 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F033338 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 74.57 % |
| % of genes near scaffold ends (potentially truncated) | 31.64 % |
| % of genes from short scaffolds (< 2000 bps) | 78.53 % |
| Associated GOLD sequencing projects | 55 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.966 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (71.186 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.870 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (71.186 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.89% β-sheet: 0.00% Coil/Unstructured: 42.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF13148 | DUF3987 | 19.32 |
| PF12965 | DUF3854 | 3.41 |
| PF05930 | Phage_AlpA | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG3311 | DNA-binding transcriptional regulator AlpA | Transcription [K] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.97 % |
| All Organisms | root | All Organisms | 22.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002493|JGI24185J35167_1072545 | Not Available | 626 | Open in IMG/M |
| 3300002510|JGI24186J35511_1006412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2859 | Open in IMG/M |
| 3300002510|JGI24186J35511_1009022 | Not Available | 2266 | Open in IMG/M |
| 3300002510|JGI24186J35511_1029459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 892 | Open in IMG/M |
| 3300003688|Ga0061020_1029243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1552 | Open in IMG/M |
| 3300003688|Ga0061020_1111230 | Not Available | 537 | Open in IMG/M |
| 3300005243|Ga0068643_1033192 | Not Available | 1811 | Open in IMG/M |
| 3300005249|Ga0068645_1003207 | Not Available | 905 | Open in IMG/M |
| 3300005250|Ga0068635_1005338 | Not Available | 665 | Open in IMG/M |
| 3300005251|Ga0068634_1022719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2772 | Open in IMG/M |
| 3300005410|Ga0068632_1005889 | Not Available | 625 | Open in IMG/M |
| 3300005411|Ga0068647_1016685 | Not Available | 1636 | Open in IMG/M |
| 3300005413|Ga0068633_1014157 | Not Available | 972 | Open in IMG/M |
| 3300005413|Ga0068633_1016100 | Not Available | 759 | Open in IMG/M |
| 3300005414|Ga0068646_1007356 | Not Available | 826 | Open in IMG/M |
| 3300005452|Ga0068706_1065402 | Not Available | 646 | Open in IMG/M |
| 3300005452|Ga0068706_1086137 | Not Available | 549 | Open in IMG/M |
| 3300005452|Ga0068706_1101178 | Not Available | 504 | Open in IMG/M |
| 3300005453|Ga0068705_10031732 | Not Available | 1900 | Open in IMG/M |
| 3300005498|Ga0068649_1120450 | Not Available | 1896 | Open in IMG/M |
| 3300006848|Ga0101768_1045021 | Not Available | 2120 | Open in IMG/M |
| 3300006848|Ga0101768_1213494 | Not Available | 1129 | Open in IMG/M |
| 3300006849|Ga0102029_1042138 | Not Available | 1535 | Open in IMG/M |
| 3300006849|Ga0102029_1099686 | Not Available | 500 | Open in IMG/M |
| 3300007000|Ga0102499_1000854 | Not Available | 648 | Open in IMG/M |
| 3300010023|Ga0130028_100666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1835 | Open in IMG/M |
| 3300010023|Ga0130028_103007 | Not Available | 819 | Open in IMG/M |
| 3300010023|Ga0130028_104536 | Not Available | 629 | Open in IMG/M |
| 3300010182|Ga0124917_1137192 | Not Available | 1042 | Open in IMG/M |
| 3300010184|Ga0124920_1041516 | Not Available | 1017 | Open in IMG/M |
| 3300010184|Ga0124920_1112217 | Not Available | 1949 | Open in IMG/M |
| 3300010193|Ga0124924_1022070 | Not Available | 959 | Open in IMG/M |
| 3300010193|Ga0124924_1260034 | Not Available | 513 | Open in IMG/M |
| 3300010194|Ga0124921_1207040 | Not Available | 1457 | Open in IMG/M |
| 3300010194|Ga0124921_1213203 | Not Available | 1066 | Open in IMG/M |
| 3300010196|Ga0124923_1096912 | Not Available | 926 | Open in IMG/M |
| 3300010257|Ga0124913_1295679 | Not Available | 912 | Open in IMG/M |
| 3300026237|Ga0209750_1003049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 5288 | Open in IMG/M |
| 3300026237|Ga0209750_1003376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. | 4939 | Open in IMG/M |
| 3300026237|Ga0209750_1026847 | Not Available | 1172 | Open in IMG/M |
| 3300026237|Ga0209750_1086736 | Not Available | 531 | Open in IMG/M |
| 3300026280|Ga0209017_10032632 | Not Available | 1330 | Open in IMG/M |
| 3300026509|Ga0209809_1009139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 4801 | Open in IMG/M |
| 3300027279|Ga0209691_1008903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 3383 | Open in IMG/M |
| 3300027279|Ga0209691_1038425 | Not Available | 982 | Open in IMG/M |
| 3300027279|Ga0209691_1055924 | Not Available | 741 | Open in IMG/M |
| 3300027279|Ga0209691_1060442 | Not Available | 698 | Open in IMG/M |
| 3300027279|Ga0209691_1067652 | Not Available | 639 | Open in IMG/M |
| 3300027279|Ga0209691_1084562 | Not Available | 531 | Open in IMG/M |
| 3300028761|Ga0272447_1004701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5580 | Open in IMG/M |
| 3300028761|Ga0272447_1014851 | Not Available | 1884 | Open in IMG/M |
| 3300031245|Ga0308395_1008844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4144 | Open in IMG/M |
| 3300031245|Ga0308395_1021796 | Not Available | 2091 | Open in IMG/M |
| 3300031245|Ga0308395_1035796 | Not Available | 1418 | Open in IMG/M |
| 3300031245|Ga0308395_1037077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 1380 | Open in IMG/M |
| 3300031245|Ga0308395_1054575 | Not Available | 1030 | Open in IMG/M |
| 3300031245|Ga0308395_1094322 | Not Available | 693 | Open in IMG/M |
| 3300031245|Ga0308395_1095036 | Not Available | 689 | Open in IMG/M |
| 3300031245|Ga0308395_1122549 | Not Available | 577 | Open in IMG/M |
| 3300031245|Ga0308395_1128633 | Not Available | 558 | Open in IMG/M |
| 3300031508|Ga0308394_1020715 | Not Available | 1912 | Open in IMG/M |
| 3300031508|Ga0308394_1030520 | Not Available | 1428 | Open in IMG/M |
| 3300031508|Ga0308394_1039384 | Not Available | 1176 | Open in IMG/M |
| 3300031508|Ga0308394_1042373 | Not Available | 1112 | Open in IMG/M |
| 3300031508|Ga0308394_1065058 | Not Available | 807 | Open in IMG/M |
| 3300031508|Ga0308394_1093936 | Not Available | 617 | Open in IMG/M |
| 3300031508|Ga0308394_1124577 | Not Available | 506 | Open in IMG/M |
| 3300031509|Ga0308399_1012355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2317 | Open in IMG/M |
| 3300031509|Ga0308399_1017603 | Not Available | 1856 | Open in IMG/M |
| 3300031509|Ga0308399_1030497 | Not Available | 1288 | Open in IMG/M |
| 3300031509|Ga0308399_1078458 | Not Available | 679 | Open in IMG/M |
| 3300031512|Ga0308397_1021088 | Not Available | 1911 | Open in IMG/M |
| 3300031512|Ga0308397_1022817 | Not Available | 1800 | Open in IMG/M |
| 3300031512|Ga0308397_1040521 | Not Available | 1190 | Open in IMG/M |
| 3300031512|Ga0308397_1043494 | Not Available | 1130 | Open in IMG/M |
| 3300031512|Ga0308397_1067935 | Not Available | 820 | Open in IMG/M |
| 3300031513|Ga0308412_1008837 | Not Available | 4885 | Open in IMG/M |
| 3300031514|Ga0308390_1076633 | Not Available | 766 | Open in IMG/M |
| 3300031514|Ga0308390_1102712 | Not Available | 611 | Open in IMG/M |
| 3300031515|Ga0308396_1019775 | All Organisms → Viruses → Predicted Viral | 1836 | Open in IMG/M |
| 3300031515|Ga0308396_1033140 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
| 3300031515|Ga0308396_1044667 | Not Available | 1015 | Open in IMG/M |
| 3300031516|Ga0308398_1089799 | Not Available | 683 | Open in IMG/M |
| 3300031517|Ga0308392_1010441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2828 | Open in IMG/M |
| 3300031517|Ga0308392_1051607 | Not Available | 944 | Open in IMG/M |
| 3300031517|Ga0308392_1056714 | Not Available | 884 | Open in IMG/M |
| 3300031517|Ga0308392_1118129 | Not Available | 533 | Open in IMG/M |
| 3300031518|Ga0308389_1002927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae → Gloeomargarita | 10308 | Open in IMG/M |
| 3300031518|Ga0308389_1082638 | Not Available | 761 | Open in IMG/M |
| 3300031567|Ga0308391_1014337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2072 | Open in IMG/M |
| 3300031567|Ga0308391_1125517 | Not Available | 524 | Open in IMG/M |
| 3300031568|Ga0308393_1010288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2883 | Open in IMG/M |
| 3300031568|Ga0308393_1026259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1512 | Open in IMG/M |
| 3300031568|Ga0308393_1114619 | Not Available | 566 | Open in IMG/M |
| 3300031767|Ga0308401_1010592 | Not Available | 2227 | Open in IMG/M |
| 3300031767|Ga0308401_1056666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 786 | Open in IMG/M |
| 3300031767|Ga0308401_1070242 | Not Available | 689 | Open in IMG/M |
| 3300031776|Ga0308415_1018113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2093 | Open in IMG/M |
| 3300031783|Ga0308418_1007256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. PCC 7502 | 4298 | Open in IMG/M |
| 3300031783|Ga0308418_1052459 | Not Available | 991 | Open in IMG/M |
| 3300031783|Ga0308418_1077962 | Not Available | 751 | Open in IMG/M |
| 3300031812|Ga0308411_10132616 | Not Available | 905 | Open in IMG/M |
| 3300031812|Ga0308411_10175811 | Not Available | 739 | Open in IMG/M |
| 3300031830|Ga0308409_1055951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 964 | Open in IMG/M |
| 3300031830|Ga0308409_1058627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 934 | Open in IMG/M |
| 3300031830|Ga0308409_1084912 | Not Available | 721 | Open in IMG/M |
| 3300031830|Ga0308409_1086119 | Not Available | 714 | Open in IMG/M |
| 3300031830|Ga0308409_1098277 | Not Available | 652 | Open in IMG/M |
| 3300031830|Ga0308409_1129157 | Not Available | 540 | Open in IMG/M |
| 3300031865|Ga0308408_1005063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 4724 | Open in IMG/M |
| 3300031865|Ga0308408_1005784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 4320 | Open in IMG/M |
| 3300031865|Ga0308408_1005903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 4256 | Open in IMG/M |
| 3300031865|Ga0308408_1018416 | Not Available | 1988 | Open in IMG/M |
| 3300031865|Ga0308408_1084003 | Not Available | 724 | Open in IMG/M |
| 3300031865|Ga0308408_1090400 | Not Available | 689 | Open in IMG/M |
| 3300031875|Ga0308405_1038798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1389 | Open in IMG/M |
| 3300031875|Ga0308405_1063055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 979 | Open in IMG/M |
| 3300031875|Ga0308405_1081241 | Not Available | 817 | Open in IMG/M |
| 3300031875|Ga0308405_1086175 | Not Available | 783 | Open in IMG/M |
| 3300031875|Ga0308405_1119004 | Not Available | 626 | Open in IMG/M |
| 3300031878|Ga0308404_1011055 | Not Available | 2146 | Open in IMG/M |
| 3300031878|Ga0308404_1071484 | Not Available | 686 | Open in IMG/M |
| 3300031878|Ga0308404_1073694 | Not Available | 674 | Open in IMG/M |
| 3300031878|Ga0308404_1104260 | Not Available | 550 | Open in IMG/M |
| 3300031878|Ga0308404_1119806 | Not Available | 507 | Open in IMG/M |
| 3300031948|Ga0308406_1052749 | Not Available | 912 | Open in IMG/M |
| 3300031948|Ga0308406_1054452 | Not Available | 892 | Open in IMG/M |
| 3300031948|Ga0308406_1066057 | Not Available | 781 | Open in IMG/M |
| 3300031948|Ga0308406_1086751 | Not Available | 649 | Open in IMG/M |
| 3300031948|Ga0308406_1097059 | Not Available | 602 | Open in IMG/M |
| 3300031950|Ga0308417_1089923 | Not Available | 1119 | Open in IMG/M |
| 3300031958|Ga0308410_1023825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 2415 | Open in IMG/M |
| 3300031966|Ga0308420_1157874 | Not Available | 676 | Open in IMG/M |
| 3300031966|Ga0308420_1160436 | Not Available | 668 | Open in IMG/M |
| 3300031980|Ga0308403_1016773 | Not Available | 1738 | Open in IMG/M |
| 3300031980|Ga0308403_1057440 | Not Available | 796 | Open in IMG/M |
| 3300031980|Ga0308403_1073150 | Not Available | 683 | Open in IMG/M |
| 3300032033|Ga0308402_1047198 | Not Available | 863 | Open in IMG/M |
| 3300032034|Ga0308407_1007023 | Not Available | 3600 | Open in IMG/M |
| 3300032034|Ga0308407_1013618 | Not Available | 2296 | Open in IMG/M |
| 3300032034|Ga0308407_1053745 | Not Available | 905 | Open in IMG/M |
| 3300032045|Ga0308400_1000983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 9646 | Open in IMG/M |
| 3300032045|Ga0308400_1008020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 2870 | Open in IMG/M |
| 3300032045|Ga0308400_1023941 | Not Available | 1504 | Open in IMG/M |
| 3300032045|Ga0308400_1042482 | Not Available | 1041 | Open in IMG/M |
| 3300032045|Ga0308400_1105286 | Not Available | 570 | Open in IMG/M |
| 3300032049|Ga0308416_1002726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae → Gloeomargarita | 5530 | Open in IMG/M |
| 3300032049|Ga0308416_1066916 | Not Available | 693 | Open in IMG/M |
| 3300032049|Ga0308416_1073956 | Not Available | 645 | Open in IMG/M |
| 3300032056|Ga0308310_1032609 | Not Available | 1612 | Open in IMG/M |
| 3300032056|Ga0308310_1121870 | Not Available | 596 | Open in IMG/M |
| 3300032056|Ga0308310_1126306 | Not Available | 580 | Open in IMG/M |
| 3300032057|Ga0308421_1051119 | Not Available | 1153 | Open in IMG/M |
| 3300032057|Ga0308421_1092950 | Not Available | 742 | Open in IMG/M |
| 3300032057|Ga0308421_1106720 | Not Available | 669 | Open in IMG/M |
| 3300032058|Ga0308419_1072747 | Not Available | 1079 | Open in IMG/M |
| 3300032058|Ga0308419_1162123 | Not Available | 573 | Open in IMG/M |
| 3300032356|Ga0308414_1011638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. | 4881 | Open in IMG/M |
| 3300032356|Ga0308414_1011638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. | 4881 | Open in IMG/M |
| 3300032356|Ga0308414_1038356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2145 | Open in IMG/M |
| 3300032356|Ga0308414_1109136 | Not Available | 955 | Open in IMG/M |
| 3300032356|Ga0308414_1154205 | Not Available | 717 | Open in IMG/M |
| 3300033886|Ga0308413_003157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. | 8036 | Open in IMG/M |
| 3300033886|Ga0308413_030802 | Not Available | 1712 | Open in IMG/M |
| 3300033886|Ga0308413_035457 | Not Available | 1543 | Open in IMG/M |
| 3300033886|Ga0308413_038815 | Not Available | 1442 | Open in IMG/M |
| 3300033886|Ga0308413_055677 | Not Available | 1106 | Open in IMG/M |
| 3300033886|Ga0308413_089139 | Not Available | 787 | Open in IMG/M |
| 3300033886|Ga0308413_123191 | Not Available | 627 | Open in IMG/M |
| 3300033886|Ga0308413_154856 | Not Available | 535 | Open in IMG/M |
| 3300033886|Ga0308413_159714 | Not Available | 524 | Open in IMG/M |
| 3300034646|Ga0372965_033298 | Not Available | 716 | Open in IMG/M |
| 3300034649|Ga0372972_015650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | 1272 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 71.19% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 19.77% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 6.21% |
| Terrestrial Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat | 1.69% |
| Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat | 1.13% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 | Environmental | Open in IMG/M |
| 3300002510 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300003688 | Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300005243 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005249 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005250 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005251 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005410 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005411 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005413 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005414 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005498 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006848 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006849 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007000 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010023 | Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly | Environmental | Open in IMG/M |
| 3300010182 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010184 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010193 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010194 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010196 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010257 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300026237 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026280 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028761 | Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3 | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031514 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149 | Environmental | Open in IMG/M |
| 3300031515 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2 | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031518 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148 | Environmental | Open in IMG/M |
| 3300031567 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1 | Environmental | Open in IMG/M |
| 3300031568 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031776 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031830 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4 | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031948 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031958 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300031980 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3 | Environmental | Open in IMG/M |
| 3300032033 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2 | Environmental | Open in IMG/M |
| 3300032034 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2 | Environmental | Open in IMG/M |
| 3300032045 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65 | Environmental | Open in IMG/M |
| 3300032049 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60 | Environmental | Open in IMG/M |
| 3300032056 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65 | Environmental | Open in IMG/M |
| 3300032057 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300033886 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd | Environmental | Open in IMG/M |
| 3300034646 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0000_MSt4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034649 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24185J35167_10725451 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERNNSIR* |
| JGI24186J35511_10064121 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MKRTNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGHKNSVR* |
| JGI24186J35511_10090222 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MSTLLSGGSMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR* |
| JGI24186J35511_10294591 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRXRKNVRXNSIR* |
| Ga0061020_10292431 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR* |
| Ga0061020_11112301 | 3300003688 | Anoxygenic And Chlorotrophic Microbial Mat | MKRSNLHNELYKLALGMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR* |
| Ga0068643_10331921 | 3300005243 | Anoxygenic And Chlorotrophic Microbial Mat | GGSMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR* |
| Ga0068645_10032071 | 3300005249 | Anoxygenic And Chlorotrophic Microbial Mat | PGGSMSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR* |
| Ga0068635_10053381 | 3300005250 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNGHKNSVR* |
| Ga0068634_10227193 | 3300005251 | Anoxygenic And Chlorotrophic Microbial Mat | TSTLPPGGSMKRTNLHNELYKLAIAMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR* |
| Ga0068632_10058891 | 3300005410 | Anoxygenic And Chlorotrophic Microbial Mat | LHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR* |
| Ga0068647_10166852 | 3300005411 | Anoxygenic And Chlorotrophic Microbial Mat | MSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR* |
| Ga0068633_10141572 | 3300005413 | Anoxygenic And Chlorotrophic Microbial Mat | MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR* |
| Ga0068633_10161001 | 3300005413 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLAIAMHKYNGRGVKWNLDYLLSQEQVRNKARNNSIR* |
| Ga0068646_10073561 | 3300005414 | Anoxygenic And Chlorotrophic Microbial Mat | MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR* |
| Ga0068706_10654022 | 3300005452 | Anoxygenic And Chlorotrophic | LHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGNKNSVR* |
| Ga0068706_10861371 | 3300005452 | Anoxygenic And Chlorotrophic | MTSKNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR* |
| Ga0068706_11011781 | 3300005452 | Anoxygenic And Chlorotrophic | RGWVQASSVMSTLFSGGGMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARSNKHNNRVR* |
| Ga0068705_100317321 | 3300005453 | Anoxygenic And Chlorotrophic | NKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR* |
| Ga0068649_11204502 | 3300005498 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR* |
| Ga0101768_10450211 | 3300006848 | Anoxygenic And Chlorotrophic Microbial Mat | MSTNKLHNELYKLAIAMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR* |
| Ga0101768_12134943 | 3300006848 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRTRKNGHKNSVR* |
| Ga0102029_10421382 | 3300006849 | Anoxygenic And Chlorotrophic Microbial Mat | SRTSTLPPGGSMKRTNLHNELYKLAIAMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR* |
| Ga0102029_10996861 | 3300006849 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR* |
| Ga0102499_10008541 | 3300007000 | Anoxygenic And Chlorotrophic Microbial Mat | MTSKNLHNELYKLALEMNKYNGRGVKHNLDYLLSQEQVRNKARNNSIR* |
| Ga0130028_1006662 | 3300010023 | Terrestrial Hot Spring Microbial Mat | MKRSNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR* |
| Ga0130028_1030071 | 3300010023 | Terrestrial Hot Spring Microbial Mat | SMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR* |
| Ga0130028_1045361 | 3300010023 | Terrestrial Hot Spring Microbial Mat | MKRSNLHNELYKLAIAMHKYNGRGVKWNLDHLLSQEQVPKKTRNNSSR* |
| Ga0124917_11371922 | 3300010182 | Anoxygenic And Chlorotrophic Microbial Mat | MKRTNLHNELYKLAIAMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR* |
| Ga0124920_10415162 | 3300010184 | Anoxygenic And Chlorotrophic Microbial Mat | SMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR* |
| Ga0124920_11122172 | 3300010184 | Anoxygenic And Chlorotrophic Microbial Mat | MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRTRKNGHKNSVR* |
| Ga0124924_10220701 | 3300010193 | Anoxygenic And Chlorotrophic Microbial Mat | SSRTSTLPPGGSMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR |
| Ga0124924_12600341 | 3300010193 | Anoxygenic And Chlorotrophic Microbial Mat | MKRTNLHNELYKLAIAMHKYNGRGVKHNLDYLVRQVEERNKAN |
| Ga0124921_12070402 | 3300010194 | Anoxygenic And Chlorotrophic Microbial Mat | MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNGHKNSVR* |
| Ga0124921_12132031 | 3300010194 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVR* |
| Ga0124923_10969121 | 3300010196 | Anoxygenic And Chlorotrophic Microbial Mat | TLPPGGSMSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR* |
| Ga0124913_12956791 | 3300010257 | Anoxygenic And Chlorotrophic Microbial Mat | HNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR* |
| Ga0209750_10030493 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLAIAMHKYNGRGVKWNLDYLLSQEQVRNKARNNSIR |
| Ga0209750_10033765 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MSTLLSGGSMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR |
| Ga0209750_10268472 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR |
| Ga0209750_10867362 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRTRKNGHKNSVR |
| Ga0209017_100326321 | 3300026280 | Anoxygenic And Chlorotrophic Microbial Mat | MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERNNSIR |
| Ga0209809_10091391 | 3300026509 | Anoxygenic And Chlorotrophic | RTSSRASTLPPGGSMSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0209691_10089032 | 3300027279 | Anoxygenic And Chlorotrophic | MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR |
| Ga0209691_10384251 | 3300027279 | Anoxygenic And Chlorotrophic | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0209691_10559241 | 3300027279 | Anoxygenic And Chlorotrophic | MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQVRNKARNNSIR |
| Ga0209691_10604422 | 3300027279 | Anoxygenic And Chlorotrophic | MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERKNSIR |
| Ga0209691_10676522 | 3300027279 | Anoxygenic And Chlorotrophic | MRSKYWHNELYKLAIAMHKVNGRGVKRNLDYLVRQEQVRNK |
| Ga0209691_10845621 | 3300027279 | Anoxygenic And Chlorotrophic | MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARSNKHNNRVR |
| Ga0272447_10047014 | 3300028761 | Microbial Mat | MKRSNLRNELYKLAIAMHKYNGRGVKWNLDYLLRQEQVPKKARNNSIR |
| Ga0272447_10148513 | 3300028761 | Microbial Mat | MASKNLHNELYKLAIAMAKLNGKSVKQNLDLLLSQVRTRNNGHNNSVR |
| Ga0308395_10088441 | 3300031245 | Hot Spring Phototrophic Mat | LSGRTMKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR |
| Ga0308395_10217962 | 3300031245 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGHKNSVR |
| Ga0308395_10357962 | 3300031245 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQVPKKTRNNSIR |
| Ga0308395_10370771 | 3300031245 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR |
| Ga0308395_10545751 | 3300031245 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308395_10943221 | 3300031245 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLALEIHKYNGQGVKHNLDLLLSQVRARNKERKNSIR |
| Ga0308395_10950361 | 3300031245 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARKNVRNNSIR |
| Ga0308395_11225491 | 3300031245 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMHKYNGKGVKQNLDLLLSQVRARKNGHKNSVR |
| Ga0308395_11286331 | 3300031245 | Hot Spring Phototrophic Mat | ALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308394_10207154 | 3300031508 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKKERKNSIR |
| Ga0308394_10305203 | 3300031508 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR |
| Ga0308394_10393844 | 3300031508 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVR |
| Ga0308394_10423731 | 3300031508 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERKNSIR |
| Ga0308394_10650581 | 3300031508 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNRVR |
| Ga0308394_10939361 | 3300031508 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKKERKNSIR |
| Ga0308394_11245771 | 3300031508 | Hot Spring Phototrophic Mat | MRSKYWHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0308399_10123552 | 3300031509 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308399_10176031 | 3300031509 | Hot Spring Phototrophic Mat | MTSKNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKNVRKNSIR |
| Ga0308399_10304971 | 3300031509 | Hot Spring Phototrophic Mat | MTSKNLRNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308399_10784581 | 3300031509 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR |
| Ga0308397_10210883 | 3300031512 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLSQEQVRNKARNNSIR |
| Ga0308397_10228171 | 3300031512 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNGHKNSVR |
| Ga0308397_10405213 | 3300031512 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVQ |
| Ga0308397_10434941 | 3300031512 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMHKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR |
| Ga0308397_10679351 | 3300031512 | Hot Spring Phototrophic Mat | WHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308397_11263801 | 3300031512 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGKGVKQNLDYLLRQEQAR |
| Ga0308412_10088374 | 3300031513 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGRGVKRNLDYLLSQEQVRNKARNNSIR |
| Ga0308390_10766332 | 3300031514 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR |
| Ga0308390_11027122 | 3300031514 | Hot Spring Phototrophic Mat | HNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308396_10197751 | 3300031515 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKNGHKNSVR |
| Ga0308396_10331402 | 3300031515 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLALEMHKYNSMGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0308396_10446672 | 3300031515 | Hot Spring Phototrophic Mat | RTSSRTSTLPPGGSMKRTNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGHKNSVR |
| Ga0308398_10897992 | 3300031516 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARNKERKNSIR |
| Ga0308392_10104411 | 3300031517 | Hot Spring Phototrophic Mat | SMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR |
| Ga0308392_10516072 | 3300031517 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKHNGQGVKRNLDLLLSQVQVRNNGHNNNVR |
| Ga0308392_10567143 | 3300031517 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308392_11181291 | 3300031517 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR |
| Ga0308389_10029279 | 3300031518 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNARNNSIR |
| Ga0308389_10826382 | 3300031518 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARNKERNNSIR |
| Ga0308391_10143373 | 3300031567 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIALHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR |
| Ga0308391_10765221 | 3300031567 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKYNGRGVKWNLDYLLRHEQ |
| Ga0308391_11255171 | 3300031567 | Hot Spring Phototrophic Mat | MSTNKLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308393_10102881 | 3300031568 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR |
| Ga0308393_10262591 | 3300031568 | Hot Spring Phototrophic Mat | FSGGSMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERNNSIR |
| Ga0308393_11146191 | 3300031568 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR |
| Ga0308401_10105924 | 3300031767 | Hot Spring Phototrophic Mat | MSTNKLRNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNRHNNNVR |
| Ga0308401_10566662 | 3300031767 | Hot Spring Phototrophic Mat | SMKRTNLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308401_10702421 | 3300031767 | Hot Spring Phototrophic Mat | MSTNKLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNRHNNNV |
| Ga0308415_10181131 | 3300031776 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARNNGHKNSVR |
| Ga0308418_10072564 | 3300031783 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKKERKNSIR |
| Ga0308418_10524594 | 3300031783 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSN |
| Ga0308418_10779621 | 3300031783 | Hot Spring Phototrophic Mat | RGWVQTSSRVSTLLSGRTMKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR |
| Ga0308411_101326161 | 3300031812 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLAIAMHKYNGRGVKWNLDHLLSQEQVPKKTRNNSSR |
| Ga0308411_101758112 | 3300031812 | Hot Spring Phototrophic Mat | MSTLPSGGSMTSKNLHNELYKLAIAMARVNGKTVKQNLDYLLSQEQVPKKERKNSIR |
| Ga0308409_10559511 | 3300031830 | Hot Spring Phototrophic Mat | YWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERNNSIR |
| Ga0308409_10586271 | 3300031830 | Hot Spring Phototrophic Mat | LALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308409_10849121 | 3300031830 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR |
| Ga0308409_10861191 | 3300031830 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308409_10982771 | 3300031830 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKKERKNSIR |
| Ga0308409_11291571 | 3300031830 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNEHKNSVR |
| Ga0308408_10050631 | 3300031865 | Hot Spring Phototrophic Mat | MSTLFSGGGMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVR |
| Ga0308408_10057842 | 3300031865 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQIRTRKNVRNNSIR |
| Ga0308408_10059031 | 3300031865 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0308408_10184162 | 3300031865 | Hot Spring Phototrophic Mat | LHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR |
| Ga0308408_10840031 | 3300031865 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARNKERKNSIR |
| Ga0308408_10904001 | 3300031865 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKWNLDYLLRQEQVRNK |
| Ga0308405_10387981 | 3300031875 | Hot Spring Phototrophic Mat | SMKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308405_10630551 | 3300031875 | Hot Spring Phototrophic Mat | SMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERNNSIR |
| Ga0308405_10812411 | 3300031875 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARNKERKNSIR |
| Ga0308405_10861751 | 3300031875 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGRGVKWNLDYLLSQEQVRNKARNNSIR |
| Ga0308405_11190041 | 3300031875 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQARN |
| Ga0308404_10110552 | 3300031878 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRVRKNVRNNSIR |
| Ga0308404_10714842 | 3300031878 | Hot Spring Phototrophic Mat | MELDPVTVNELYKLAIAMNKHNNKGVKRNLDLLLSQVRTRSNKHNNRVR |
| Ga0308404_10736941 | 3300031878 | Hot Spring Phototrophic Mat | MSTNKLRNELYKLAIAMHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR |
| Ga0308404_11042601 | 3300031878 | Hot Spring Phototrophic Mat | MTSKNLRNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308404_11198061 | 3300031878 | Hot Spring Phototrophic Mat | MHPNHQHNELYKLAIAMHKVNGKGVKRNLDYLLRQEQVRNKVRNNSIR |
| Ga0308406_10527491 | 3300031948 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308406_10544521 | 3300031948 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR |
| Ga0308406_10660571 | 3300031948 | Hot Spring Phototrophic Mat | KYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNRVR |
| Ga0308406_10867511 | 3300031948 | Hot Spring Phototrophic Mat | RGWVQTSTGTLTLLSGGSMKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308406_10970591 | 3300031948 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQAR |
| Ga0308417_10899231 | 3300031950 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNSMGVKQNLDLLLSQVRTRKKERKNSIR |
| Ga0308410_10238254 | 3300031958 | Hot Spring Phototrophic Mat | MTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR |
| Ga0308420_11578741 | 3300031966 | Hot Spring Phototrophic Mat | MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSV |
| Ga0308420_11604361 | 3300031966 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNGHKNSVR |
| Ga0308403_10167732 | 3300031980 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKVNGRGVKQNLDLLLSQVRARNNGHKNSVR |
| Ga0308403_10574401 | 3300031980 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKYNGRGVKHNLDYLLRQVEERNKAN |
| Ga0308403_10731501 | 3300031980 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLAIAMHKVNGKGVKRNLDYLLSQEQVRNKARNNSIR |
| Ga0308402_10471981 | 3300032033 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNRHNNNVR |
| Ga0308407_10070233 | 3300032034 | Hot Spring Phototrophic Mat | NLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARNKERKNSIR |
| Ga0308407_10136184 | 3300032034 | Hot Spring Phototrophic Mat | MTSKNLHNELYKLAIAMHKYNGKGVKQNLDYLLSQEQVRNKARNNSIR |
| Ga0308407_10537451 | 3300032034 | Hot Spring Phototrophic Mat | GGSMKRTNLHNELYKLALEMHKYNSMGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0308407_10972721 | 3300032034 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVR |
| Ga0308400_100098310 | 3300032045 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKVNGKGVKHNLDLLLSQVQVRNNRHNNNVR |
| Ga0308400_10080204 | 3300032045 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKNVRKNSIR |
| Ga0308400_10239412 | 3300032045 | Hot Spring Phototrophic Mat | MSTNKLYNELYKLAIAMHKHNGRGVKHNLDLLLSQVRARKNVRKNSIR |
| Ga0308400_10424822 | 3300032045 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVRARKNVRKNSIR |
| Ga0308400_11052861 | 3300032045 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLAIAMHKHNGRGVKRNLDLLLSQVQVRNNG |
| Ga0308416_10027265 | 3300032049 | Hot Spring Phototrophic Mat | MSTNKLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308416_10669161 | 3300032049 | Hot Spring Phototrophic Mat | MSTNKLHNELYKLAIAMHKYNGRGVKRNLDLLLSQVRARKNVRKNSIR |
| Ga0308416_10739561 | 3300032049 | Hot Spring Phototrophic Mat | MSTNKLHNELYKLAIAMHKHNGRGVKRNLDLLLSQVQVRNNGHNNNVR |
| Ga0308310_10326092 | 3300032056 | Hot Spring Phototrophic Mat | SMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR |
| Ga0308310_11218701 | 3300032056 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNS |
| Ga0308310_11263061 | 3300032056 | Hot Spring Phototrophic Mat | SSRTSTLPPGGSMKRTNLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0308421_10511192 | 3300032057 | Hot Spring Phototrophic Mat | KSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLSQEQVRNKARNNSIR |
| Ga0308421_10929501 | 3300032057 | Hot Spring Phototrophic Mat | GSMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR |
| Ga0308421_11067201 | 3300032057 | Hot Spring Phototrophic Mat | MSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0308419_10727472 | 3300032058 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRERKNKHNNRVR |
| Ga0308419_11621232 | 3300032058 | Hot Spring Phototrophic Mat | MRRSNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNVRKNSIR |
| Ga0308414_10116381 | 3300032356 | Hot Spring Phototrophic Mat | MSTLFSGGSMKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERKNSIR |
| Ga0308414_10116387 | 3300032356 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARN |
| Ga0308414_10383563 | 3300032356 | Hot Spring Phototrophic Mat | MRSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARSNGHKNSVR |
| Ga0308414_11091362 | 3300032356 | Hot Spring Phototrophic Mat | STLPPGGTMKRSSLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR |
| Ga0308414_11542051 | 3300032356 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLAIQMSKFNGKGVKQNLDYLLSQEQIRNKARNNSIR |
| Ga0308413_003157_2525_2671 | 3300033886 | Hot Spring Phototrophic Mat | MSTNKLRNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR |
| Ga0308413_030802_1309_1458 | 3300033886 | Hot Spring Phototrophic Mat | MEHSGNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARNKERKNSIR |
| Ga0308413_035457_2_118 | 3300033886 | Hot Spring Phototrophic Mat | YKLALEMNKYNGRGVKHNLDLLLSQVRARSNGHKNSVR |
| Ga0308413_038815_1052_1198 | 3300033886 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARSNKHNNRVR |
| Ga0308413_055677_970_1104 | 3300033886 | Hot Spring Phototrophic Mat | MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNN |
| Ga0308413_089139_138_284 | 3300033886 | Hot Spring Phototrophic Mat | MKRSNLHNELYKLALEMHKYNGRGVKQNLDLLMSQVRARKNVRKNSIR |
| Ga0308413_109011_579_683 | 3300033886 | Hot Spring Phototrophic Mat | MKNKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQ |
| Ga0308413_123191_2_169 | 3300033886 | Hot Spring Phototrophic Mat | TLLSGGSMKNKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0308413_154856_286_432 | 3300033886 | Hot Spring Phototrophic Mat | MTSKNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR |
| Ga0308413_159714_413_523 | 3300033886 | Hot Spring Phototrophic Mat | LALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR |
| Ga0372965_033298_117_263 | 3300034646 | Hot Spring Phototrophic Mat | MKRTNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR |
| Ga0372972_015650_1108_1272 | 3300034649 | Hot Spring Phototrophic Mat | LLSGGSMKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLSQEQVRNKARNNSIR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |