Basic Information | |
---|---|
Family ID | F033417 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 177 |
Average Sequence Length | 43 residues |
Representative Sequence | MSTLIDHLATDRIRGGRLVLAYSIGAVFGIALALAALLAAGTGP |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 87.01 % |
% of genes near scaffold ends (potentially truncated) | 18.08 % |
% of genes from short scaffolds (< 2000 bps) | 84.75 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (61.017 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (14.124 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.164 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.972 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.78% β-sheet: 0.00% Coil/Unstructured: 47.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 176 Family Scaffolds |
---|---|---|
PF03663 | Glyco_hydro_76 | 13.64 |
PF13466 | STAS_2 | 5.68 |
PF09594 | GT87 | 1.14 |
PF08447 | PAS_3 | 1.14 |
PF05715 | zf-piccolo | 0.57 |
PF00731 | AIRC | 0.57 |
PF08281 | Sigma70_r4_2 | 0.57 |
PF02559 | CarD_CdnL_TRCF | 0.57 |
PF12490 | BCAS3 | 0.57 |
PF00903 | Glyoxalase | 0.57 |
PF01148 | CTP_transf_1 | 0.57 |
PF14742 | GDE_N_bis | 0.57 |
PF10417 | 1-cysPrx_C | 0.57 |
PF07681 | DoxX | 0.57 |
PF00561 | Abhydrolase_1 | 0.57 |
COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
---|---|---|---|
COG4833 | Predicted alpha-1,6-mannanase, GH76 family | Carbohydrate transport and metabolism [G] | 13.64 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.57 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 61.02 % |
All Organisms | root | All Organisms | 38.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908036|A5_v_NODE_11738_len_1669_cov_9_164170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1719 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101322790 | Not Available | 666 | Open in IMG/M |
3300000891|JGI10214J12806_10200685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1673 | Open in IMG/M |
3300000955|JGI1027J12803_106706589 | Not Available | 1451 | Open in IMG/M |
3300000956|JGI10216J12902_100966456 | Not Available | 642 | Open in IMG/M |
3300000956|JGI10216J12902_101081827 | Not Available | 1135 | Open in IMG/M |
3300000956|JGI10216J12902_108185988 | Not Available | 572 | Open in IMG/M |
3300001305|C688J14111_10169802 | Not Available | 673 | Open in IMG/M |
3300001686|C688J18823_10134404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
3300002568|C688J35102_119476871 | Not Available | 702 | Open in IMG/M |
3300002568|C688J35102_119496762 | Not Available | 706 | Open in IMG/M |
3300002568|C688J35102_119877777 | Not Available | 801 | Open in IMG/M |
3300002568|C688J35102_120444265 | Not Available | 1074 | Open in IMG/M |
3300002568|C688J35102_120514789 | Not Available | 1135 | Open in IMG/M |
3300002568|C688J35102_120658094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1307 | Open in IMG/M |
3300004114|Ga0062593_100184472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1638 | Open in IMG/M |
3300004114|Ga0062593_103184870 | Not Available | 526 | Open in IMG/M |
3300004153|Ga0063455_100178506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1019 | Open in IMG/M |
3300004156|Ga0062589_100342899 | Not Available | 1181 | Open in IMG/M |
3300004156|Ga0062589_100432688 | Not Available | 1082 | Open in IMG/M |
3300004156|Ga0062589_101777177 | Not Available | 618 | Open in IMG/M |
3300004479|Ga0062595_101150493 | Not Available | 684 | Open in IMG/M |
3300004643|Ga0062591_101538832 | Not Available | 667 | Open in IMG/M |
3300005093|Ga0062594_100152754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1516 | Open in IMG/M |
3300005093|Ga0062594_101567888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300005093|Ga0062594_102245189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300005161|Ga0066807_1004046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1203 | Open in IMG/M |
3300005164|Ga0066815_10034450 | Not Available | 778 | Open in IMG/M |
3300005186|Ga0066676_10445112 | Not Available | 877 | Open in IMG/M |
3300005332|Ga0066388_100067618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3853 | Open in IMG/M |
3300005332|Ga0066388_100356022 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
3300005332|Ga0066388_102414562 | Not Available | 954 | Open in IMG/M |
3300005332|Ga0066388_102593465 | Not Available | 923 | Open in IMG/M |
3300005332|Ga0066388_104109606 | Not Available | 742 | Open in IMG/M |
3300005444|Ga0070694_100677251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
3300005468|Ga0070707_100876832 | Not Available | 862 | Open in IMG/M |
3300005468|Ga0070707_101370160 | Not Available | 674 | Open in IMG/M |
3300005529|Ga0070741_10007208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23211 | Open in IMG/M |
3300005562|Ga0058697_10099146 | Not Available | 1206 | Open in IMG/M |
3300005713|Ga0066905_100032791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2972 | Open in IMG/M |
3300005713|Ga0066905_100216989 | Not Available | 1444 | Open in IMG/M |
3300005713|Ga0066905_101249571 | Not Available | 666 | Open in IMG/M |
3300005713|Ga0066905_101532623 | Not Available | 608 | Open in IMG/M |
3300005764|Ga0066903_100018778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7235 | Open in IMG/M |
3300005764|Ga0066903_100801419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1685 | Open in IMG/M |
3300005764|Ga0066903_101971685 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300005937|Ga0081455_10009955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9719 | Open in IMG/M |
3300005937|Ga0081455_10028631 | All Organisms → cellular organisms → Bacteria | 5089 | Open in IMG/M |
3300005937|Ga0081455_10105400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2253 | Open in IMG/M |
3300005937|Ga0081455_10119418 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2079 | Open in IMG/M |
3300005981|Ga0081538_10064837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2063 | Open in IMG/M |
3300005981|Ga0081538_10274064 | Not Available | 630 | Open in IMG/M |
3300005983|Ga0081540_1002345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15502 | Open in IMG/M |
3300005985|Ga0081539_10284627 | Not Available | 718 | Open in IMG/M |
3300006046|Ga0066652_100230177 | Not Available | 1612 | Open in IMG/M |
3300006046|Ga0066652_101356578 | Not Available | 668 | Open in IMG/M |
3300006046|Ga0066652_101967124 | Not Available | 522 | Open in IMG/M |
3300006048|Ga0075363_100961507 | Not Available | 525 | Open in IMG/M |
3300006051|Ga0075364_10187413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1401 | Open in IMG/M |
3300006572|Ga0074051_11648152 | Not Available | 1266 | Open in IMG/M |
3300006575|Ga0074053_11114798 | Not Available | 559 | Open in IMG/M |
3300006575|Ga0074053_11920509 | Not Available | 683 | Open in IMG/M |
3300006604|Ga0074060_11821753 | Not Available | 1118 | Open in IMG/M |
3300006755|Ga0079222_11316016 | Not Available | 660 | Open in IMG/M |
3300006755|Ga0079222_11471129 | Not Available | 636 | Open in IMG/M |
3300006953|Ga0074063_10066196 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300006954|Ga0079219_10118319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1344 | Open in IMG/M |
3300006954|Ga0079219_12361267 | Not Available | 515 | Open in IMG/M |
3300009012|Ga0066710_100862177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 1392 | Open in IMG/M |
3300009098|Ga0105245_10420104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1340 | Open in IMG/M |
3300009098|Ga0105245_12191464 | Not Available | 606 | Open in IMG/M |
3300009789|Ga0126307_10000334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 30487 | Open in IMG/M |
3300009789|Ga0126307_10001642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14823 | Open in IMG/M |
3300009789|Ga0126307_10021582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4873 | Open in IMG/M |
3300009789|Ga0126307_10036200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3817 | Open in IMG/M |
3300009789|Ga0126307_10067375 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
3300009789|Ga0126307_10888336 | Not Available | 720 | Open in IMG/M |
3300009840|Ga0126313_10230523 | Not Available | 1431 | Open in IMG/M |
3300009840|Ga0126313_11359854 | Not Available | 588 | Open in IMG/M |
3300010036|Ga0126305_10444292 | Not Available | 860 | Open in IMG/M |
3300010036|Ga0126305_10535860 | Not Available | 783 | Open in IMG/M |
3300010037|Ga0126304_10098411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1847 | Open in IMG/M |
3300010037|Ga0126304_10100974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1824 | Open in IMG/M |
3300010037|Ga0126304_10165524 | Not Available | 1436 | Open in IMG/M |
3300010038|Ga0126315_10065406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2011 | Open in IMG/M |
3300010038|Ga0126315_10125981 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300010038|Ga0126315_10210469 | Not Available | 1175 | Open in IMG/M |
3300010039|Ga0126309_10014477 | All Organisms → cellular organisms → Bacteria | 3331 | Open in IMG/M |
3300010040|Ga0126308_10343289 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300010040|Ga0126308_10348477 | Not Available | 981 | Open in IMG/M |
3300010040|Ga0126308_10757232 | Not Available | 670 | Open in IMG/M |
3300010041|Ga0126312_10975387 | Not Available | 620 | Open in IMG/M |
3300010042|Ga0126314_10297500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
3300010043|Ga0126380_11985831 | Not Available | 532 | Open in IMG/M |
3300010044|Ga0126310_10603888 | Not Available | 818 | Open in IMG/M |
3300010046|Ga0126384_12202799 | Not Available | 530 | Open in IMG/M |
3300010145|Ga0126321_1504417 | Not Available | 956 | Open in IMG/M |
3300010166|Ga0126306_10556067 | Not Available | 911 | Open in IMG/M |
3300010166|Ga0126306_11414275 | Not Available | 576 | Open in IMG/M |
3300010362|Ga0126377_10491457 | Not Available | 1257 | Open in IMG/M |
3300010362|Ga0126377_12236333 | Not Available | 623 | Open in IMG/M |
3300010397|Ga0134124_10676595 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300010400|Ga0134122_12700118 | Not Available | 548 | Open in IMG/M |
3300012198|Ga0137364_10946338 | Not Available | 652 | Open in IMG/M |
3300012200|Ga0137382_10176757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
3300012201|Ga0137365_11309926 | Not Available | 513 | Open in IMG/M |
3300012205|Ga0137362_11099733 | Not Available | 675 | Open in IMG/M |
3300012212|Ga0150985_110163861 | Not Available | 646 | Open in IMG/M |
3300012212|Ga0150985_119943280 | Not Available | 660 | Open in IMG/M |
3300012212|Ga0150985_121311143 | Not Available | 1000 | Open in IMG/M |
3300012350|Ga0137372_10768658 | Not Available | 693 | Open in IMG/M |
3300012354|Ga0137366_10562572 | Not Available | 820 | Open in IMG/M |
3300012355|Ga0137369_10406691 | Not Available | 980 | Open in IMG/M |
3300012356|Ga0137371_10732606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 755 | Open in IMG/M |
3300012358|Ga0137368_10130456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1887 | Open in IMG/M |
3300012400|Ga0134048_1367637 | Not Available | 516 | Open in IMG/M |
3300012901|Ga0157288_10019061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1285 | Open in IMG/M |
3300012924|Ga0137413_10088872 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
3300012929|Ga0137404_10849398 | Not Available | 831 | Open in IMG/M |
3300012938|Ga0162651_100028201 | Not Available | 808 | Open in IMG/M |
3300012951|Ga0164300_10018100 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
3300012955|Ga0164298_10276354 | Not Available | 1027 | Open in IMG/M |
3300012957|Ga0164303_11413592 | Not Available | 521 | Open in IMG/M |
3300012958|Ga0164299_10005782 | All Organisms → cellular organisms → Bacteria | 4219 | Open in IMG/M |
3300012961|Ga0164302_10030678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2465 | Open in IMG/M |
3300012986|Ga0164304_11807842 | Not Available | 511 | Open in IMG/M |
3300013297|Ga0157378_11676690 | Not Available | 682 | Open in IMG/M |
3300013772|Ga0120158_10264256 | Not Available | 852 | Open in IMG/M |
3300015242|Ga0137412_10075416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2744 | Open in IMG/M |
3300015371|Ga0132258_10513890 | All Organisms → cellular organisms → Bacteria | 2997 | Open in IMG/M |
3300015371|Ga0132258_11609693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1639 | Open in IMG/M |
3300015371|Ga0132258_12475814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1299 | Open in IMG/M |
3300017947|Ga0187785_10250040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300017947|Ga0187785_10250040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300018028|Ga0184608_10532869 | Not Available | 500 | Open in IMG/M |
3300018032|Ga0187788_10180088 | Not Available | 810 | Open in IMG/M |
3300018071|Ga0184618_10060170 | Not Available | 1404 | Open in IMG/M |
3300018433|Ga0066667_10790026 | Not Available | 806 | Open in IMG/M |
3300019356|Ga0173481_10203744 | Not Available | 860 | Open in IMG/M |
3300019361|Ga0173482_10111285 | Not Available | 1010 | Open in IMG/M |
3300019362|Ga0173479_10610972 | Not Available | 572 | Open in IMG/M |
3300021286|Ga0179583_1119207 | Not Available | 507 | Open in IMG/M |
3300022756|Ga0222622_10440030 | Not Available | 924 | Open in IMG/M |
3300022756|Ga0222622_10706351 | Not Available | 733 | Open in IMG/M |
3300024288|Ga0179589_10026875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1976 | Open in IMG/M |
3300024288|Ga0179589_10501642 | Not Available | 563 | Open in IMG/M |
3300025552|Ga0210142_1016773 | Not Available | 1358 | Open in IMG/M |
3300025552|Ga0210142_1036454 | Not Available | 940 | Open in IMG/M |
3300025556|Ga0210120_1001279 | All Organisms → cellular organisms → Bacteria | 5841 | Open in IMG/M |
3300025927|Ga0207687_11335923 | Not Available | 616 | Open in IMG/M |
3300027401|Ga0208637_1025080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
3300028708|Ga0307295_10016534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1780 | Open in IMG/M |
3300028708|Ga0307295_10068748 | Not Available | 930 | Open in IMG/M |
3300028720|Ga0307317_10338463 | Not Available | 508 | Open in IMG/M |
3300028784|Ga0307282_10235587 | Not Available | 878 | Open in IMG/M |
3300028828|Ga0307312_10198071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1289 | Open in IMG/M |
3300028828|Ga0307312_11104312 | Not Available | 525 | Open in IMG/M |
3300028875|Ga0307289_10086316 | Not Available | 1274 | Open in IMG/M |
3300028875|Ga0307289_10238444 | Not Available | 748 | Open in IMG/M |
3300028881|Ga0307277_10027856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2239 | Open in IMG/M |
3300028885|Ga0307304_10437841 | Not Available | 594 | Open in IMG/M |
3300030006|Ga0299907_10184937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1722 | Open in IMG/M |
3300030336|Ga0247826_10700355 | Not Available | 786 | Open in IMG/M |
3300030785|Ga0102757_10044542 | Not Available | 922 | Open in IMG/M |
3300030785|Ga0102757_11466509 | Not Available | 554 | Open in IMG/M |
3300031091|Ga0308201_10363099 | Not Available | 534 | Open in IMG/M |
3300031421|Ga0308194_10101720 | Not Available | 827 | Open in IMG/M |
3300031740|Ga0307468_100045239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2248 | Open in IMG/M |
3300031938|Ga0308175_100240983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1809 | Open in IMG/M |
3300031939|Ga0308174_11524176 | Not Available | 573 | Open in IMG/M |
3300032080|Ga0326721_10295090 | Not Available | 901 | Open in IMG/M |
3300032174|Ga0307470_10629496 | Not Available | 807 | Open in IMG/M |
3300033433|Ga0326726_10087307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2772 | Open in IMG/M |
3300033433|Ga0326726_10266119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1600 | Open in IMG/M |
3300033550|Ga0247829_10921812 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300034090|Ga0326723_0060150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
3300034681|Ga0370546_022229 | Not Available | 850 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.12% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 14.12% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.52% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.26% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.26% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.13% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.13% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.13% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.13% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.13% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.13% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.13% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.56% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.56% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908036 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A5_v_00059500 | 2124908036 | Soil | MGTLIDHLATDRIRGGRLVFAYTIGAIFGIALALIALSAAGP |
INPhiseqgaiiFebDRAFT_1013227901 | 3300000364 | Soil | MSTLIDQLATDRIRGGRLVLAYSVGAAFGIIVALAALLLAGTAP* |
JGI10214J12806_102006853 | 3300000891 | Soil | MGTLIDHLATDRIRGGRLILAYSIGAVFGIALAIVALLAAGT |
JGI1027J12803_1067065893 | 3300000955 | Soil | MSTLIDQLATDRIRGGRLVLAYSVGAAFGIIVALAALLLA |
JGI10216J12902_1009664561 | 3300000956 | Soil | LATDRIRGGRLVLAYSIGAIFGIALAIGTLLAAGTGP* |
JGI10216J12902_1010818272 | 3300000956 | Soil | MSTLIDHLATDRIRGGRLVLAYSIGALFGIIVAVLALLVAGTGP* |
JGI10216J12902_1081859881 | 3300000956 | Soil | LALSTLIDHLATDRVRGGRLVLAYTVGAIFGVAVAVVALLAAGTGP* |
C688J14111_101698021 | 3300001305 | Soil | MGTLIDQLATDRIRGGRLVLAYTIGALCGIAVAVLALAIAGTGP* |
C688J18823_101344041 | 3300001686 | Soil | MNTLIDHLATDRIRGGRLVLAYSIGAIFGIALALVALLAAGPA* |
C688J35102_1194768711 | 3300002568 | Soil | MSTLIDHLATDRVRGGRLVLAYSIGAIFGTALALVALLATGTGL* |
C688J35102_1194967621 | 3300002568 | Soil | MSTLIDHLATDRIRGGRLVLAYAIGAVFGIAVAVLALAIAGTGP* |
C688J35102_1198777772 | 3300002568 | Soil | MGTLIDQLATDRIRGGRLVFAYSIGAVFGIALAVVALLAAGTGP* |
C688J35102_1204442653 | 3300002568 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGAICGIVIAALALLIVG |
C688J35102_1205147892 | 3300002568 | Soil | MSTLINQLATDRIRGGRLVFAYSIGAIVGIALALVALLATGTGL* |
C688J35102_1206580942 | 3300002568 | Soil | MSTLIDQLATDRIRGGRLVLAYGIGVAFGIIVALAALLLAGTTA* |
Ga0062593_1001844721 | 3300004114 | Soil | MSTLVDYLASNRIRGGRLVLAYAVGAILGIAVAVVALLVTGTA* |
Ga0062593_1031848701 | 3300004114 | Soil | MSTLIDHLATDRIRGGRLVLAYSVGAICGIAVAVLALLLAGT |
Ga0063455_1001785062 | 3300004153 | Soil | MSTLIDHLATDRIRGGRLVLAYSVGAICGIVVAVLALLIAGTGP* |
Ga0062589_1003428992 | 3300004156 | Soil | MSTLIDHLATDRIRGGRLVLAYSVGAICGIAVAVLALLLAGTGP* |
Ga0062589_1004326882 | 3300004156 | Soil | MSTLIDQLATDRIRGGRLVLAYGIGAAFGIIVALAALLLAGTTP* |
Ga0062589_1017771771 | 3300004156 | Soil | MGTLIDHLATDRIRGGRLVLAYSIGAIFGIALAIVALLAAGTGP* |
Ga0062595_1011504931 | 3300004479 | Soil | REREVGMSTLIDHLATDRIRGGRLVLAYSVGAICGIAVAVLALLLAGTGP* |
Ga0062591_1015388321 | 3300004643 | Soil | DHLATDRIRGGRLVLAYSIGAIFGIALAIAALLAAGTGP* |
Ga0062594_1001527541 | 3300005093 | Soil | MGTLIDHLATDRIRGGRLVLAYSVGAIFGIALAMVALLAAGTGP* |
Ga0062594_1015678882 | 3300005093 | Soil | MSTLIDQLATDRIQGGRLVLAYGIGAAFGIIVALAALLLAGTAP* |
Ga0062594_1022451891 | 3300005093 | Soil | MSTLIDQLATDRIRGGRLVLAYGVGAAFGIIVALAALLLAGTAP* |
Ga0066807_10040461 | 3300005161 | Soil | VGTLIDHLATDRIRGGRLILAYSIGAVFGIALAIVALLAAGTGP* |
Ga0066815_100344502 | 3300005164 | Soil | MSTLIDHLATDRIRGGRLVLAYSVGAVFGIALAMVALLATGTGF* |
Ga0066676_104451121 | 3300005186 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGAVFGIAVAVVALLVAGTGP* |
Ga0066388_1000676182 | 3300005332 | Tropical Forest Soil | MGTLIDHFASERIRGGRLILAYAVGIVFGAALAVALLAAGT* |
Ga0066388_1003560222 | 3300005332 | Tropical Forest Soil | MSTLIDHLATDRIRGGRLVLAYSIGAILGIAVAVVALAIAGTGP* |
Ga0066388_1024145622 | 3300005332 | Tropical Forest Soil | MGTLIDQLATDRLRGGRLVIAYAVGLFVGIGLAVAALLLAGTTP* |
Ga0066388_1025934652 | 3300005332 | Tropical Forest Soil | MSTLIDQLATDRIRGGRLVLAYGIGAIFGIALAVVALLATAG* |
Ga0066388_1041096061 | 3300005332 | Tropical Forest Soil | MSTLIDQLASERIRGGRLVLAYTIGALFGIVVAIAALTATAGL* |
Ga0070694_1006772511 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLIDQLATDRIRGGRLVLAYGIGATFGIIVALAALLLAGTAP* |
Ga0070707_1008768322 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLIDHLATDRIRGGRLVLAYTIGAIFGIALAVIALSAAGP* |
Ga0070707_1013701602 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTLIDHLATDRIRGGRLVLAYSIGAVFGIALALAALLAAGTGP* |
Ga0070741_1000720814 | 3300005529 | Surface Soil | MSTLIDQFASDRIRGGRLVLAYVVGGIFGTAVALAALLVTGTTP* |
Ga0058697_100991463 | 3300005562 | Agave | MSTLIDHLATDRVRGGRLVLAYTIGIVCGVAVAALALLVAGTGP* |
Ga0066905_1000327912 | 3300005713 | Tropical Forest Soil | MGTLIDHFASDRIRGGWLVLAYSIGALCGIAVAGLALLIAGTGP* |
Ga0066905_1002169894 | 3300005713 | Tropical Forest Soil | MSTLIDHLATDRIRGGRLVFAYGIGAICGIAVAVAALLIAGTGP* |
Ga0066905_1012495712 | 3300005713 | Tropical Forest Soil | MNTLIDQLASERIRGGRLVLAYGIGAIFGIGLAVTALLATAG* |
Ga0066905_1015326232 | 3300005713 | Tropical Forest Soil | MGTLIDQLATDRLRGGRLVMAYAVGLFVGIALAVVALLLAGTTP* |
Ga0066903_1000187783 | 3300005764 | Tropical Forest Soil | MSTLIDHLATDRIRGRRLVIAYAIGALFGTVVAAAALLAAGTGP* |
Ga0066903_1008014193 | 3300005764 | Tropical Forest Soil | MGQLLNHLATDRLRGGKLVIAYSAGLLIGIAVAVAALLAAGPTP* |
Ga0066903_1019716853 | 3300005764 | Tropical Forest Soil | LATDRIRGGRLVLAYSIGAVFGIALAAAALLAAGPGV* |
Ga0081455_100099557 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSTLIDHLATDRIRGARLVLAYGIGAVFGIAVAVLALALAGTGP* |
Ga0081455_100286315 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSTLIDQLATDRVKGGRLVFAYSVGAIFGVALAIAALLAAGTGP* |
Ga0081455_101054003 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGTLIDRLATDRIRGGRLVFAYSIGAVFGIALAIAALLAAGTGP* |
Ga0081455_101194181 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGTLIDHLATDRLKGGRLVFAYSVGAVFGIVLAIAALLAAGPGV* |
Ga0081538_100648373 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSTLIDHLATDRIRGGRLVFAYSIGAVCGIVVAVLALLIAGTGP* |
Ga0081538_102740642 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MGTLIDHLATDRLRGGKLVAAYTVGLIAGVAMALIALLATGTA* |
Ga0081540_100234511 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MSTLIDHLATDRIRGGRLVLAYSIGAACGIAVAVVALLLAGTAP* |
Ga0081539_102846272 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MGTLIDHLATDRVRGGRLFAAYSVGLIVGIAVALAALLAAGTTP* |
Ga0066652_1002301773 | 3300006046 | Soil | MSTLIDHLATDRIRGGRLVLAYGIGAVFGIVVAALALMIAGTGP* |
Ga0066652_1013565782 | 3300006046 | Soil | ATDRLRGGKLVVAYTAGLLVGIAVALVALLAAGTTP* |
Ga0066652_1019671241 | 3300006046 | Soil | MSTLIEQLANDRIRGARLVLAYAVGGIFGIAVALALLAAL* |
Ga0075363_1009615073 | 3300006048 | Populus Endosphere | MSTLIDQLATDRIRGGRLVLAYSIGAIFGIALALVALVAAGP* |
Ga0075364_101874134 | 3300006051 | Populus Endosphere | MSTLIDHLATDRIRGGRLVLAYSVGAVFGIALAIVALLAAGTT* |
Ga0074051_116481522 | 3300006572 | Soil | MGTLIDHLATDRIRGGRLILAYSIGAVFGIALAIVALLAAGTGP* |
Ga0074053_111147981 | 3300006575 | Soil | REREVGMSTLIDHLATDRIRGGRLVLAYSVGAVFGIALAMVALLATGTGF* |
Ga0074053_119205093 | 3300006575 | Soil | MTTLIDHLATDRIRGGRLVLAYSIGAIFGIALAIVALVAAGTGP* |
Ga0074060_118217532 | 3300006604 | Soil | MSTLIDHLATDRIRGGRLILAYSIGAVFGIALAIVALLAAGTGP* |
Ga0079222_113160162 | 3300006755 | Agricultural Soil | MGTLIDHLATDRLRGSKLVIAYTVGLLVGIAVALVALLVTGTTP* |
Ga0079222_114711292 | 3300006755 | Agricultural Soil | EREVCMGTLIDHLATDRLRGGRLVIAYTVGLLVGVGLALVALLVTGTTP* |
Ga0074063_100661962 | 3300006953 | Soil | GMGTLIDHLATDRIRGGRLILAYSIGAVFGIALAIVALLAAGTGP* |
Ga0079219_101183191 | 3300006954 | Agricultural Soil | MSTLIDQLATDRIRGGRLVLAYTIGALCGIAVAVLAL |
Ga0079219_123612671 | 3300006954 | Agricultural Soil | MSTLIDQLASDRIRGARLVLAYVVGGIFGTAVAVLALLAAGTGP* |
Ga0066710_1008621772 | 3300009012 | Grasslands Soil | MSTLIDQLANDRIRGARLVLAYAIGGIVGIALALGLLAAL |
Ga0105245_104201042 | 3300009098 | Miscanthus Rhizosphere | VGTLIDHLTTERVRGGRLVIAYTVGVVFGIGLALVALLATGTGL* |
Ga0105245_121914641 | 3300009098 | Miscanthus Rhizosphere | REVGMGTLIDHLATDRIRGGRLVLAYSIGAIFGIALAIVALLAAGTGP* |
Ga0126307_100003347 | 3300009789 | Serpentine Soil | MSTLIDHLATDRIRGGRLVVAYTIGAVCGIAVAVVALLIAGTGP* |
Ga0126307_1000164211 | 3300009789 | Serpentine Soil | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIVVALAALLVAGTSI* |
Ga0126307_100215825 | 3300009789 | Serpentine Soil | MSTLIDHLATDRVRGGRLVLAYSIGAICGIALALLALLVTGTAI* |
Ga0126307_100362003 | 3300009789 | Serpentine Soil | MSTLIDHLATDRIRGGRLVLAYSIGAVCGIAVAVLALLIAGTGP* |
Ga0126307_100673754 | 3300009789 | Serpentine Soil | MGTLIDHLATDRLRGGKLVIAYTVGILVGVAVALVALLAAGTTP* |
Ga0126307_108883361 | 3300009789 | Serpentine Soil | MSTLIDHLASDRVRGARLVLAYAIGILVGVVLALIALVAAGTTP* |
Ga0126313_102305232 | 3300009840 | Serpentine Soil | MGTLIDHLATDRLRGGKLVVAYTVGLLVGVAVALVALLAAGTTP* |
Ga0126313_113598542 | 3300009840 | Serpentine Soil | MGTLIDHLATDRLRGGKLVIAYTVGLLVGVAVALIALLVAGTTP* |
Ga0126305_104442922 | 3300010036 | Serpentine Soil | STLIDHLATDRIRGGRLVLAYSIGAIFGIVVALAALLVAGTSI* |
Ga0126305_105358601 | 3300010036 | Serpentine Soil | MGRLIDHLATDRLRGGKLVIAYTVGILGGVAVALVALLAAGTTP* |
Ga0126304_100984112 | 3300010037 | Serpentine Soil | MTTLIDHLATDRIRGGRLVLAYTIGIIFGIAVAAAALLTAGP* |
Ga0126304_101009743 | 3300010037 | Serpentine Soil | MSTLIDHLASDRIGGGRLVLAYTVGAIFGIALALVALGAAGTGP* |
Ga0126304_101655242 | 3300010037 | Serpentine Soil | MSTLIDHLATDRVRGGRLVLAYSIGAICGIALALLALLVAGTSI* |
Ga0126315_100654061 | 3300010038 | Serpentine Soil | MGTLIDHLATDRIRGGRLVLAYTIGAIVGIALAIVALGAAGA* |
Ga0126315_101259814 | 3300010038 | Serpentine Soil | MGTLIDHLASDRVRGARLVLAYAIGILVGVVLALIALVAAGTTP* |
Ga0126315_102104692 | 3300010038 | Serpentine Soil | MTTLIDHLATDRIRGRRLVLAYTIGIIFGIAVAAAALLTAGP* |
Ga0126309_100144774 | 3300010039 | Serpentine Soil | MGTLIDQLASDRIRGTRLVIAYGIGILIGVIVALIALLAAGTTP* |
Ga0126308_103432893 | 3300010040 | Serpentine Soil | MSTLIDQLASDRIRGGRLVLAYTVGAFFGIAVALLALLVTGTA* |
Ga0126308_103484771 | 3300010040 | Serpentine Soil | MSTLIDHLASDRVRGARLVLAYAIGILVGVVLALIA |
Ga0126308_107572322 | 3300010040 | Serpentine Soil | MGTLIDHLASDRIRGGRLVVAYTIGAIFGTALAIAALGATAGL* |
Ga0126312_109753872 | 3300010041 | Serpentine Soil | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIVVALAALLAAGTSI* |
Ga0126314_102975001 | 3300010042 | Serpentine Soil | LATDRLRGGRLVIAYTVGLLVGVVVALIALLAAGTTP* |
Ga0126380_119858312 | 3300010043 | Tropical Forest Soil | VGPLIDQLATDRLRGGKLLIAYGVGLFVGIALALVALLVAGTTP* |
Ga0126310_106038882 | 3300010044 | Serpentine Soil | MSTLIDQLATDRVRGGRLVLAYSIGAIFGTALAVAALVATGTGI* |
Ga0126384_122027992 | 3300010046 | Tropical Forest Soil | MSTLIDQLATDRIRGGRLVLAYGIGAIFGIVVALAALLLAGPAA* |
Ga0126321_15044172 | 3300010145 | Soil | MSTLIDHLATDRIRGGRLVLAYGIGAVFGIAVAVLALALAGTGP* |
Ga0126306_105560672 | 3300010166 | Serpentine Soil | MGTLIDHLATDRLRGGKLVVAYTIGLLVGVVVALIALLAAGSAP* |
Ga0126306_114142751 | 3300010166 | Serpentine Soil | MNTLIDQLATDRIRGGRLVLAYIVGIVFGVAVAGAALLTAGP* |
Ga0126377_104914572 | 3300010362 | Tropical Forest Soil | MGTLIDHLATDRIRGGRLVFAYSVGAACGIVVAVLALLLAGTGP* |
Ga0126377_122363332 | 3300010362 | Tropical Forest Soil | LIDHLATDRIRGARLVLAYGIGAVFGIAVAVLALALAGTGP* |
Ga0134124_106765951 | 3300010397 | Terrestrial Soil | MSTLIDQLATDRIRGGRLVLAYGIGAAFGIIVALAALLLAGTA |
Ga0134122_127001182 | 3300010400 | Terrestrial Soil | MGTLIDHLATDRIRGGRLVLAYSIGAIFGIALAIAALLAAGTGP* |
Ga0137364_109463382 | 3300012198 | Vadose Zone Soil | REREVGMSTLIDHLATDRIRGGRLVLAYTVGAIFGIAVALVALLVAGTGP* |
Ga0137382_101767572 | 3300012200 | Vadose Zone Soil | MSTLIDHLATDRIRGGRLVLAYTVGAIFGIAVALGALLVAGTGP* |
Ga0137365_113099261 | 3300012201 | Vadose Zone Soil | MSTLIDHLATDRIRGGRLVFAYTIGAVVGIALAIIALSAAGP* |
Ga0137362_110997331 | 3300012205 | Vadose Zone Soil | MSTLIDHLATDRIRGGRLVLAYTVGAIFGIALAIVALQAAGTGP* |
Ga0150985_1101638612 | 3300012212 | Avena Fatua Rhizosphere | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIALALVALAAAGP* |
Ga0150985_1199432802 | 3300012212 | Avena Fatua Rhizosphere | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIALALVALLATGTGF* |
Ga0150985_1213111432 | 3300012212 | Avena Fatua Rhizosphere | MSTLIDHLATDRIRGGRLVLAYTIGAIFGIVVAVVALLIAGTGP* |
Ga0137372_107686582 | 3300012350 | Vadose Zone Soil | MSTLIDHLATDRIRGGRLVLAYSIGAVFGIALAIIALLAAGTGP* |
Ga0137366_105625722 | 3300012354 | Vadose Zone Soil | MSTLIDHLATDRIRGGRLVLAYAIGAIFGIALAIVALSAAGP* |
Ga0137369_104066912 | 3300012355 | Vadose Zone Soil | MSTLIDRLATDRIRGGRLVLAYSIGAVFGIALAIAALLAAGTGP* |
Ga0137371_107326062 | 3300012356 | Vadose Zone Soil | MSTLIDQLANDRIRGARLVRAYAIGGIVGIALALGLLAAL* |
Ga0137368_101304562 | 3300012358 | Vadose Zone Soil | MSTLIDHLATDRIRGGRLVLAYGIGAIFGVALAIVALSAAGP* |
Ga0134048_13676372 | 3300012400 | Grasslands Soil | MSTLIDHLATDRIRGGRLVLAYSIGAVFGIAVAVVALLVAGTGP* |
Ga0157288_100190613 | 3300012901 | Soil | MGTLIDHLATDRIRGGRLILAYSIGAVFGIALAIVALL |
Ga0137413_100888723 | 3300012924 | Vadose Zone Soil | STLIDHLATNRIRGGRLVLAYSIGAIFGTALALIALLAAGTSL* |
Ga0137404_108493982 | 3300012929 | Vadose Zone Soil | MSTLIDHLATDRIRGGRLVLAYSIGAVFGIALALAALLAAGTGP* |
Ga0162651_1000282012 | 3300012938 | Soil | MGTLIDHLATDRLRGGKLVIAYTIGLLIGIVLALVALVATGTTP* |
Ga0164300_100181001 | 3300012951 | Soil | MSALIDQLATDRIRGGRLVLAYSIGAICGIVIAALALLIAGTGP* |
Ga0164298_102763541 | 3300012955 | Soil | MSTLIDQLATDRIRGGRLVLAYGVGAAFGIIVALAALLL |
Ga0164303_114135921 | 3300012957 | Soil | MSTLIDQLATDRIRGGRLVLAYGIGAACGIIVALAALLLAGSAP* |
Ga0164299_100057823 | 3300012958 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGAICGIVIAALALLIAGTGP* |
Ga0164302_100306782 | 3300012961 | Soil | MSTLIDHLATDRIRGGRLVLAYSIGAICGIVLAVLALAIAGTGP* |
Ga0164304_118078422 | 3300012986 | Soil | MSTLIYQLATDRIRGGRLVLAYGIGAACGIIVALAALLLAGSAP* |
Ga0157378_116766902 | 3300013297 | Miscanthus Rhizosphere | MGTLIDHLATDRIRGGRLVLAYSIDAIFGIALAIVALLAAGTGP* |
Ga0120158_102642561 | 3300013772 | Permafrost | MSTLINHLATDRVKGGRLVFAYAIGGVFGTALAIAALLAAGTGP* |
Ga0137412_100754162 | 3300015242 | Vadose Zone Soil | MSTLIDHLATNRIRGGRLVLAYSIGAIFGTALALIALLAAGTSL* |
Ga0132258_105138902 | 3300015371 | Arabidopsis Rhizosphere | MGTLIDHLATDRLRGGRLLIAYVVGLVLGIGVALVALLAAAPTP* |
Ga0132258_116096931 | 3300015371 | Arabidopsis Rhizosphere | MGTLIDRLATDRLRGSRLVIAYGIGLLVGIAVALVALLVAGTTP* |
Ga0132258_124758142 | 3300015371 | Arabidopsis Rhizosphere | MSTLIDQLATDRIRGGRLVLAYGIGAAFGIIVALAALLLAGTAP* |
Ga0187785_102500402 | 3300017947 | Tropical Peatland | MSTLIDQLATDRIRGGRLVLAYSIGAVFGIALAAAALVAAGTGV |
Ga0187785_102500403 | 3300017947 | Tropical Peatland | MSTLIDQFSTDRIRGGRLVLAYGIGAVFGIAFAVAALFTWMALLGR |
Ga0184608_105328691 | 3300018028 | Groundwater Sediment | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIALALVALLAAGPA |
Ga0187788_101800882 | 3300018032 | Tropical Peatland | MSTLIDQFSTDRIRGGRLVLAYGIGAVFGIAFAVAALFAAGTTP |
Ga0184618_100601703 | 3300018071 | Groundwater Sediment | MGTLIDHLATDRIRGGRLVLAYSIGAVFGIALAIVALLAAGTGP |
Ga0066667_107900262 | 3300018433 | Grasslands Soil | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIALALIALLAAGPA |
Ga0173481_102037442 | 3300019356 | Soil | MGTLIDHLATDRIRGGRLVLAYSIGAIFGIALAIVALLAAGTGP |
Ga0173482_101112852 | 3300019361 | Soil | MGTLIDHLATDRIRGGRLILAYSIGAVFGIALAIVALLAAGTGP |
Ga0173479_106109721 | 3300019362 | Soil | MSTLIDHLATDRIRGGRLVLAYGIGAFCGIAVAVVALLLAGTGP |
Ga0179583_11192071 | 3300021286 | Vadose Zone Soil | MSTLIDRLASDRIGGGRLVLAYVIGAVFGIAVALVALAAA |
Ga0222622_104400302 | 3300022756 | Groundwater Sediment | MSTLIDQLATDRIRGGRLVLAYSIGAICGIVIAALALLIAGTGP |
Ga0222622_107063511 | 3300022756 | Groundwater Sediment | REREAGMSTLIDHLATDRIRGGRLVLAYSIGAICGIVVAALALAIAGTGP |
Ga0179589_100268753 | 3300024288 | Vadose Zone Soil | MSTLIDRLASDRIGGGRLVLAYVIGAVFGIAVALVALAAAGPA |
Ga0179589_105016422 | 3300024288 | Vadose Zone Soil | MSTLIDHLATNRIRGGRLVLAYSIGAIFGTALALIALLAAGTSL |
Ga0210142_10167732 | 3300025552 | Natural And Restored Wetlands | MGTLIDHLATDRIRGGRLILAYSIGAIFGIALALVALAAAGP |
Ga0210142_10364542 | 3300025552 | Natural And Restored Wetlands | MNTLIDHLATDRIRGGRLVLAYSIGAVFGIALAIAALLAAGTGP |
Ga0210120_10012791 | 3300025556 | Natural And Restored Wetlands | MGTLIDHLATDRIRGGRLILAYSIGAIFGIALALVALAAA |
Ga0207687_113359231 | 3300025927 | Miscanthus Rhizosphere | VGTLIDHLTTERVRGGRLVIAYTVGVVFGIGLALVALLATGTGL |
Ga0208637_10250802 | 3300027401 | Soil | MGTLIDQLSSDRIRGGRFVLAYAVGIVFGVALAIAALSAAGT |
Ga0307295_100165342 | 3300028708 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGAFCGIVIAALALLIAGTGP |
Ga0307295_100687481 | 3300028708 | Soil | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIALALVALAAAGP |
Ga0307317_103384632 | 3300028720 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGAFCGIIIAALALLIAGTGP |
Ga0307282_102355872 | 3300028784 | Soil | MGTLIDHLATDRIRGGRLVLAYTIGAIFGIALALVALSAAGP |
Ga0307312_101980714 | 3300028828 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGAFCGIVIAALALLI |
Ga0307312_111043121 | 3300028828 | Soil | MSTLIDQLASDRIRGGRLVLAYTIGAVFGIALAVMALLATG |
Ga0307289_100863162 | 3300028875 | Soil | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIALALIALAAAGP |
Ga0307289_102384442 | 3300028875 | Soil | MSTLIDQLATDRIRGGWLVLAYSIGAICGIVIAALALLIAGTGP |
Ga0307277_100278562 | 3300028881 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGAICGIVIAALALLITGTGP |
Ga0307304_104378411 | 3300028885 | Soil | MSTLIDQLATDRIRGGRLVLAYSIGALCGIVIAALALLIAGTGP |
Ga0299907_101849373 | 3300030006 | Soil | MSTLIDHLATDRIRGGRLVLAYLVGIVFGVAVAGAALLTAGP |
Ga0247826_107003552 | 3300030336 | Soil | MGTLIDHLATDRLRGRKLVIAYTIGLLIGIALALVALLAAGTTP |
Ga0102757_100445422 | 3300030785 | Soil | MGTLIDHLATDRIRGGRLVLAYSIGAVCGIIVAVLALLIAGTGP |
Ga0102757_114665092 | 3300030785 | Soil | MSTLIDQLATDRIRGGRLVLAYGIGAICGIAIAGLALLIAGTGP |
Ga0308201_103630992 | 3300031091 | Soil | AREREVGMSTLIDQLATDRIRGGRLVLAYSIGAFCGIVIAALALLIAGTGP |
Ga0308194_101017201 | 3300031421 | Soil | MSTLIDHLATDRIRGGRLVLAYSIGAIFGIALALVALLAA |
Ga0307468_1000452392 | 3300031740 | Hardwood Forest Soil | MGTLIDHLATDRLRGGKLVIAYTIGLLIGIALALVALLATGTTP |
Ga0308175_1002409833 | 3300031938 | Soil | MSTLIDQLATDRVRGARLVLAYSIGAIFGIALALVALLATGTSF |
Ga0308174_115241762 | 3300031939 | Soil | MSTLIDHLATDRIRGGRLVLAYSIGAVFGIALALVALL |
Ga0326721_102950902 | 3300032080 | Soil | MGTLIDHLATDRVRGGRLVAAYSVGLIVGVLVALAALLAAGTTP |
Ga0307470_106294961 | 3300032174 | Hardwood Forest Soil | MSTLIDHLATDRIRGGRLVLAYSIGAICGIVLAVLALAIAGTGP |
Ga0326726_100873073 | 3300033433 | Peat Soil | MGTLIDQLATDRIRGGRFVLAYSIGAVFGIALALVALMAAGTGF |
Ga0326726_102661192 | 3300033433 | Peat Soil | VSTLIDHLATDRIRGGRLVLAYSIGAIFGVALAIAALAAAGTGP |
Ga0247829_109218121 | 3300033550 | Soil | HLASDRIRGGRLVLAYTVGAIFGIAVALLALLVTGNA |
Ga0326723_0060150_89_223 | 3300034090 | Peat Soil | MGTLIDQLATDRMRGGRLVLAYSIGAVFGIALALVALMAAGTGF |
Ga0370546_022229_697_831 | 3300034681 | Soil | MSTLIDHLATDRIRGGRLVLAYSIGAFFGIALAIVALLAAGTGP |
⦗Top⦘ |