| Basic Information | |
|---|---|
| Family ID | F033331 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VLLEEARGLSRNLAYHRRARLEARIGDALDEVDRQIQELRADRG |
| Number of Associated Samples | 45 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 34.52 % |
| % of genes near scaffold ends (potentially truncated) | 59.32 % |
| % of genes from short scaffolds (< 2000 bps) | 82.49 % |
| Associated GOLD sequencing projects | 42 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.706 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (75.141 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.271 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (84.181 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF13358 | DDE_3 | 1.69 |
| PF00571 | CBS | 1.13 |
| PF07366 | SnoaL | 1.13 |
| PF07311 | Dodecin | 1.13 |
| PF07883 | Cupin_2 | 1.13 |
| PF00436 | SSB | 1.13 |
| PF03471 | CorC_HlyC | 1.13 |
| PF16916 | ZT_dimer | 1.13 |
| PF00589 | Phage_integrase | 1.13 |
| PF03992 | ABM | 1.13 |
| PF01656 | CbiA | 1.13 |
| PF00353 | HemolysinCabind | 1.13 |
| PF13560 | HTH_31 | 0.56 |
| PF00476 | DNA_pol_A | 0.56 |
| PF14269 | Arylsulfotran_2 | 0.56 |
| PF00893 | Multi_Drug_Res | 0.56 |
| PF09723 | Zn-ribbon_8 | 0.56 |
| PF09140 | MipZ | 0.56 |
| PF07291 | MauE | 0.56 |
| PF13380 | CoA_binding_2 | 0.56 |
| PF01872 | RibD_C | 0.56 |
| PF05787 | DUF839 | 0.56 |
| PF02817 | E3_binding | 0.56 |
| PF11638 | DnaA_N | 0.56 |
| PF01545 | Cation_efflux | 0.56 |
| PF00216 | Bac_DNA_binding | 0.56 |
| PF13492 | GAF_3 | 0.56 |
| PF00198 | 2-oxoacid_dh | 0.56 |
| PF13205 | Big_5 | 0.56 |
| PF05922 | Inhibitor_I9 | 0.56 |
| PF01609 | DDE_Tnp_1 | 0.56 |
| PF00582 | Usp | 0.56 |
| PF03131 | bZIP_Maf | 0.56 |
| PF07452 | CHRD | 0.56 |
| PF09557 | DUF2382 | 0.56 |
| PF12802 | MarR_2 | 0.56 |
| PF13474 | SnoaL_3 | 0.56 |
| PF01055 | Glyco_hydro_31 | 0.56 |
| PF13586 | DDE_Tnp_1_2 | 0.56 |
| PF03729 | DUF308 | 0.56 |
| PF14023 | DUF4239 | 0.56 |
| PF08818 | DUF1801 | 0.56 |
| PF02371 | Transposase_20 | 0.56 |
| PF12728 | HTH_17 | 0.56 |
| PF02522 | Antibiotic_NAT | 0.56 |
| PF01135 | PCMT | 0.56 |
| PF00313 | CSD | 0.56 |
| PF00068 | Phospholip_A2_1 | 0.56 |
| PF03713 | DUF305 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 1.13 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.13 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.13 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 1.13 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.56 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.56 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.56 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.56 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.56 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.56 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.56 |
| COG3211 | Secreted phosphatase, PhoX family | General function prediction only [R] | 0.56 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.56 |
| COG2746 | Aminoglycoside N3'-acetyltransferase | Defense mechanisms [V] | 0.56 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.56 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.56 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.56 |
| COG1501 | Alpha-glucosidase/xylosidase, GH31 family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG1404 | Serine protease, subtilisin family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.56 |
| COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.56 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.56 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.71 % |
| Unclassified | root | N/A | 24.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_120714300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1404 | Open in IMG/M |
| 3300004081|Ga0063454_100108461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1349 | Open in IMG/M |
| 3300005562|Ga0058697_10058879 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300005562|Ga0058697_10173895 | Not Available | 957 | Open in IMG/M |
| 3300006918|Ga0079216_10320814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 928 | Open in IMG/M |
| 3300006918|Ga0079216_11900372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 514 | Open in IMG/M |
| 3300007790|Ga0105679_10102435 | Not Available | 1101 | Open in IMG/M |
| 3300007790|Ga0105679_10121792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300009789|Ga0126307_10013088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6095 | Open in IMG/M |
| 3300009789|Ga0126307_10024046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4635 | Open in IMG/M |
| 3300009789|Ga0126307_10066123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 2840 | Open in IMG/M |
| 3300009789|Ga0126307_10112459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 2164 | Open in IMG/M |
| 3300009789|Ga0126307_10141036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1927 | Open in IMG/M |
| 3300009789|Ga0126307_10383481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1133 | Open in IMG/M |
| 3300009789|Ga0126307_10450406 | Not Available | 1038 | Open in IMG/M |
| 3300009789|Ga0126307_10454841 | Not Available | 1033 | Open in IMG/M |
| 3300009789|Ga0126307_10585218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 901 | Open in IMG/M |
| 3300009789|Ga0126307_10654582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 848 | Open in IMG/M |
| 3300009789|Ga0126307_10805788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 758 | Open in IMG/M |
| 3300009789|Ga0126307_11189591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 617 | Open in IMG/M |
| 3300009789|Ga0126307_11538711 | Not Available | 540 | Open in IMG/M |
| 3300009840|Ga0126313_10052674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 2875 | Open in IMG/M |
| 3300009840|Ga0126313_10115449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter radiotolerans | 1992 | Open in IMG/M |
| 3300009840|Ga0126313_10185436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter | 1591 | Open in IMG/M |
| 3300009840|Ga0126313_10278312 | Not Available | 1304 | Open in IMG/M |
| 3300009840|Ga0126313_10413320 | Not Available | 1071 | Open in IMG/M |
| 3300009840|Ga0126313_10450903 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300009840|Ga0126313_10819102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 758 | Open in IMG/M |
| 3300009840|Ga0126313_10942656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Pinirhizobacter → Pinirhizobacter soli | 706 | Open in IMG/M |
| 3300009840|Ga0126313_11054479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
| 3300009840|Ga0126313_11233588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 617 | Open in IMG/M |
| 3300009840|Ga0126313_11537045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 553 | Open in IMG/M |
| 3300010036|Ga0126305_10033967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 2800 | Open in IMG/M |
| 3300010036|Ga0126305_10047883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 2412 | Open in IMG/M |
| 3300010036|Ga0126305_10299015 | Not Available | 1045 | Open in IMG/M |
| 3300010036|Ga0126305_10353352 | Not Available | 963 | Open in IMG/M |
| 3300010036|Ga0126305_10358272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300010036|Ga0126305_10424097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
| 3300010036|Ga0126305_10424910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 879 | Open in IMG/M |
| 3300010036|Ga0126305_10424932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 879 | Open in IMG/M |
| 3300010036|Ga0126305_10453346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 851 | Open in IMG/M |
| 3300010036|Ga0126305_10453992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 851 | Open in IMG/M |
| 3300010036|Ga0126305_10460918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 844 | Open in IMG/M |
| 3300010036|Ga0126305_10728456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 672 | Open in IMG/M |
| 3300010036|Ga0126305_10830311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 629 | Open in IMG/M |
| 3300010036|Ga0126305_10871977 | Not Available | 614 | Open in IMG/M |
| 3300010036|Ga0126305_11152135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 535 | Open in IMG/M |
| 3300010037|Ga0126304_10078142 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300010037|Ga0126304_10110745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1745 | Open in IMG/M |
| 3300010037|Ga0126304_10136333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1578 | Open in IMG/M |
| 3300010037|Ga0126304_10141760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1549 | Open in IMG/M |
| 3300010037|Ga0126304_10274484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1113 | Open in IMG/M |
| 3300010037|Ga0126304_10512093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300010037|Ga0126304_10531737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 790 | Open in IMG/M |
| 3300010037|Ga0126304_10638382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 718 | Open in IMG/M |
| 3300010037|Ga0126304_10828648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 628 | Open in IMG/M |
| 3300010037|Ga0126304_10926128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 593 | Open in IMG/M |
| 3300010037|Ga0126304_11234097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 513 | Open in IMG/M |
| 3300010038|Ga0126315_10019905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 3351 | Open in IMG/M |
| 3300010038|Ga0126315_10146255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1396 | Open in IMG/M |
| 3300010038|Ga0126315_10153819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1363 | Open in IMG/M |
| 3300010038|Ga0126315_10191234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1229 | Open in IMG/M |
| 3300010038|Ga0126315_10335713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 939 | Open in IMG/M |
| 3300010038|Ga0126315_10368283 | Not Available | 898 | Open in IMG/M |
| 3300010038|Ga0126315_10959673 | Not Available | 571 | Open in IMG/M |
| 3300010039|Ga0126309_10010406 | All Organisms → cellular organisms → Bacteria | 3799 | Open in IMG/M |
| 3300010039|Ga0126309_10023353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 2731 | Open in IMG/M |
| 3300010039|Ga0126309_10046421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 2058 | Open in IMG/M |
| 3300010039|Ga0126309_10199914 | Not Available | 1106 | Open in IMG/M |
| 3300010039|Ga0126309_10322474 | Not Available | 900 | Open in IMG/M |
| 3300010039|Ga0126309_10358969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 860 | Open in IMG/M |
| 3300010039|Ga0126309_10610939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 688 | Open in IMG/M |
| 3300010039|Ga0126309_10621248 | Not Available | 683 | Open in IMG/M |
| 3300010039|Ga0126309_10755923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 630 | Open in IMG/M |
| 3300010040|Ga0126308_10128989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1579 | Open in IMG/M |
| 3300010040|Ga0126308_10225526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter tropicus | 1211 | Open in IMG/M |
| 3300010040|Ga0126308_10241021 | Not Available | 1173 | Open in IMG/M |
| 3300010040|Ga0126308_10347606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 982 | Open in IMG/M |
| 3300010040|Ga0126308_10385210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 933 | Open in IMG/M |
| 3300010040|Ga0126308_10489002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 830 | Open in IMG/M |
| 3300010040|Ga0126308_10633722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 731 | Open in IMG/M |
| 3300010040|Ga0126308_10727839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 683 | Open in IMG/M |
| 3300010040|Ga0126308_10975602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 593 | Open in IMG/M |
| 3300010040|Ga0126308_11004470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 585 | Open in IMG/M |
| 3300010040|Ga0126308_11018331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium | 581 | Open in IMG/M |
| 3300010040|Ga0126308_11107585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 558 | Open in IMG/M |
| 3300010041|Ga0126312_10086842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 2126 | Open in IMG/M |
| 3300010041|Ga0126312_10142795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1659 | Open in IMG/M |
| 3300010041|Ga0126312_10269114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1199 | Open in IMG/M |
| 3300010041|Ga0126312_10408187 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300010041|Ga0126312_10452260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 916 | Open in IMG/M |
| 3300010041|Ga0126312_10520447 | Not Available | 852 | Open in IMG/M |
| 3300010041|Ga0126312_10673665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 746 | Open in IMG/M |
| 3300010041|Ga0126312_10795180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 686 | Open in IMG/M |
| 3300010041|Ga0126312_10979333 | Not Available | 618 | Open in IMG/M |
| 3300010041|Ga0126312_11491474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 501 | Open in IMG/M |
| 3300010042|Ga0126314_10085114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 2125 | Open in IMG/M |
| 3300010042|Ga0126314_10272683 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300010042|Ga0126314_10689885 | Not Available | 748 | Open in IMG/M |
| 3300010042|Ga0126314_10984652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 625 | Open in IMG/M |
| 3300010042|Ga0126314_11077993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 598 | Open in IMG/M |
| 3300010042|Ga0126314_11375013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 530 | Open in IMG/M |
| 3300010042|Ga0126314_11417210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 522 | Open in IMG/M |
| 3300010042|Ga0126314_11494792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 507 | Open in IMG/M |
| 3300010044|Ga0126310_10010244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 4327 | Open in IMG/M |
| 3300010044|Ga0126310_10039795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 2541 | Open in IMG/M |
| 3300010044|Ga0126310_10073484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1988 | Open in IMG/M |
| 3300010044|Ga0126310_10086309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1864 | Open in IMG/M |
| 3300010044|Ga0126310_10109404 | Not Available | 1691 | Open in IMG/M |
| 3300010044|Ga0126310_10230931 | Not Available | 1236 | Open in IMG/M |
| 3300010044|Ga0126310_10385313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 994 | Open in IMG/M |
| 3300010044|Ga0126310_10447171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 932 | Open in IMG/M |
| 3300010044|Ga0126310_11068699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300010044|Ga0126310_11522362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 549 | Open in IMG/M |
| 3300010044|Ga0126310_11767517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 515 | Open in IMG/M |
| 3300010045|Ga0126311_10078365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 2212 | Open in IMG/M |
| 3300010045|Ga0126311_10222248 | Not Available | 1388 | Open in IMG/M |
| 3300010045|Ga0126311_10736841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 790 | Open in IMG/M |
| 3300010045|Ga0126311_10752540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 782 | Open in IMG/M |
| 3300010045|Ga0126311_11180528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 632 | Open in IMG/M |
| 3300010045|Ga0126311_11360638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300010166|Ga0126306_10123553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1897 | Open in IMG/M |
| 3300010166|Ga0126306_10198941 | Not Available | 1512 | Open in IMG/M |
| 3300010166|Ga0126306_10201482 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300010166|Ga0126306_10332019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1177 | Open in IMG/M |
| 3300010166|Ga0126306_10343252 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300010166|Ga0126306_10756579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 782 | Open in IMG/M |
| 3300010166|Ga0126306_10984503 | Not Available | 686 | Open in IMG/M |
| 3300010166|Ga0126306_11385114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 582 | Open in IMG/M |
| 3300010166|Ga0126306_11585018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 545 | Open in IMG/M |
| 3300010166|Ga0126306_11587927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 544 | Open in IMG/M |
| 3300010166|Ga0126306_11589664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 544 | Open in IMG/M |
| 3300010166|Ga0126306_11603366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 542 | Open in IMG/M |
| 3300010395|Ga0058701_10683026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 564 | Open in IMG/M |
| 3300012042|Ga0136627_1231281 | Not Available | 596 | Open in IMG/M |
| 3300012092|Ga0136621_1328857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 593 | Open in IMG/M |
| 3300012184|Ga0136610_1251101 | Not Available | 605 | Open in IMG/M |
| 3300012681|Ga0136613_10497302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 660 | Open in IMG/M |
| 3300014487|Ga0182000_10496083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 566 | Open in IMG/M |
| 3300014488|Ga0182001_10682839 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300018432|Ga0190275_10490201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1260 | Open in IMG/M |
| 3300018432|Ga0190275_12927792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 552 | Open in IMG/M |
| 3300018465|Ga0190269_11910623 | Not Available | 512 | Open in IMG/M |
| 3300018466|Ga0190268_10072881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1477 | Open in IMG/M |
| 3300018466|Ga0190268_10932922 | Not Available | 680 | Open in IMG/M |
| 3300018892|Ga0193607_1102529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 793 | Open in IMG/M |
| 3300018933|Ga0193614_1013766 | Not Available | 2379 | Open in IMG/M |
| 3300018933|Ga0193614_1147240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 646 | Open in IMG/M |
| 3300018939|Ga0193593_1017610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1761 | Open in IMG/M |
| 3300018939|Ga0193593_1100343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 721 | Open in IMG/M |
| 3300018946|Ga0193599_1011155 | All Organisms → cellular organisms → Bacteria | 3463 | Open in IMG/M |
| 3300019377|Ga0190264_11678039 | Not Available | 564 | Open in IMG/M |
| 3300021184|Ga0196959_10003566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 2197 | Open in IMG/M |
| 3300030510|Ga0268243_1001027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4384 | Open in IMG/M |
| 3300031092|Ga0308204_10072124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 893 | Open in IMG/M |
| 3300031548|Ga0307408_101785560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 588 | Open in IMG/M |
| 3300031911|Ga0307412_10200379 | Not Available | 1515 | Open in IMG/M |
| 3300031911|Ga0307412_10677640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 882 | Open in IMG/M |
| 3300031911|Ga0307412_10829247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 805 | Open in IMG/M |
| 3300032002|Ga0307416_100211048 | Not Available | 1852 | Open in IMG/M |
| 3300032002|Ga0307416_103271919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 542 | Open in IMG/M |
| 3300032126|Ga0307415_100101287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 2113 | Open in IMG/M |
| 3300032159|Ga0268251_10036295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1556 | Open in IMG/M |
| 3300032159|Ga0268251_10453332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 565 | Open in IMG/M |
| 3300034007|Ga0334936_070683 | Not Available | 722 | Open in IMG/M |
| 3300034026|Ga0334946_073043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 576 | Open in IMG/M |
| 3300034143|Ga0334961_028731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter tropicus | 949 | Open in IMG/M |
| 3300034402|Ga0334960_037281 | Not Available | 666 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 75.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.95% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 3.39% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.82% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.13% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010395 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.e | Host-Associated | Open in IMG/M |
| 3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018892 | Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, bundles v1 | Environmental | Open in IMG/M |
| 3300018933 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 42 hrs v1 | Environmental | Open in IMG/M |
| 3300018939 | Soil crust microbial communities from Colorado Plateau, Utah, USA - midlate stage, 9 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300018946 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034007 | Biocrust microbial communities from Mojave Desert, California, United States - 32SMC | Environmental | Open in IMG/M |
| 3300034026 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 42SMS | Environmental | Open in IMG/M |
| 3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
| 3300034402 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 56SNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1207143002 | 3300002568 | Soil | DCEARGLSRNLAYHRRARLGARIGEALDEVDRQIQESRADRGQ* |
| Ga0063454_1001084611 | 3300004081 | Soil | EEARGLSRNLAYHRRARLEGRIGEALEEVDRQIGELRAAKS* |
| Ga0058697_100588791 | 3300005562 | Agave | MRVLLEEARGLSRNLAYHRRARLEAKLGDALDEVDQQIQQLRAAKG* |
| Ga0058697_101738951 | 3300005562 | Agave | LARNLAYHRRARLEDVLGRALDEVDRQIEELRSSSRD* |
| Ga0079215_115580021 | 3300006894 | Agricultural Soil | NLAYHRMVRLEARLGEALEEVDRQIVELRSDWGS* |
| Ga0079216_103208144 | 3300006918 | Agricultural Soil | GLSRNLAYHRRVRLEARIGESLDEVDNQIEQLRTAKG* |
| Ga0079216_119003722 | 3300006918 | Agricultural Soil | SRNLAYHRRARLECRIGEALKDVDLQIQELRAAKG* |
| Ga0105679_101024351 | 3300007790 | Soil | LEEARLLARNLAYHRQARLEDVLGRSLEEVDRQIEELRREERR* |
| Ga0105679_101217921 | 3300007790 | Soil | MRVLLEEARALSRNLAYHRRVSLESRIGEALEEVDRQVRELRVAEG* |
| Ga0126307_1001308810 | 3300009789 | Serpentine Soil | MRVLLEEARGLSRDLAYHRRVRLEGRIGETLEEVDRQVRELRAATKG* |
| Ga0126307_100240463 | 3300009789 | Serpentine Soil | MRVLLEEARALARNLAYHRRARLEASIGQALEEVDQQIEDLRRDRT* |
| Ga0126307_100661234 | 3300009789 | Serpentine Soil | MRVLLEEARGLARNLAYHRRARLEASIGRALDEVDRQIEDLRKDRA* |
| Ga0126307_101124591 | 3300009789 | Serpentine Soil | NMRVLLEEARVLARDLAYHRRARVEAVLGRALDEVDRQIEDLRRDQG* |
| Ga0126307_101410361 | 3300009789 | Serpentine Soil | MRVLLEEARGLTRDLAYHRRARLEDRLGVVLDEVDRQIEELRADRG* |
| Ga0126307_103834813 | 3300009789 | Serpentine Soil | MRVLLEEARALSRNLSYHRRVSLESRIGEVLEEVDRQVRELRAAKG* |
| Ga0126307_104504062 | 3300009789 | Serpentine Soil | RGLLEEARLFARNLAYHRRASLEAVLGQALEEVERQIEELRRERHG* |
| Ga0126307_104548411 | 3300009789 | Serpentine Soil | ARMLARNLAYHRRARLEDVLGRALDEVDRQVEELRSSSRD* |
| Ga0126307_105852181 | 3300009789 | Serpentine Soil | NMRVLLEEARVLARDLAYHRRARVEAVLGRALDEVDRQIEDLCRDQG* |
| Ga0126307_106545822 | 3300009789 | Serpentine Soil | VLLEEAKSLSRNLAYHLRARLESRIGEAIDEVDRQIQELRADRG* |
| Ga0126307_108057881 | 3300009789 | Serpentine Soil | MRVLLEEARSLSRNLAYHRRTRLESRIGEALDEVDLQIKELRAAKG* |
| Ga0126307_111895911 | 3300009789 | Serpentine Soil | GLSRNLAYHRRARLEKRIGEALEEVDRQIVELRAAKG* |
| Ga0126307_115387111 | 3300009789 | Serpentine Soil | LLLEEVMGLSRNLAHHRRARLEATIGEALDEVEKVDRQIQELRADR |
| Ga0126313_100526741 | 3300009840 | Serpentine Soil | LLLEEAMGLSRNLAHHRRARLEATIGEALDEVEKVDRQIQELRADRG* |
| Ga0126313_101154492 | 3300009840 | Serpentine Soil | VLLEEARGPSRNLAYHRRVRLQVRLGEALDEVDRQIRELPADRR* |
| Ga0126313_101854364 | 3300009840 | Serpentine Soil | MRVLLEEARGLSRNLSYHRRARLEARIGEALDEVDRQIRELRADRG* |
| Ga0126313_102783123 | 3300009840 | Serpentine Soil | LLEEARLRSRNLAYHRQAVLERKLGRALDELDQQIEELRSLRS* |
| Ga0126313_104133201 | 3300009840 | Serpentine Soil | RMLARNLAYHRRARLEDVLGRALDEVDRQIEELRSSSRD* |
| Ga0126313_104509031 | 3300009840 | Serpentine Soil | LEEARGLSRNLAYHRRARLEARLGETLEEVDRQIVELRAAKG* |
| Ga0126313_108191021 | 3300009840 | Serpentine Soil | VLLEEARSLSRNLAYHRRARLEARIGEAIDEVDSQIRELRADRG* |
| Ga0126313_109426561 | 3300009840 | Serpentine Soil | LSRNLAYHRRARLEAAIGEALDEVDRQIDQLRADRG* |
| Ga0126313_110544791 | 3300009840 | Serpentine Soil | RNMRVLLEEARMLARNLAYHRRARLEDVLGQALDEVDRQIEELRSSSRD* |
| Ga0126313_112335882 | 3300009840 | Serpentine Soil | MRVLLEEARGISRNLAYHRRARLESRSGEALEEVDQQIVELRSDRGS* |
| Ga0126313_115370452 | 3300009840 | Serpentine Soil | VLLEEARGLSRNLAYHRRALLESRIGETLDEVDRQILELRATKG* |
| Ga0126305_100339674 | 3300010036 | Serpentine Soil | NMRVLLEEARVHARHLAYHRRARLEDVLGEALEEVDRQIEQLRRDGRG* |
| Ga0126305_100478833 | 3300010036 | Serpentine Soil | RVLLEEARGLSRNLAYHRRARLEEKIGDALDEVDRQIEELRATRD* |
| Ga0126305_102990152 | 3300010036 | Serpentine Soil | MRVLLEEARVLAHNLAYHRRVRLEAVLGQALAEVDRQIEELRSERRE* |
| Ga0126305_103533522 | 3300010036 | Serpentine Soil | MRVLLEEARGMARNLAYHRRARLEAVLGQALNEVDDQIEVLRSE* |
| Ga0126305_103582722 | 3300010036 | Serpentine Soil | MRVLLEEARGLSRNLAYHRRARLEAKLGDTLDEVDRQIEELRRTRG* |
| Ga0126305_104240972 | 3300010036 | Serpentine Soil | LLEEARVLARDLAYHRRARVEAVLGRALDEVDWQIEDLRRDRG* |
| Ga0126305_104249101 | 3300010036 | Serpentine Soil | MRVLLEEARVLARDLAYHRRARVEAVLGRALDEVDRQIEDLCRDQG* |
| Ga0126305_104249322 | 3300010036 | Serpentine Soil | EEARGLSRNLAYHRRARLEARIGDALDEMDRQIQELRADRG* |
| Ga0126305_104533461 | 3300010036 | Serpentine Soil | NMRVLLEEARGLSRNLAYHRRARLEARIGEALEEVERQIVQLRATKG* |
| Ga0126305_104539922 | 3300010036 | Serpentine Soil | EEARGLSRNLAYHRRARLEARIGEALEEVDRQIVQLRATKG* |
| Ga0126305_104609182 | 3300010036 | Serpentine Soil | VLLEEARGLSRNLAHHRRARLEFRIGEALDEVDRQIGELRADRG* |
| Ga0126305_107284562 | 3300010036 | Serpentine Soil | RVLLEEARMLARNLAYHRRARLEDVLGQALDEVDRQIEELRSSSQD* |
| Ga0126305_107422001 | 3300010036 | Serpentine Soil | QGLPRSLAYQRRARLKSRIGEALDEVDRQVQQLRATEG* |
| Ga0126305_108303111 | 3300010036 | Serpentine Soil | SLSRNLAYHLRARLESRIGEAIDEVDRQIQELRADRG* |
| Ga0126305_108719771 | 3300010036 | Serpentine Soil | MRVLLEEARVLARDLAYHRRARVEAVLGRALDEVDRQIEDLRRDQG* |
| Ga0126305_111521351 | 3300010036 | Serpentine Soil | LSRNLAYHRRARLEARIGEALEEVDRQIGQLRATKG* |
| Ga0126304_100781421 | 3300010037 | Serpentine Soil | SRNLAYHRRARLEARIGEALDEVDQQIVELRAAKR* |
| Ga0126304_101107452 | 3300010037 | Serpentine Soil | MRVLLEEARGLARNLAYHRRARLEASIGQALDEVDRQIEDLRKDRA* |
| Ga0126304_101363332 | 3300010037 | Serpentine Soil | MRVLLEEARVLARDLAYHRRARVEAVLGRALDEVDWQIEDLRRDRG* |
| Ga0126304_101417601 | 3300010037 | Serpentine Soil | NMRVLLEEARGLSRNLAYHRRARLEARIGEALEEVDRQIVQLRATKG* |
| Ga0126304_102384951 | 3300010037 | Serpentine Soil | RNLVYHRRVRLESRMGEALDEVDRQVQQLRANKG* |
| Ga0126304_102744841 | 3300010037 | Serpentine Soil | NMRVLLEEARGLSRNLAYHLRVRLEAAIGEVLDEVDRQIEELRADRG* |
| Ga0126304_105120932 | 3300010037 | Serpentine Soil | LLEEARELSRNLAYHRRARLEGRIGEALEDVDRQISELRATRS* |
| Ga0126304_105317372 | 3300010037 | Serpentine Soil | MRVLLEEARGMARNLAYHRRARLEAVLGQALNEVDDQIEELRSE* |
| Ga0126304_106383821 | 3300010037 | Serpentine Soil | VLLEEARGLSRNLAYHRRARLESRIGDALDEVDRQIVELRAAKG* |
| Ga0126304_108286482 | 3300010037 | Serpentine Soil | LEEARGLSRNLAYHRRARLEARIGEALEEVDRQIVELRAAKG* |
| Ga0126304_109261281 | 3300010037 | Serpentine Soil | NARVLLEEARGLSRNLAYHRRARLEAAIGEALDEVDSQIEALQVDRG* |
| Ga0126304_112340972 | 3300010037 | Serpentine Soil | RVLLEEAKGLSRNLAYHRRARLEARIGEALDEVDQQIQELRAAKG* |
| Ga0126315_100199052 | 3300010038 | Serpentine Soil | MRVLLKEARTLARNLAYHRRARLEASIGIALDEIDQQIEDLRRDRT* |
| Ga0126315_101462553 | 3300010038 | Serpentine Soil | MRVLLEEARGLSRNLAYHRRARLERRIGEALEEVDLQIEELRAAKR* |
| Ga0126315_101538192 | 3300010038 | Serpentine Soil | MRVLLEEARTFARDLAYHRRARLEASIGQALDEVDRQIEDLRRDRV* |
| Ga0126315_101912341 | 3300010038 | Serpentine Soil | MRVLLEEARVLARNLAYHRRARLEAVLGQALDEVDRQIEELRRDRV* |
| Ga0126315_101989051 | 3300010038 | Serpentine Soil | DLAYHRRVRLEGRIGETLEEVDRQVRELRAATKG* |
| Ga0126315_103357132 | 3300010038 | Serpentine Soil | SQNLAYHRRARLESRIGESLEEVDQQIEQLRAAKG* |
| Ga0126315_103682831 | 3300010038 | Serpentine Soil | MGVLLEEARSLSRDLAYHRRVRLEGRIGETLEEVDRQVRELRAATKG* |
| Ga0126315_105365652 | 3300010038 | Serpentine Soil | LARDLAYHRRARLEAVLGRALEEVDRQIEDLRTDEQG* |
| Ga0126315_109596731 | 3300010038 | Serpentine Soil | NLAYHRRARLEDVLGRALDEVDRQIEELRSSSRD* |
| Ga0126309_100104061 | 3300010039 | Serpentine Soil | RGLSRDLAYHRRTRLEVRIGEALDEVDRQIRELRADRG* |
| Ga0126309_100233534 | 3300010039 | Serpentine Soil | MRVLLEEARGLARDLAYHRRARLEAVLGQALEEVDSQIEDLRRDFSD* |
| Ga0126309_100464211 | 3300010039 | Serpentine Soil | RDLAYHRRARLEAAIGRALEEVDGQIEELRAGRRG* |
| Ga0126309_100531514 | 3300010039 | Serpentine Soil | SRTLAYHRRVRLESRIGEALDEVDRQVQELRAAKG* |
| Ga0126309_101999141 | 3300010039 | Serpentine Soil | RNMRVLLEEARMLARNLAYHRRARLEDVLGRALDEVDRQIEELRRSSRD* |
| Ga0126309_103224741 | 3300010039 | Serpentine Soil | RNLAYHRRARLEAVLGQALNEVDRQIEELRSEGRS* |
| Ga0126309_103589692 | 3300010039 | Serpentine Soil | MRVLLEEASLLSRDLAYHRRAKLDAVIGRALEEVDRQVGELRGP* |
| Ga0126309_106109393 | 3300010039 | Serpentine Soil | EEARGLSRNLAYHRRARLEARLGETLEEVDRQIVELRAAKG* |
| Ga0126309_106212481 | 3300010039 | Serpentine Soil | RVLLEEARELSRNLANHRRARLEAKLGVALEEVDRQIGELRSDRC* |
| Ga0126309_107559231 | 3300010039 | Serpentine Soil | VLLEEARGLSRNLAYHRRARLEARIGEALDEVGRQI* |
| Ga0126308_100160361 | 3300010040 | Serpentine Soil | ARVRARNLAYHRRARLEEALGRALEEVDRQIEELRSERHG* |
| Ga0126308_101289891 | 3300010040 | Serpentine Soil | MRVLIEKARVLARNLAYHRRVGMEEVLRRALEEVDRQIRSCAARGAT |
| Ga0126308_102255262 | 3300010040 | Serpentine Soil | VLLEEARGLSRNLAYHRRARLEARIGDALDEVDRQIQELRADRG* |
| Ga0126308_102410212 | 3300010040 | Serpentine Soil | MRVLLEEARVLARNLAYHRRARLEAVLRQALDEADHQIEDLRTQRY* |
| Ga0126308_103476061 | 3300010040 | Serpentine Soil | MRVLLEEARRLSRNLAYHRRARLESRIGEVLEEVDQQIEQLRATKG* |
| Ga0126308_103852101 | 3300010040 | Serpentine Soil | HNLAYHRRVRLEAVLGQALAEVDRQIEELRSERRE* |
| Ga0126308_104890022 | 3300010040 | Serpentine Soil | LLEEARGLSRNLDYHRRARLEARIGEVLEEVDQQIEQLWAAKD* |
| Ga0126308_106337221 | 3300010040 | Serpentine Soil | MRVLLEEARGLSRNLAYHRRALLESRIGEVLDGVDQQIEQLRAARG* |
| Ga0126308_107278391 | 3300010040 | Serpentine Soil | RGLSRNLAYHRRARLESRIGEALDEVDQQIQELRAAKG* |
| Ga0126308_109756022 | 3300010040 | Serpentine Soil | SRNLAYHRRARLEARIGEALEEVDRQIVELRAAKG* |
| Ga0126308_110044701 | 3300010040 | Serpentine Soil | RGLSRNLSYHRRARLEARIGEALEEVDRQIVQLRATKG* |
| Ga0126308_110183312 | 3300010040 | Serpentine Soil | LLLEEVMGLSRNLAHHRRARLEATIGEALDEVDKVDRQIQELRADRG* |
| Ga0126308_111075851 | 3300010040 | Serpentine Soil | EEARMLARNLAYHRRARLEDVLGRTLDEVDRQIEELRSSSRD* |
| Ga0126312_100868424 | 3300010041 | Serpentine Soil | LEEARGLSRNLAYHRRVRLESMIGEALEEVERQIVELRAAKG* |
| Ga0126312_101427954 | 3300010041 | Serpentine Soil | MRVLLEEARVQTRNLAYHRRVRLETIIGHVLEELERQIAELRAIQR* |
| Ga0126312_102691141 | 3300010041 | Serpentine Soil | MRVLLKEARILARNLAYHRRARLEDVLGRALEEVYKQIEELRREQLG* |
| Ga0126312_104081872 | 3300010041 | Serpentine Soil | MRVLLEEARGLSRNLSYHRRARLEAKLGDVLDEVDRQIVELRAAKG* |
| Ga0126312_104522602 | 3300010041 | Serpentine Soil | MRVLLEEARGMSRNLAYHRRARLEARLGDALDEVDRQI |
| Ga0126312_105204472 | 3300010041 | Serpentine Soil | MRVLLEEARVLTRNLAYHRRARLEAVLRQALDEADHQIENLRTQRY* |
| Ga0126312_106736651 | 3300010041 | Serpentine Soil | MRVLLEEARGMSRNLAYHRRARLEARLGDALDEVDRQIVELRADRGSW |
| Ga0126312_107951801 | 3300010041 | Serpentine Soil | ARRLSRNLAYHRRARLETKLGVALDEVDRQIAELRADRR* |
| Ga0126312_109793331 | 3300010041 | Serpentine Soil | ARNLAYHRRARLEDVLGRALDEVDRQIEELRSSSRD* |
| Ga0126312_114457531 | 3300010041 | Serpentine Soil | RNLAYHRRVRLEARLGEALEEVDRQIVELRGDRGS* |
| Ga0126312_114914741 | 3300010041 | Serpentine Soil | MGVLLEEARGLSRDLAYHRRVRLEVRIGEALEEVDRQVRELRAATKG* |
| Ga0126314_100851146 | 3300010042 | Serpentine Soil | EEARGLSKNLAYHRRARLESRIGEVLDEVDQQIQQLRATKG* |
| Ga0126314_102726833 | 3300010042 | Serpentine Soil | MRVLLEEARGLSRNLAYHRRARLERRIGEALEEVDLQIEELRAAKG* |
| Ga0126314_106898852 | 3300010042 | Serpentine Soil | LLLEEVMGLSRNLAHHRRARLEATIGEALDEVDKVDRQIQELRADLG* |
| Ga0126314_109846521 | 3300010042 | Serpentine Soil | MRVLLEEARGLSRNLAYHRRARLETRLGEALEEVDRQIVELRAAKG* |
| Ga0126314_110779931 | 3300010042 | Serpentine Soil | MRVLLEEARGLSRNLAYHRRARLERRIGEALDEVDRQIVELRADRGS* |
| Ga0126314_113750133 | 3300010042 | Serpentine Soil | VLLEEARGLSRNLAYHRRARLEARIGEALEEVDQHIQQLRAAKG* |
| Ga0126314_114172101 | 3300010042 | Serpentine Soil | RGLSRNLAYHRRARLEARLGEALEEVDRQIVQLRATKG* |
| Ga0126314_114947921 | 3300010042 | Serpentine Soil | LLEEARGLARNLAYHRRARLESTIGEALEEVDRQIEELRAARG* |
| Ga0126310_100102442 | 3300010044 | Serpentine Soil | MRVLLEEARGLSRNLAYHRRARLESSIGEVLDEVDQQIQELRAAKG* |
| Ga0126310_100397951 | 3300010044 | Serpentine Soil | VLLEEARGLSRNLAYHRRARLEAKLGETLDEVDRQIVELRSDRH* |
| Ga0126310_100734841 | 3300010044 | Serpentine Soil | LSQNLAYHRRARLESRVGETLDEVDQQIQELRAAKG* |
| Ga0126310_100863091 | 3300010044 | Serpentine Soil | MRVLLEEARSLSRNLAYHRRARLESRIGEALEEVDQQIQELRPARG* |
| Ga0126310_101094042 | 3300010044 | Serpentine Soil | MRVLLEEARVLARNLAYHRRARLEAVLRQALDEADHQIENLRTQRY* |
| Ga0126310_102309311 | 3300010044 | Serpentine Soil | VLLEEARSLSRNLAYDRRTRLEARIGAALDEVDRQIQELRADRG* |
| Ga0126310_103853132 | 3300010044 | Serpentine Soil | LEETRVLARNLAYHRRARLESVIGRALDEVDRQIEELRSEGRS* |
| Ga0126310_104471711 | 3300010044 | Serpentine Soil | RGLSRNLAYHRRARLEARIGEALEEVDRQIVELRATKG* |
| Ga0126310_110686991 | 3300010044 | Serpentine Soil | RGLARNLAYHRRARLESTIGEALEEVDRQIEELRAARG* |
| Ga0126310_115223622 | 3300010044 | Serpentine Soil | VLLEEARGLSRNLAYHRRARLEAKLGETLDEVDRQIQKLRAYRG* |
| Ga0126310_117675172 | 3300010044 | Serpentine Soil | RVLLEEARGLSRNLVYHRRARLESRIGEALEEVDQQIEELRATKG* |
| Ga0126311_100783651 | 3300010045 | Serpentine Soil | VLLEEARGLSRNLAYHRRARLEARIGEALEEVDRQIVELRATKG* |
| Ga0126311_102222482 | 3300010045 | Serpentine Soil | MRVFLEEARGLSRNLAYHRRVQLEGRIGDALDEVDRQIQELQAAKG* |
| Ga0126311_107368411 | 3300010045 | Serpentine Soil | QNMRVLLEEARGLSRNLSYHRRARLEARIGEALEEVDRQIVELRAAKG* |
| Ga0126311_107525401 | 3300010045 | Serpentine Soil | RVLLEEARGLSRNLAYHRRARLEARIGEALEEVERQIVQLRATKG* |
| Ga0126311_111805281 | 3300010045 | Serpentine Soil | EARGLSRNLAYHRRARLESRIGEVLEEVDQQIQQLRAAKG* |
| Ga0126311_113606381 | 3300010045 | Serpentine Soil | RGLSRNLAYHRRARLEGRIGEALEDVDRQISELQATRS* |
| Ga0126306_100048039 | 3300010166 | Serpentine Soil | RHLAYHRRARLEDVLGEALEEVDRQIEQLRRDGRG* |
| Ga0126306_101235534 | 3300010166 | Serpentine Soil | LLEEARTLARDLAYHRRARLEASIGQALDEVDQQIEDLRRDRT* |
| Ga0126306_101989413 | 3300010166 | Serpentine Soil | RNMRVLLEEARMLARNLAYHRRARLEDVLGRALDEIDRQIEELRSSSRD* |
| Ga0126306_102014823 | 3300010166 | Serpentine Soil | RVLLEEARGLSRNLAYHRRARLEVRLGEALEEVDRQIVELRADRGP* |
| Ga0126306_103320191 | 3300010166 | Serpentine Soil | RNLAYHRRARLESRIGESLDEVDQHIEQLRAAKG* |
| Ga0126306_103432522 | 3300010166 | Serpentine Soil | GLLEEARLFARNLAYHRRASLEAVLGQALEEVDRQIEELRRERHG* |
| Ga0126306_107565791 | 3300010166 | Serpentine Soil | LEEARGLARNLAYHRRARLESRIGEALDEVDLQIQELRTAKG* |
| Ga0126306_109845032 | 3300010166 | Serpentine Soil | ATNLAYHRRAKLESTIGEALDEVDHQIEELRAAKG* |
| Ga0126306_113851143 | 3300010166 | Serpentine Soil | EARGMSRNLAYHRRARLEARLGDALDEVDRQIGELRRTRG* |
| Ga0126306_115850181 | 3300010166 | Serpentine Soil | QNMRVLLEEARGLSRNLAYHRRARLEARIGEALEEVDQQIQQLRAAKG* |
| Ga0126306_115879271 | 3300010166 | Serpentine Soil | GLSRNLAYHRRARLEARIGEALEEVDRQIVELRATKG* |
| Ga0126306_115896641 | 3300010166 | Serpentine Soil | GLSRNLAYHRRAWLESRIGEALDEVDRQIEELRPADD* |
| Ga0126306_116033661 | 3300010166 | Serpentine Soil | NMRVLLEEARGLSRNLAYHRRARLGARIGEALEEVDRQILELRAAKG* |
| Ga0058701_106830262 | 3300010395 | Agave | GLSRNLAYHRRARLESRIGEALDEVDRQITELRAAKG* |
| Ga0136627_12312811 | 3300012042 | Polar Desert Sand | MRVLLEEARVLARSLAYHRRATLEAVLVRALDEVDRQIEELRDEGRG* |
| Ga0136621_13288572 | 3300012092 | Polar Desert Sand | LLEEARLLARDLAHHRRARLEAVLGRALDEVDRQIGELRTP* |
| Ga0136610_12511011 | 3300012184 | Polar Desert Sand | RLLARGLAYHRRARLEAAVGRALDEVDREIEELRPDRRG* |
| Ga0136613_104973022 | 3300012681 | Polar Desert Sand | MRVLLEESRVLARGLAYHRRAALEAVLGRVLEEVDRQIEDLRHGRKGG* |
| Ga0182000_104960831 | 3300014487 | Soil | RSRNLAYHRRARLEARLGEALDEVDRQILELRADRGS* |
| Ga0182001_106828392 | 3300014488 | Soil | LSRNLAYHRRTRLETKIGDALDEVDRQIAELRSDRC* |
| Ga0190275_104902013 | 3300018432 | Soil | MKLSRNLAYHRRARLEAKLGETLDEVDRYILGLRSARR |
| Ga0190275_129277921 | 3300018432 | Soil | EARGLSRNLAHHRRARLENRIGVALDEVDRQIQELRSDRI |
| Ga0190269_119106231 | 3300018465 | Soil | LWRNLAYHRRARLEAKLGEALDKVDRQIQDLRAYRG |
| Ga0190268_100728815 | 3300018466 | Soil | GMSRNLAYHRRARLEAQLGDALDEVDRQIEELRRTRG |
| Ga0190268_109329221 | 3300018466 | Soil | MRVLLEEARELSRNLAYHRTARLEEELGVVLDEVDRQIEGLRADRRG |
| Ga0193607_11025291 | 3300018892 | Soil | ARLRAQDLACHRRARLEAVLGQALDEVDRQIGELRTS |
| Ga0193614_10137662 | 3300018933 | Soil | MRVLLEEARALARDLAYHRRARLEAAIGLALDEIDRQIEELRRDRA |
| Ga0193614_11472401 | 3300018933 | Soil | MRVLLEEARLLARNLAYHRRATLESSIGQTLDEIERQVEDLRADRG |
| Ga0193593_10176102 | 3300018939 | Soil | MRVLLEEARLLARNLAHHRRSKLEAGLGQVLDELDRQIEDLRKNRG |
| Ga0193593_11003431 | 3300018939 | Soil | LLQEARGLTRDLAYHRRARLEDRLGVVLEEVDRQIEELRADRG |
| Ga0193599_10111552 | 3300018946 | Soil | MRVLLEEARLLARNLAHHRRSKLEAGLGHVLDELDRQIEDLRKNRG |
| Ga0190264_116780391 | 3300019377 | Soil | RNMRVLLEEARVHARHLAYHRRARLEDVLGEALEEVDRQIEQLRRDGRG |
| Ga0196959_100035663 | 3300021184 | Soil | MRVVLEQARLLARDLAYHRRARLEAAIGRALDEVDGQIEELRADRRG |
| Ga0268243_10010278 | 3300030510 | Soil | MRVLLEEARGLSRNLAYHRKTRLEARLGEVLEEVDRQIE |
| Ga0308204_100721242 | 3300031092 | Soil | MRVLLEEARGLSRNLAYHRRVRLEARLGEALEEVDCQIEELRADRGS |
| Ga0307408_1017855601 | 3300031548 | Rhizosphere | EARGLSRNLAYHRRARLETKVGDALDEVDRQIGELRADRR |
| Ga0307412_102003792 | 3300031911 | Rhizosphere | ARGLSRDLAYHRRARLESSIGEALDEVDQQIEDLRATKS |
| Ga0307412_106776403 | 3300031911 | Rhizosphere | MRVLLEEARGLSRDLAYHRRARLESSIGEALDEVDQQIEDLRATKS |
| Ga0307412_108292472 | 3300031911 | Rhizosphere | RVLLEEARGLSRNLAYHRRARLEDRIGEALDEVDRQIVELRAAKR |
| Ga0307416_1002110482 | 3300032002 | Rhizosphere | VRVLLEEARFLDSLLAYHQRARLEARLGEALDEVDRQFQELRADRR |
| Ga0307416_1032719191 | 3300032002 | Rhizosphere | MRVLLEEARGISRNLAYHRRARLESRIGEALEEVDQQIVELRSDRGS |
| Ga0307415_1001012871 | 3300032126 | Rhizosphere | MRVLLEEARGLSRDLAYHRRARLESRIGDALDEVDQ |
| Ga0268251_100362953 | 3300032159 | Agave | MRVLLEDARVLSRNLAYHRRARLEHVLGQALDEVDHQIEELRRGRG |
| Ga0268251_104533321 | 3300032159 | Agave | MRVLLEEARGMSRNLAYHRRARLEARLGEALDEVDRQIVE |
| Ga0334936_070683_17_157 | 3300034007 | Biocrust | MRVLLKEARLLSRDLAYHRRARLEAVIGRALDEVDRQVGELLQGAP |
| Ga0334946_073043_418_561 | 3300034026 | Sub-Biocrust Soil | MRVLLEEARGLGRNLAYHRRARLEDVLGQALEEVDRQIEQLRRDGRR |
| Ga0334961_028731_535_675 | 3300034143 | Sub-Biocrust Soil | MRVLLEEARLLARDLAYHRRARVEAVLGRALDEVDRQIEDLRRDQG |
| Ga0334960_037281_17_160 | 3300034402 | Sub-Biocrust Soil | MRVLLEEARVHARHLAYHRRARLEDVLGEALEEVDRQIEQLRRDGRR |
| ⦗Top⦘ |