCNIAHQKLQEIEKAYEKEDEEMMIRLIKVRQSLW |
Ga0208744_10604323 | 3300025450 | Freshwater | ANGGRLNFGGEKDPMLKKQSNKAHKLLQKIEADYEKEDTEMLIRLIKIRQSLWT |
Ga0208426_10406051 | 3300025451 | Aqueous | TRKALDLSTKIERAYEKEDEAMMIRLIKARDSLWT |
Ga0208379_11051982 | 3300025598 | Freshwater | LKRASKLALKELRKIEAAYAKEDESMMIRLIKVRESLWT |
Ga0208741_100194841 | 3300025723 | Freshwater | KALRKASDLAHKELRKIEAAHAKEEEQMMIRLIKIRESLWT |
Ga0208499_10066081 | 3300025789 | Freshwater | LRKASDLAHKELRKIEAAHAKEEEQMMIRLIKIRESLWT |
Ga0208499_10159171 | 3300025789 | Freshwater | DPVLKKASDKAHKLLQKIEKAYEDEDEAMMIRLIKIRQSLWT |
Ga0255104_10398733 | 3300027146 | Freshwater | DYCEQARILNGGRLFGSKSTPELKKLSDKAHKLLQKIETAYEKEDEAMMIRLIKARDSLW |
Ga0255113_10254732 | 3300027147 | Freshwater | LSTRSHEMLQKIEADYAAEDEAMMIRLIKARDSLWT |
Ga0208027_10958791 | 3300027260 | Estuarine | RFSSEKSPELEAMSDKSHALLQEIESAYEAEDEAMMIRLIKARDSLWT |
Ga0255109_10841272 | 3300027329 | Freshwater | ELSTRSHEMLQKIEADYAAEDEAMMIRLIKARDSLWT |
Ga0255122_10096304 | 3300027595 | Freshwater | LNDGRLFGSKKTPELEELSTRSHKLLQKIEADYAAEDEAMMIRLIKARDSLWT |
Ga0255119_10422351 | 3300027596 | Freshwater | GKLSFNSPKDPILKKAYDKAHKLLQKIEADYEKEDEAMMIRLIKARDSLWT |
Ga0208974_11049701 | 3300027608 | Freshwater Lentic | CEASRIANGGKMSWSSKDKTPELQEMSDKSHALLQEIETAYEAEDEVMMIRLIKARDSLW |
Ga0208942_11617651 | 3300027627 | Freshwater Lentic | YCEASRIANGGKLSWNSDKSPELKAMSDKSHALLQEIEAAYEAEDEVMMIRLIKARDSLW |
Ga0208133_10615363 | 3300027631 | Estuarine | QEMSDKSHALLQEIETAYEAEDEQMMIRLIKARDGLWT |
Ga0209356_10844751 | 3300027644 | Freshwater Lake | GKLSFSGDKSPELKEMSDKSHKLLQEIEAAYEAEDESMMIRLIKARDSLWT |
Ga0209769_11779222 | 3300027679 | Freshwater Lake | SPELKEMSDKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0209188_11156001 | 3300027708 | Freshwater Lake | KDAASRNASSKAMKLLDKIEKAYEKEDTEMMIRLIKARDSLWT |
Ga0209188_11459911 | 3300027708 | Freshwater Lake | NDRSPELEEMSNKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0209599_101350733 | 3300027710 | Deep Subsurface | ISSKNPETEKLGKKALNLTTKIEAAYDKEDEQMMIRLIKARDSLWT |
Ga0209599_101611513 | 3300027710 | Deep Subsurface | AQDKAHKLLQKIEAAYEKEDEAMLIRLIKIRQSLWT |
Ga0209599_101982422 | 3300027710 | Deep Subsurface | ASDRAHKLLQKMEANYEKEDEAMMIRLIKIRDGLWT |
(restricted) Ga0247836_10176881 | 3300027728 | Freshwater | NSPKDPVLKKANDKAHKLLQKIEADYEKEDEAMMIRLIKARDSLWT |
Ga0209189_10018281 | 3300027747 | Freshwater Lake | SFRNDRSPELEEMSNKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0208305_101801572 | 3300027753 | Estuarine | NGGKLSFRNDRSPELEEMSNKSHKLLREIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0209088_101031521 | 3300027763 | Freshwater Lake | DGRLFGSKETDELRKQGNKALKLSSKIEKQYADEDERMMIRLIKARDSLWT |
Ga0209088_101815561 | 3300027763 | Freshwater Lake | STPKDPVLKKAQDKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0209088_102804772 | 3300027763 | Freshwater Lake | KLSFSTPKDPVLKKAQDKAHKLLQKIEADYEKEDEAMMIRLIKARDSLWT |
Ga0209086_104307732 | 3300027770 | Freshwater Lake | EANRVANDGRMSFSDSKTPELKKMCNKAHKLLQKIEAAYEKEDEAMMIRLIKVRQGLWT |
Ga0209829_100560541 | 3300027777 | Freshwater Lake | DPALKKASDKAHKLLQKIEVAYEKEDEQMMIRLIKARDSLWT |
Ga0209829_103211252 | 3300027777 | Freshwater Lake | WIGVQSNNPETEKLGKKALKLTTKIEQAYDKEDEAMMIRLICARDSLWT |
Ga0209500_100450491 | 3300027782 | Freshwater Lake | SFSTPKDPVLKKAQDKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0209500_102534881 | 3300027782 | Freshwater Lake | PKDPVLKKAQDKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0209353_100234765 | 3300027798 | Freshwater Lake | KLSWSGDKTPELKKMSKKAHAALRKIEAAYEKEDEDMMIRLIKVRDRLWT |
Ga0209353_101328661 | 3300027798 | Freshwater Lake | KMSDRATKLLDKIEKAYEKEEEAMMIRLIKVRHGLWT |
Ga0209353_101636321 | 3300027798 | Freshwater Lake | KASDKAHKLLQKIESDYEKEDEAMMIRLIKARDSLWT |
Ga0209354_101788554 | 3300027808 | Freshwater Lake | RLANGGKLSWMGSDKTPELRKMADKALKLTTKIEAAYDKEDTEMMIRLIKARDSLWT |
Ga0209777_107053261 | 3300027896 | Freshwater Lake Sediment | EAQRTANGGKLNFSTPKDPVLKKQSDKAHKLLQKIEAAYEKEDEQMMIRLIKIRDALWT |
Ga0209400_12375483 | 3300027963 | Freshwater Lake | AANGGKLSFSTPKDPVLKKAQDKAHKLLQKIEAAYEKEDEAMMIRLIKIRQSLWT |
Ga0209400_12547731 | 3300027963 | Freshwater Lake | ELKKMCNKAHKLLQKIEAAYEKEDEAMMIRLIKVRQGLWT |
Ga0209400_13529102 | 3300027963 | Freshwater Lake | KMADKALKLTTKIEAAYDKEDTEMMIRLIKARDSLWT |
Ga0209191_10648613 | 3300027969 | Freshwater Lake | SWLGSDKSPELKEMSDKTHALLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0265593_10247506 | 3300028178 | Saline Water | HDASGWSAYCEAIRVANGGKFSFSEKNKTPELQEMSDRSHALLQEIETAYEAEDEAMMIRLIKARDSLWT |
Ga0304729_10161651 | 3300028392 | Freshwater Lake | SSDKNPELKEISDKSHALLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0304729_12469512 | 3300028392 | Freshwater Lake | GGKLSFRNDRSPELEEMSNKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0304728_10006301 | 3300028393 | Freshwater Lake | RSPELEEMSNKSHKLLQEIEAAYEAEDEAMMIRLIKARDSLWT |
Ga0304728_11407443 | 3300028393 | Freshwater Lake | RLANGGKLSWLGSDKTPELKAMSDKSHALLQEIEAAYEAEDEVMMIRLIKARDSLWT |
Ga0304730_10522974 | 3300028394 | Freshwater Lake | ASNKAHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0315899_101763591 | 3300031784 | Freshwater | KARELNGGKLFGSKKTPELEKMSTKSHKLLQKIEAAYEKEDEAMMIRLIKARDSLWT |
Ga0315900_104673923 | 3300031787 | Freshwater | PELEELSTRSHELLQKIEAEYAAEDEAMMIRLIKARDSLWT |
Ga0315900_109547262 | 3300031787 | Freshwater | STPELKKMSDKSHKLLQKIETAYKKEDETMMIRLIRIRESLWT |
Ga0316223_10611951 | 3300032560 | Freshwater | VLKKASDKAHKLLQKIEKAYEAEDEAMMIRLIKIRQSLWT |
Ga0316222_10424343 | 3300032561 | Freshwater | LKKASDKAHKLLQKIEKAYEAEDEAMMIRLIKIRQSLWT |
Ga0316231_10421353 | 3300032722 | Freshwater | PVLKKQSDKAHKLLQKIEKSYEDEDEAMMIRLIKIRQSLWT |
Ga0334980_0133452_894_1019 | 3300033816 | Freshwater | PELEELSTRSHELLQKIEADYAAEDEAMMIRLIKARDSLWT |
Ga0334980_0411624_3_110 | 3300033816 | Freshwater | SNKAHKLLSKIEKAYEKEDEEMMIRLIKIRESLWT |
Ga0334991_0270110_580_699 | 3300034013 | Freshwater | LEELSTRSHELLQKIEADYTAEDEAMMIRLIKARDSLWT |
Ga0335033_0218094_866_1018 | 3300034117 | Freshwater | FSSLGSDKTPELKKMSDKAHKLLRKIEAAYEKEDEQMMIRLIRVRESLWT |
Ga0335052_0000855_18758_18868 | 3300034279 | Freshwater | MSDKAHKLLRKIEAAYEKEDEQMMIRLIRVRESLWT |
⦗Top⦘ |