| Basic Information | |
|---|---|
| Family ID | F033416 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAGYTIQNLKDVEDQAPNFGLSPQLEARMARVPLELENFGV |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.14 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 96.05 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.791 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.859 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.859 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.107 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 0.00% Coil/Unstructured: 76.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF00133 | tRNA-synt_1 | 63.84 |
| PF09334 | tRNA-synt_1g | 12.99 |
| PF13603 | tRNA-synt_1_2 | 12.43 |
| PF01189 | Methyltr_RsmB-F | 0.56 |
| PF00106 | adh_short | 0.56 |
| PF00501 | AMP-binding | 0.56 |
| PF02784 | Orn_Arg_deC_N | 0.56 |
| PF03473 | MOSC | 0.56 |
| PF04439 | Adenyl_transf | 0.56 |
| PF00085 | Thioredoxin | 0.56 |
| PF06463 | Mob_synth_C | 0.56 |
| PF13567 | DUF4131 | 0.56 |
| PF06267 | DUF1028 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 76.84 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 76.84 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 76.84 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 76.84 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 12.99 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 12.99 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.56 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.56 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.56 |
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.92 % |
| Unclassified | root | N/A | 18.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01EM0WY | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10152949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300000878|AL9A1W_1132458 | Not Available | 572 | Open in IMG/M |
| 3300000886|AL3A1W_1138208 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 2356 | Open in IMG/M |
| 3300004479|Ga0062595_100962464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 728 | Open in IMG/M |
| 3300005093|Ga0062594_102512360 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005166|Ga0066674_10496982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300005171|Ga0066677_10712273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300005187|Ga0066675_10821795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 702 | Open in IMG/M |
| 3300005356|Ga0070674_100154485 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin070 | 1735 | Open in IMG/M |
| 3300005435|Ga0070714_101282978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter | 715 | Open in IMG/M |
| 3300005439|Ga0070711_100191301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1573 | Open in IMG/M |
| 3300005440|Ga0070705_101047078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 665 | Open in IMG/M |
| 3300005454|Ga0066687_10747606 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005467|Ga0070706_100724328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 922 | Open in IMG/M |
| 3300005526|Ga0073909_10722952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 501 | Open in IMG/M |
| 3300005540|Ga0066697_10761767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 527 | Open in IMG/M |
| 3300005540|Ga0066697_10785930 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005546|Ga0070696_101598871 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005549|Ga0070704_102037067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 533 | Open in IMG/M |
| 3300005559|Ga0066700_10844637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300005562|Ga0058697_10498741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300005577|Ga0068857_102512952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300005578|Ga0068854_100332318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1238 | Open in IMG/M |
| 3300005713|Ga0066905_100620504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 918 | Open in IMG/M |
| 3300005841|Ga0068863_101628252 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006032|Ga0066696_10031148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2855 | Open in IMG/M |
| 3300006046|Ga0066652_101074062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 763 | Open in IMG/M |
| 3300006049|Ga0075417_10606838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 557 | Open in IMG/M |
| 3300006574|Ga0074056_11797857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1242 | Open in IMG/M |
| 3300006581|Ga0074048_13414686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300006806|Ga0079220_10634282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 768 | Open in IMG/M |
| 3300006846|Ga0075430_101787660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 504 | Open in IMG/M |
| 3300006853|Ga0075420_101863554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300006914|Ga0075436_100833387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300009089|Ga0099828_10519138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1074 | Open in IMG/M |
| 3300009147|Ga0114129_11182943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
| 3300009147|Ga0114129_11836776 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009148|Ga0105243_11211123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
| 3300009156|Ga0111538_12014873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300009789|Ga0126307_10382816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1134 | Open in IMG/M |
| 3300009789|Ga0126307_11188669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300009802|Ga0105073_1049396 | Not Available | 553 | Open in IMG/M |
| 3300009840|Ga0126313_10221160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1460 | Open in IMG/M |
| 3300009840|Ga0126313_11029776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300010036|Ga0126305_11244549 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010038|Ga0126315_10989581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300010039|Ga0126309_11097980 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300010044|Ga0126310_10998373 | Not Available | 659 | Open in IMG/M |
| 3300010047|Ga0126382_11767239 | Not Available | 580 | Open in IMG/M |
| 3300010325|Ga0134064_10167383 | Not Available | 770 | Open in IMG/M |
| 3300010326|Ga0134065_10220191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300010329|Ga0134111_10171488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
| 3300010329|Ga0134111_10184949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300010335|Ga0134063_10668941 | Not Available | 534 | Open in IMG/M |
| 3300010336|Ga0134071_10605493 | Not Available | 573 | Open in IMG/M |
| 3300011003|Ga0138514_100021683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1157 | Open in IMG/M |
| 3300011422|Ga0137425_1112944 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300011996|Ga0120156_1039678 | Not Available | 862 | Open in IMG/M |
| 3300012199|Ga0137383_10911952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300012200|Ga0137382_10089540 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300012206|Ga0137380_11085279 | Not Available | 682 | Open in IMG/M |
| 3300012209|Ga0137379_10917447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300012211|Ga0137377_10904394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 814 | Open in IMG/M |
| 3300012285|Ga0137370_10070139 | Not Available | 1921 | Open in IMG/M |
| 3300012349|Ga0137387_10766744 | Not Available | 698 | Open in IMG/M |
| 3300012356|Ga0137371_10985100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300012359|Ga0137385_10903193 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012491|Ga0157329_1007074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300012498|Ga0157345_1050961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300012502|Ga0157347_1075013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300012530|Ga0136635_10391677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300012685|Ga0137397_10771080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300012911|Ga0157301_10195229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300012915|Ga0157302_10168383 | Not Available | 760 | Open in IMG/M |
| 3300012955|Ga0164298_10925276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300012957|Ga0164303_11147599 | Not Available | 564 | Open in IMG/M |
| 3300012961|Ga0164302_10508343 | Not Available | 852 | Open in IMG/M |
| 3300012972|Ga0134077_10498271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300012975|Ga0134110_10310569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300012976|Ga0134076_10593956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300012977|Ga0134087_10140909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300013296|Ga0157374_12164549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300014056|Ga0120125_1043876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300014166|Ga0134079_10238493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300014965|Ga0120193_10037194 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300015357|Ga0134072_10295590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300015357|Ga0134072_10371034 | Not Available | 555 | Open in IMG/M |
| 3300015358|Ga0134089_10380645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300015359|Ga0134085_10260500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 756 | Open in IMG/M |
| 3300015371|Ga0132258_10059826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8768 | Open in IMG/M |
| 3300015371|Ga0132258_10636458 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
| 3300015374|Ga0132255_102686424 | Not Available | 761 | Open in IMG/M |
| 3300017657|Ga0134074_1251400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300017789|Ga0136617_10484033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
| 3300018051|Ga0184620_10235692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300018054|Ga0184621_10134897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 886 | Open in IMG/M |
| 3300018054|Ga0184621_10252043 | Not Available | 629 | Open in IMG/M |
| 3300018071|Ga0184618_10379708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300018433|Ga0066667_10754122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 822 | Open in IMG/M |
| 3300018433|Ga0066667_11873555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300018465|Ga0190269_10535925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300018466|Ga0190268_11874789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 544 | Open in IMG/M |
| 3300018468|Ga0066662_10649508 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300018920|Ga0190273_12184161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 519 | Open in IMG/M |
| 3300019361|Ga0173482_10217069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300019885|Ga0193747_1120874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300020002|Ga0193730_1040532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1349 | Open in IMG/M |
| 3300020020|Ga0193738_1093753 | Not Available | 864 | Open in IMG/M |
| 3300021080|Ga0210382_10467933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300021081|Ga0210379_10115731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1123 | Open in IMG/M |
| 3300021413|Ga0193750_1042686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 982 | Open in IMG/M |
| 3300025852|Ga0209124_10335601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300025899|Ga0207642_10712881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300025899|Ga0207642_11004802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300025908|Ga0207643_10556723 | Not Available | 736 | Open in IMG/M |
| 3300025910|Ga0207684_10302996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 1378 | Open in IMG/M |
| 3300025919|Ga0207657_10348950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin510 | 1167 | Open in IMG/M |
| 3300025924|Ga0207694_11778022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300025929|Ga0207664_11872931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300025935|Ga0207709_10754312 | Not Available | 783 | Open in IMG/M |
| 3300025936|Ga0207670_11121121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300025938|Ga0207704_11835358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300025942|Ga0207689_10230473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 1531 | Open in IMG/M |
| 3300026023|Ga0207677_12202554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300026041|Ga0207639_11772442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300026095|Ga0207676_11027455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
| 3300026116|Ga0207674_12146566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300026142|Ga0207698_11435036 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 705 | Open in IMG/M |
| 3300026310|Ga0209239_1119715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300026527|Ga0209059_1332236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300026540|Ga0209376_1364225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300026547|Ga0209156_10173007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1039 | Open in IMG/M |
| 3300027050|Ga0209325_1021611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300027324|Ga0209845_1022752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
| 3300027907|Ga0207428_10261334 | Not Available | 1289 | Open in IMG/M |
| 3300028709|Ga0307279_10053543 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300028710|Ga0307322_10105409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11 | 727 | Open in IMG/M |
| 3300028711|Ga0307293_10165544 | Not Available | 704 | Open in IMG/M |
| 3300028711|Ga0307293_10202302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300028716|Ga0307311_10213085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300028718|Ga0307307_10088123 | Not Available | 937 | Open in IMG/M |
| 3300028720|Ga0307317_10053203 | Not Available | 1300 | Open in IMG/M |
| 3300028720|Ga0307317_10130913 | Not Available | 839 | Open in IMG/M |
| 3300028721|Ga0307315_10302645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300028722|Ga0307319_10228579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300028722|Ga0307319_10325734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300028744|Ga0307318_10048328 | Not Available | 1407 | Open in IMG/M |
| 3300028744|Ga0307318_10267558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300028768|Ga0307280_10214530 | Not Available | 684 | Open in IMG/M |
| 3300028768|Ga0307280_10414749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300028803|Ga0307281_10039848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1442 | Open in IMG/M |
| 3300028811|Ga0307292_10340373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300028812|Ga0247825_10443067 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300028824|Ga0307310_10370139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300028828|Ga0307312_10077885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 2022 | Open in IMG/M |
| 3300028828|Ga0307312_11126301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 519 | Open in IMG/M |
| 3300028872|Ga0307314_10110751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300028875|Ga0307289_10311256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300028876|Ga0307286_10003234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4792 | Open in IMG/M |
| 3300028881|Ga0307277_10183021 | Not Available | 915 | Open in IMG/M |
| 3300028885|Ga0307304_10315444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300028885|Ga0307304_10373968 | Not Available | 640 | Open in IMG/M |
| 3300030006|Ga0299907_10704515 | Not Available | 772 | Open in IMG/M |
| 3300030620|Ga0302046_10246706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1469 | Open in IMG/M |
| 3300031680|Ga0318574_10899028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300031716|Ga0310813_11643477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300031731|Ga0307405_11083095 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031740|Ga0307468_100734218 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300031820|Ga0307473_11182565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300031847|Ga0310907_10479909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300031908|Ga0310900_11746397 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031995|Ga0307409_101063584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin510 | 829 | Open in IMG/M |
| 3300032954|Ga0335083_10194543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1863 | Open in IMG/M |
| 3300033412|Ga0310810_10404968 | Not Available | 1406 | Open in IMG/M |
| 3300033475|Ga0310811_10431530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1422 | Open in IMG/M |
| 3300033551|Ga0247830_11654014 | Not Available | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.21% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.39% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.26% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.13% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.13% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.13% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.13% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.13% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.13% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.13% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.13% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.56% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_1119640 | 2035918004 | Soil | MSDYTHINLKDDVEDQAPNFGLSPDLETRMARVPLGMEEAGL |
| AF_2010_repII_A1DRAFT_101529491 | 3300000597 | Forest Soil | MATFTHLNLQNDVEDQAPKFGLSPDLEFRMARVPLEMENAGCSYL |
| AL9A1W_11324582 | 3300000878 | Permafrost | MAGFTKVNLKDDVDDQAPNFGLSPNLEMRMARVPLGMENSG |
| AL3A1W_11382082 | 3300000886 | Permafrost | MAGFTKVNLKDDVDDQAPNFGLSPNLEMRMARVPLGMENSGMSYQRIAPN |
| Ga0062595_1009624641 | 3300004479 | Soil | MAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLELEHSGIS |
| Ga0062594_1025123602 | 3300005093 | Soil | MAAYTKVNLKQDVDDQAPNFGLAPDLEARMARVPLELEHS |
| Ga0066674_104969821 | 3300005166 | Soil | MYQRGRIVAMSDYTHINLKEDVDDQAPNFGLSPQLESRMARVPLEM |
| Ga0066677_107122732 | 3300005171 | Soil | MAGYTKLNLREDVEDQGPNFGYEGKMEARMARVPLELEHSGVS |
| Ga0066675_108217952 | 3300005187 | Soil | MSDFTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRV |
| Ga0070674_1001544852 | 3300005356 | Miscanthus Rhizosphere | MAGYTKLNLKNDVEDQAPNFGLEGKIEARMARVPLELEQQGVS |
| Ga0070714_1012829782 | 3300005435 | Agricultural Soil | MDAMTGYTHINLKEDVEDQAPNFGMSPNLEMRMARVPLELENSGL |
| Ga0070711_1001913012 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAMTGYTHINLKEDVEDQAPNFGMSPNLEMRMARVPLEL |
| Ga0070705_1010470781 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRV |
| Ga0066687_107476061 | 3300005454 | Soil | MAGHTVQNLKEVEDQAPNFGLSPHLEARMARVPLELENFG |
| Ga0070706_1007243281 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDYTHINLKEDVDDQAPNFGLSPDLETRMARVPLGMENSGLSYI |
| Ga0073909_107229521 | 3300005526 | Surface Soil | MSDYTQLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRV |
| Ga0066697_107617672 | 3300005540 | Soil | LAGYTKVNLKDDVDDQAPNFGLEGKIEARMARVALELEHSGVSYQRLAPN |
| Ga0066697_107859302 | 3300005540 | Soil | MAAYTVQNLKEVEDQAPNFGLGPELEARMARVPLELEEF |
| Ga0070696_1015988711 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGYTKLNLRENVDDQGPNFGFEGKIEARMARVALELEQSGVS |
| Ga0070704_1020370672 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDYTHINLKEDVDDQAPNFGLSPDLETRMARVPLGMENSGLSYIRI |
| Ga0066700_108446372 | 3300005559 | Soil | MGEYTIKNLKTDVDDQATNFGLAPNLEARMARVPLELENF |
| Ga0058697_104987411 | 3300005562 | Agave | MAAYTIKNLKTDVDDQAPNFGLSPDLEVRMARVPLELESF |
| Ga0068857_1025129521 | 3300005577 | Corn Rhizosphere | MAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEQQGVSY |
| Ga0068854_1003323182 | 3300005578 | Corn Rhizosphere | MAGYTKLNLKDDVEDQAPNFGLEGKIEARMARVPLELEQQ |
| Ga0066905_1006205041 | 3300005713 | Tropical Forest Soil | MSDYTHINLREDVEDQAPNFGLAPNLETRMARVPLEMENAGLT |
| Ga0068863_1016282521 | 3300005841 | Switchgrass Rhizosphere | VAAYTIQNLKDVEDQAPKFGFSPQLEARMARVPLE |
| Ga0066696_100311481 | 3300006032 | Soil | MAGYTIQNLKDVEDQAPNFGLSPQLEARMARVPLELENFGV |
| Ga0066652_1010740621 | 3300006046 | Soil | VAEYTVQNMKEVEDQAPKFGHSPHLEARMARVPLE |
| Ga0075417_106068382 | 3300006049 | Populus Rhizosphere | MSDYTHINLKEDVDDQAPNFGLAPDLEFRMARVPLEMENAGVS |
| Ga0074056_117978571 | 3300006574 | Soil | MSDYTHLNLKDADDQAPNFGLSPDMEFRMARVPLGLEHSGISYCRVSPGFR |
| Ga0074048_134146862 | 3300006581 | Soil | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHS |
| Ga0079220_106342822 | 3300006806 | Agricultural Soil | MDAMSDYTHLNLKQDVDDQAPNFGLAPDMEFRMARVPLEMENAGV |
| Ga0075430_1017876601 | 3300006846 | Populus Rhizosphere | MAAMSGYTIANLKEVEDQAPKFGLSPDLEARFARVALDAEM |
| Ga0075420_1018635541 | 3300006853 | Populus Rhizosphere | VADYTKVNIKEEVEDQAPNFGLSPDLESRMARVPL |
| Ga0075436_1008333872 | 3300006914 | Populus Rhizosphere | MDAMTGYTHINLKEDVEDQAPNFGMSPNLEMRMARVPLELE |
| Ga0099828_105191382 | 3300009089 | Vadose Zone Soil | MSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHSGLS |
| Ga0114129_111829432 | 3300009147 | Populus Rhizosphere | MAAYTKVNLRDDVDDQAPNFGLAPDLEARMARVPLELEHSGISYQRLAPN |
| Ga0114129_118367761 | 3300009147 | Populus Rhizosphere | MSEYTHLNLKEVEDQAPKFGLSPDLEFRMARVPLEMENAGV |
| Ga0105243_112111232 | 3300009148 | Miscanthus Rhizosphere | LAGYTTLNLKDVEDQAPNFGLSPDLEARMARVPLELEQFGL |
| Ga0111538_120148732 | 3300009156 | Populus Rhizosphere | VGGYTHLNLKEDVDDQAPNFGLSPNLEARMARVPLELEGFGVSYQ |
| Ga0126307_103828163 | 3300009789 | Serpentine Soil | MSTYTKVNLREDVDDMAPRFGYAEHVEARFARRTLELEQSGI |
| Ga0126307_111886692 | 3300009789 | Serpentine Soil | MAGYTKLNLKDEVEDQAPKFGLGGKLEARMARVPLELEHSGVSYQRLS |
| Ga0105073_10493961 | 3300009802 | Groundwater Sand | MAGYTKLNLKADVEDQAPKFGFSPNLEFRMARDSL |
| Ga0126313_102211602 | 3300009840 | Serpentine Soil | MSGYTIVNLKEVEDQAPKFGYSPNLEARFARVPLEL |
| Ga0126313_110297762 | 3300009840 | Serpentine Soil | MSGYTIVNLKEVEDQAPNFGLTPDLEARFARVALD |
| Ga0126305_112445491 | 3300010036 | Serpentine Soil | MSEYTVVNMRNVEDQAEKFGLSPQLEARFARVPLEAEL |
| Ga0126315_109895811 | 3300010038 | Serpentine Soil | MSRYTHINLKDDVEDQAPKFGMSPNLEMRMARVPLELENS |
| Ga0126309_110979802 | 3300010039 | Serpentine Soil | MSDYTHLNLKEVEDQAPKFGLSPDLEFRMGRVPLDMEQAGLSYIR |
| Ga0126310_109983732 | 3300010044 | Serpentine Soil | MTDYTLINLKQDVEDQAPNFGLSPNLEARMARVPLAMENAGLSYIRIAPGF |
| Ga0126382_117672391 | 3300010047 | Tropical Forest Soil | MAAMSDYTHINLKEDVDDQAPNFGLAPHLETRMARVPLEMEHAGLSYIRIA |
| Ga0134064_101673831 | 3300010325 | Grasslands Soil | MADDTHINHKEDVEDQAPNFGLSPNLEARMARVPLEMEQAGVTYL |
| Ga0134065_102201911 | 3300010326 | Grasslands Soil | MTTYTIKNLKADVDDQAPNFGLSPQLETRMARVPLELEHAGVS |
| Ga0134111_101714882 | 3300010329 | Grasslands Soil | MADYTHINLKDDVDDQAPNFGLSPQLETRMARVPLEMENAGVSY |
| Ga0134111_101849491 | 3300010329 | Grasslands Soil | MAGYTKLNLKKDVEDQGPNFGYEGKMEARMARVPLELEHAGV |
| Ga0134063_106689411 | 3300010335 | Grasslands Soil | MSDYTHINLKEDVDDQAPNFGLSPNLEARMARVPL |
| Ga0134071_106054931 | 3300010336 | Grasslands Soil | VAAYTKVNLKEDVEDQAPNFGLSPNLEARMARVPLEMEQLLE* |
| Ga0138514_1000216832 | 3300011003 | Soil | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLEMENSGI |
| Ga0137425_11129442 | 3300011422 | Soil | MSEYTHVNLREVEDQAPKFGLSPDLEFRMGRVPLDMENAGVSYIRMA |
| Ga0120156_10396782 | 3300011996 | Permafrost | MAGFTKVNLKDDVDDQAPNFGLSPNLEMRMARVPLGMENSGMS |
| Ga0137383_109119522 | 3300012199 | Vadose Zone Soil | MAGYTKLNLREDVEDQAPNFGLEGKIEARMARVPLELEHSGV |
| Ga0137382_100895401 | 3300012200 | Vadose Zone Soil | MSAMSDYTHINLKEDVEDQAPNFGLSPNLEARMARVPLEMEQAG |
| Ga0137380_110852792 | 3300012206 | Vadose Zone Soil | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEH |
| Ga0137379_109174471 | 3300012209 | Vadose Zone Soil | LTLATIIGDMSDYTHLNLKDADDQAPNFGLSPELEFRMARVPLGLEHS |
| Ga0137377_109043942 | 3300012211 | Vadose Zone Soil | VAGYTKVNLKDDVEDQAPNFGLAPHIEARMARVPLELEH |
| Ga0137370_100701392 | 3300012285 | Vadose Zone Soil | MSAMSDYTHINLKEDVDDQAPNFGLSPNMEFRMARVPLDMENAGLSYLRIAPGFRV |
| Ga0137387_107667441 | 3300012349 | Vadose Zone Soil | MSDYTHLNLKDVEDQAPNFGLEDNLEFRMARVALGLENSGLSYCRVAPGF |
| Ga0137371_109851001 | 3300012356 | Vadose Zone Soil | MAAYTLVNLKDVEDQGPNFGLAGDLEARMARVPLELEHSGVTYQR |
| Ga0137385_109031931 | 3300012359 | Vadose Zone Soil | LGDYTKVNLKEDVDDQAERFGLAPNIEFRMGRVPL |
| Ga0157329_10070742 | 3300012491 | Arabidopsis Rhizosphere | MAAYTKVNLREDVDDQAPNFGLAPDLEARMARVPLELE |
| Ga0157345_10509611 | 3300012498 | Arabidopsis Rhizosphere | MGYTKLNLREDVEDQAPKFGLEGNLEARMARVPLEL |
| Ga0157347_10750132 | 3300012502 | Arabidopsis Rhizosphere | MAAYTKVNLREEVDDQAPNFGLAPDLEARMARVPLEVEHSGISYQRLA |
| Ga0136635_103916771 | 3300012530 | Polar Desert Sand | MAGYTIVNRRDVEDQAPKFGLSPNLHARFTGDSLG |
| Ga0137397_107710802 | 3300012685 | Vadose Zone Soil | MSDYTHLNLKDAEDQAPNFGLGDNLEFRMARVALGLE |
| Ga0157301_101952291 | 3300012911 | Soil | MPEYNKLNLKDDVEDQAPNFGLAPDLEARMARVPLELEGFGV |
| Ga0157302_101683832 | 3300012915 | Soil | MGGYTKVNLKDDVEDQGPNFGLEGKIEARMARVPLE |
| Ga0164298_109252762 | 3300012955 | Soil | MSEYTTVNLKEVEDQAPKWNLSPDLEARFARVALDAE |
| Ga0164303_111475992 | 3300012957 | Soil | MVMADYTHINLKQDVDDQAPNFGLSPNLEARMARVPLGMENAGVSYLRIGPG |
| Ga0164302_105083432 | 3300012961 | Soil | MSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHSG |
| Ga0134077_104982711 | 3300012972 | Grasslands Soil | MSGYTIVNMKEVEDQAPKFGLSPDLEARFARVALDAELIG |
| Ga0134110_103105692 | 3300012975 | Grasslands Soil | MADYTHINLKDDVDDQAPNFGLSPQLETRMARVPLEM |
| Ga0134076_105939561 | 3300012976 | Grasslands Soil | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLELEQS |
| Ga0134087_101409092 | 3300012977 | Grasslands Soil | MSGYTKLNLREEVEDQAPNFGLEGKIEMRMARVPLEC |
| Ga0157374_121645492 | 3300013296 | Miscanthus Rhizosphere | VSGYTIVNLKEVEDRATGEGPTLEARCARGALDSDHL |
| Ga0120125_10438762 | 3300014056 | Permafrost | MEMADFTKLNLKEDVEDQAPNFGLAPHLEARMARVALGMENGGLS |
| Ga0134079_102384932 | 3300014166 | Grasslands Soil | MAGYTHLNLKEVEDQAPKFDMSPDLEFRSARVPLEMEN |
| Ga0120193_100371942 | 3300014965 | Terrestrial | MSGYTIVNLKQVEDQAPNFGLSPDLEARFARVALDA |
| Ga0134072_102955902 | 3300015357 | Grasslands Soil | MAGYTVRNLKDDVDDQALNFGLSPQLESRMARVPLEL |
| Ga0134072_103710341 | 3300015357 | Grasslands Soil | MSDYTHLNLKEDVDDQAPNFGLSPNLEFRMARVPLEMENA |
| Ga0134089_103806451 | 3300015358 | Grasslands Soil | MSGYTIVNLKEVEDQAPNFGLAPDFEARFARVALDAELV |
| Ga0134085_102605001 | 3300015359 | Grasslands Soil | MAGYTIQNLKDVEDQAPNFGVPPGLEARFARQALELEKSGASY |
| Ga0132258_100598264 | 3300015371 | Arabidopsis Rhizosphere | MRYTKLNLKDDVEDQAPKFGLGENLESRMARVPLELQQSGVSYQRLGPN* |
| Ga0132258_106364581 | 3300015371 | Arabidopsis Rhizosphere | MTDYTHLNLKDDVDDQAPNFGLAPDLEFRMARVPL |
| Ga0132255_1026864241 | 3300015374 | Arabidopsis Rhizosphere | MGYTKLNLREDVEDQAPKFGLEGNLEARMARVPLELQQSGLSYQRLG |
| Ga0134074_12514002 | 3300017657 | Grasslands Soil | VGGYTIKNLKTDVEDQAPNFGYSPHIEARMARVPLGLEHS |
| Ga0136617_104840333 | 3300017789 | Polar Desert Sand | MADYTLKNLKEVKDQAPDHGMGGDMEARFARTDLELEK |
| Ga0184620_102356922 | 3300018051 | Groundwater Sediment | VAEYTDQNMKEVEDQAPKFGHSPHLEARMARVPLE |
| Ga0184621_101348972 | 3300018054 | Groundwater Sediment | MSDYTIVNLKEVDDQAPNFGLEGKIEARMARVPLELEHSGISYQRLA |
| Ga0184621_102520431 | 3300018054 | Groundwater Sediment | MAGFTKVNLKDDVDDQAPNFGLSPHIEARMARVPLEMENAGISY |
| Ga0184618_103797081 | 3300018071 | Groundwater Sediment | MAGYTKLNLREDVEDQAPNFGLEDKLEARMARVPLELEHSGLSY |
| Ga0066667_107541221 | 3300018433 | Grasslands Soil | MSDYTHLNLKEDVDDQGPNFGFAGDIEARMARVPLGMESSGV |
| Ga0066667_118735552 | 3300018433 | Grasslands Soil | MTAYTIKNLKDDVDDQAPNFGLSPDLEARMARVPLELEQFGISY |
| Ga0190269_105359252 | 3300018465 | Soil | MSGYTHLNLKDVEDQAPNFGLADNLEFRMARVALGL |
| Ga0190268_118747892 | 3300018466 | Soil | MAGYTHVNLKQDVEDQAPNFGYAPNIEARFAGGSLELENSGVS |
| Ga0066662_106495081 | 3300018468 | Grasslands Soil | MAEYTHINLKEDVDDQAPNFGLSPHIEARMARVPLGMEHAGLSYQ |
| Ga0190273_121841612 | 3300018920 | Soil | MSEYTHLNLKDVEDQAPKFGLSPDMEFRMARVPLEMENAGVSYLRVA |
| Ga0173482_102170692 | 3300019361 | Soil | MSDYTIVNLKEVEDQAPNFGLSPDLEARFARVALDAERVG |
| Ga0193747_11208741 | 3300019885 | Soil | MAGYTKVNLREDVDDQGPNFGFEGKIEARMARVPLELEQSGVSLLGLAPNF |
| Ga0193730_10405321 | 3300020002 | Soil | MSDYTLLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHSGISYFRVSPG |
| Ga0193738_10937532 | 3300020020 | Soil | MSGYTIVNLKEVEDQAENFGLAPDFEARFARVALEAE |
| Ga0210382_104679331 | 3300021080 | Groundwater Sediment | MSGYTIVNLKEVEDQALNFGLSPDLEARFGRVALDAELIG |
| Ga0210379_101157312 | 3300021081 | Groundwater Sediment | MSEYTHVNLKEVEDQAPKFGLSPDLEFRMGRVPLDMENAGV |
| Ga0193750_10426861 | 3300021413 | Soil | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLE |
| Ga0209124_103356011 | 3300025852 | Arctic Peat Soil | MAGYTLKNLKEVEDQAPTFGLSPSLEARFARGPLELESSGLS |
| Ga0207642_107128812 | 3300025899 | Miscanthus Rhizosphere | MAAYTKVNLKQDVDDQAPNFGLAPDLEARMARVPLELEHSGISYQ |
| Ga0207642_110048022 | 3300025899 | Miscanthus Rhizosphere | MAGYTKLNLKDEVEDQAPNFGLEGKIEARMARVPLELEQQG |
| Ga0207643_105567231 | 3300025908 | Miscanthus Rhizosphere | MSDFTHLNLKDVEDQAPNFGLEENLEFRMARVGLGLENSGLSYL |
| Ga0207684_103029962 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGYTKLNLRENVDDQGPNFGFEGKIEARMARVPLELEQSGVSLL |
| Ga0207657_103489501 | 3300025919 | Corn Rhizosphere | MAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPL |
| Ga0207694_117780221 | 3300025924 | Corn Rhizosphere | MAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELD |
| Ga0207664_118729312 | 3300025929 | Agricultural Soil | MSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHS |
| Ga0207709_107543121 | 3300025935 | Miscanthus Rhizosphere | MAGYTKLNLKDDVEDQAPNFGLEGKIEARMACVPLE |
| Ga0207670_111211212 | 3300025936 | Switchgrass Rhizosphere | MAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLEL |
| Ga0207704_118353582 | 3300025938 | Miscanthus Rhizosphere | MAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLELEHSGISYQ |
| Ga0207689_102304731 | 3300025942 | Miscanthus Rhizosphere | MAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEHQGVTYQ |
| Ga0207677_122025541 | 3300026023 | Miscanthus Rhizosphere | VAAYTIQNLKDVEDQAPKFGFSPQLEARMARVPLELENFGIS |
| Ga0207639_117724421 | 3300026041 | Corn Rhizosphere | MAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEHQG |
| Ga0207676_110274551 | 3300026095 | Switchgrass Rhizosphere | MSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEHSGI |
| Ga0207674_121465661 | 3300026116 | Corn Rhizosphere | MAGYTKVNLKDEVEDQAPNFGLEGKIEARMARVPLELEQQGVSYQRLAPN |
| Ga0207698_114350361 | 3300026142 | Corn Rhizosphere | MAGYTKLNLKDDVEDQAPNFGLEGKIEARMARVPL |
| Ga0209239_11197151 | 3300026310 | Grasslands Soil | VAGYTKANLKEDVEDQAPNFGLEGKIEARMARVAL |
| Ga0209059_13322361 | 3300026527 | Soil | MAGYTKLNLREDVEDQAPNFGLEENLEARMARVPLELEHSGVS |
| Ga0209376_13642251 | 3300026540 | Soil | MAGYTKLNLREDVEDQGPNFGYEGKMEARMARVPLELEHSGVSLLGL |
| Ga0209156_101730071 | 3300026547 | Soil | MAGYTHLNLKEVEDQAPKFDMSPDLEFRSARVPLEMENAGISYLRV |
| Ga0209325_10216111 | 3300027050 | Forest Soil | MAGYTKLNLKDEVEDQAPNFGLEGKIEARMARVPLEP |
| Ga0209845_10227522 | 3300027324 | Groundwater Sand | VAEYTLTNLKDVEDQAPKFGLGDNLEFRMARVALGLENSG |
| Ga0207428_102613341 | 3300027907 | Populus Rhizosphere | MSEYTIKNLKDDVGDQAPNFGLSPDLGARFARDSLDME |
| Ga0307279_100535431 | 3300028709 | Soil | VADYTVTNLKSDVEDQAPNFGMSPNLEARFARAALELQSSGVSYQ |
| Ga0307322_101054092 | 3300028710 | Soil | MAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLE |
| Ga0307293_101655442 | 3300028711 | Soil | MSDYTHLNLKDADDQAPNFGLSPDLEFRMARVPLGLEQSGLSYCRVA |
| Ga0307293_102023022 | 3300028711 | Soil | MSDYTHLNLKAAEDQAPNFGLSPDLEFRMARVPLGLEQS |
| Ga0307311_102130851 | 3300028716 | Soil | MAGYTKVNLKDDVEDQGPNFGYEGKIEARMARVPLE |
| Ga0307307_100881232 | 3300028718 | Soil | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHSGISYCRVS |
| Ga0307317_100532031 | 3300028720 | Soil | MSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGMENSGV |
| Ga0307317_101309131 | 3300028720 | Soil | MAGFTKVNLKEDVDDQAPNFGLSPNLEARMARVPLEMENAGISYQRIAPN |
| Ga0307315_103026452 | 3300028721 | Soil | MAAYTKVNLKEDVDDQAPNFGLAPDLEARMARVPLELEHSGISY |
| Ga0307319_102285792 | 3300028722 | Soil | MAGYTKLNLREVDDQAPNFGLEGKIEARMARVQLEL |
| Ga0307319_103257342 | 3300028722 | Soil | MSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHSGI |
| Ga0307318_100483282 | 3300028744 | Soil | MSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGM |
| Ga0307318_102675581 | 3300028744 | Soil | MSGYTIVNLKEVEDQAPNFGLSPDLEARFARVALDAELIG |
| Ga0307280_102145302 | 3300028768 | Soil | MSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGMENSGVSYIRIAPGFR |
| Ga0307280_104147492 | 3300028768 | Soil | VAGYTVQNLKEVEDQALNFGLSPHLEARMARVPLELEQSGV |
| Ga0307281_100398481 | 3300028803 | Soil | MSEYTHVNLKEVEDQAPKFGLSPDLEFRMGRVPLDMENAGVSYIRM |
| Ga0307292_103403731 | 3300028811 | Soil | MAGYTKLNLREVDDQAPNFGLEGKIEARMARVPLEL |
| Ga0247825_104430672 | 3300028812 | Soil | MSDYTIVNMKEVEDQAPKFGLAPDLEARFARVPLDAELIGFT |
| Ga0307310_103701392 | 3300028824 | Soil | MSEYKIVNLKEVEDQAPNFGLSPDLEARFARVALE |
| Ga0307312_100778852 | 3300028828 | Soil | MAGYTKLNLKDDVEDQAPKFGLGGTMEARMARVPLELE |
| Ga0307312_111263011 | 3300028828 | Soil | MSGYTIVNLKEVEDQAPNFGLSPDLEARFARVALDAELIGLTYQR |
| Ga0307314_101107512 | 3300028872 | Soil | MSGYTIVNLKEVEDQAPNFGLAPDFEARFARVALEAEL |
| Ga0307289_103112562 | 3300028875 | Soil | MSEYTIVNLKEVEDQAPKWNLSPDLEARFARVALD |
| Ga0307286_100032344 | 3300028876 | Soil | MPSNSSSVTVGAMSDYTHLNLKDAEDQAPNFGLSPDLEFRMARVPLGLEHS |
| Ga0307277_101830211 | 3300028881 | Soil | MAGYTKLNLKDDVDDQGPNFGYEGKIEARMARVPLELEHSGVSYLR |
| Ga0307304_103154441 | 3300028885 | Soil | MAEYTHLNLKQDVDDQAPNFGLSPNLEARMARVPLQL |
| Ga0307304_103739682 | 3300028885 | Soil | MSDYTHINLKEDVEDQAPNFGLSPNLETRMARVPLGMENSGVSYIR |
| Ga0299907_107045152 | 3300030006 | Soil | MSDYTHLNLKEVEDQAPKFGLSPDLEFRMARVPLELEQAGV |
| Ga0302046_102467061 | 3300030620 | Soil | MADYTKVNLKRDVDDSAEQHGLAPELEARFATLPLELTESAISYQRFAAN |
| Ga0318574_108990282 | 3300031680 | Soil | VAGYAIVNLKDVEDQAPAFGLSPALEARFARRPLD |
| Ga0310813_116434771 | 3300031716 | Soil | MAEYNKVNLKDDVEDQAPNFGLAPDLEARMARVPLELEGFGVSYQRVA |
| Ga0307405_110830951 | 3300031731 | Rhizosphere | MGYTKLNLKDDVEDQAPNFGLEENLEARMARVPLELQNSGLSY |
| Ga0307468_1007342182 | 3300031740 | Hardwood Forest Soil | MAAMSGYTIANLKEVEDQAPNFGMSPDLEARFARVAL |
| Ga0307473_111825651 | 3300031820 | Hardwood Forest Soil | VAAYTIQNLKDVEDQAPKFGFSPQLEARMARVPLEL |
| Ga0310907_104799092 | 3300031847 | Soil | MAGYTKVNLKDDVEDQAPNFGLEGKIEARMARVPLEMEQAGVSYQRIAPSFRV |
| Ga0310900_117463972 | 3300031908 | Soil | MSEYTHLNLKEVEDQAPKFGLSPDLEFRMGRVPLDMENAGVS |
| Ga0307409_1010635842 | 3300031995 | Rhizosphere | MGYTKLNLKDDVEDQAPNFGLEENLEARMARVPLELQ |
| Ga0335083_101945431 | 3300032954 | Soil | MVENRRCELAGYTKVNLKDDVDDQGPNFGLEGKIEARMARVPLELEHTGVSY |
| Ga0310810_104049681 | 3300033412 | Soil | MSEYTIVNLKEVEDQAPKWNLSPDLEARFARVALDAELV |
| Ga0310811_104315301 | 3300033475 | Soil | MSEYTIVNLKEVEDQAPKWNLSPDLEARFARVALDA |
| Ga0247830_116540142 | 3300033551 | Soil | MSEYTIVNLKEVEDQAPNFGLAPDFEARFARVALEAE |
| ⦗Top⦘ |