| Basic Information | |
|---|---|
| Family ID | F033318 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 177 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAV |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 177 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 51.41 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 84.18 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.181 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.814 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.073 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.847 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 177 Family Scaffolds |
|---|---|---|
| PF05157 | T2SSE_N | 48.59 |
| PF00730 | HhH-GPD | 9.60 |
| PF00633 | HHH | 3.39 |
| PF10576 | EndIII_4Fe-2S | 2.82 |
| PF00482 | T2SSF | 1.69 |
| PF00437 | T2SSE | 1.69 |
| PF08448 | PAS_4 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
|---|---|---|---|
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 9.60 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 9.60 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 9.60 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 9.60 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 9.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.18 % |
| Unclassified | root | N/A | 15.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10021913 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101055741 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101145753 | Not Available | 666 | Open in IMG/M |
| 3300002914|JGI25617J43924_10364926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300003368|JGI26340J50214_10177731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300004080|Ga0062385_11066725 | Not Available | 546 | Open in IMG/M |
| 3300004080|Ga0062385_11188940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300004082|Ga0062384_100022374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2710 | Open in IMG/M |
| 3300004082|Ga0062384_101127836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300004091|Ga0062387_100381743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300004479|Ga0062595_101397709 | Not Available | 638 | Open in IMG/M |
| 3300005167|Ga0066672_10424233 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005179|Ga0066684_10032427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2860 | Open in IMG/M |
| 3300005439|Ga0070711_101747754 | Not Available | 545 | Open in IMG/M |
| 3300005467|Ga0070706_100599239 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005526|Ga0073909_10241692 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005541|Ga0070733_10337156 | Not Available | 999 | Open in IMG/M |
| 3300005552|Ga0066701_10050608 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
| 3300005556|Ga0066707_10330259 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005559|Ga0066700_10889738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300005561|Ga0066699_10036998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2888 | Open in IMG/M |
| 3300005561|Ga0066699_10656366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300005575|Ga0066702_10390236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300005586|Ga0066691_10544046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300005712|Ga0070764_10317134 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300005944|Ga0066788_10070083 | Not Available | 844 | Open in IMG/M |
| 3300006059|Ga0075017_100272205 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300007265|Ga0099794_10216405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300007788|Ga0099795_10648833 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009012|Ga0066710_102298533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300009038|Ga0099829_11303613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300009088|Ga0099830_11432143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300009088|Ga0099830_11821546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300009089|Ga0099828_10097413 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
| 3300009098|Ga0105245_12576672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → unclassified Desulfuromonas → Desulfuromonas sp. | 562 | Open in IMG/M |
| 3300009137|Ga0066709_103583560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → unclassified Desulfuromonas → Desulfuromonas sp. | 563 | Open in IMG/M |
| 3300009624|Ga0116105_1051060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300010048|Ga0126373_10097097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2717 | Open in IMG/M |
| 3300010048|Ga0126373_10420186 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300010303|Ga0134082_10052597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1565 | Open in IMG/M |
| 3300010321|Ga0134067_10002057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4849 | Open in IMG/M |
| 3300010321|Ga0134067_10012675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2431 | Open in IMG/M |
| 3300010323|Ga0134086_10285608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300010336|Ga0134071_10565094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300010337|Ga0134062_10446314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300010358|Ga0126370_10253993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300010359|Ga0126376_12008306 | Not Available | 620 | Open in IMG/M |
| 3300010376|Ga0126381_104104332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300010398|Ga0126383_10585513 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300010398|Ga0126383_10599303 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300011120|Ga0150983_13314829 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300011269|Ga0137392_10199937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae | 1634 | Open in IMG/M |
| 3300011269|Ga0137392_11266965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300011270|Ga0137391_10254057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1523 | Open in IMG/M |
| 3300011270|Ga0137391_11235981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300011270|Ga0137391_11284964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300012096|Ga0137389_10314829 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300012189|Ga0137388_10739002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300012199|Ga0137383_10598942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300012203|Ga0137399_10724081 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012203|Ga0137399_11385102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300012205|Ga0137362_10017993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5377 | Open in IMG/M |
| 3300012205|Ga0137362_11398870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300012205|Ga0137362_11685503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300012210|Ga0137378_10761067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300012211|Ga0137377_10317081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae | 1494 | Open in IMG/M |
| 3300012349|Ga0137387_10982862 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012349|Ga0137387_11117845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012361|Ga0137360_10823195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300012362|Ga0137361_10168219 | Not Available | 1970 | Open in IMG/M |
| 3300012363|Ga0137390_10154661 | Not Available | 2279 | Open in IMG/M |
| 3300012582|Ga0137358_10029598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3584 | Open in IMG/M |
| 3300012685|Ga0137397_11240767 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012918|Ga0137396_10807015 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012918|Ga0137396_11065074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300012923|Ga0137359_10286330 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300012925|Ga0137419_10459893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300012925|Ga0137419_11271038 | Not Available | 618 | Open in IMG/M |
| 3300012927|Ga0137416_10409066 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300012944|Ga0137410_10325650 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300012971|Ga0126369_13461427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300012977|Ga0134087_10012242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2988 | Open in IMG/M |
| 3300015052|Ga0137411_1165103 | Not Available | 2026 | Open in IMG/M |
| 3300015053|Ga0137405_1048062 | Not Available | 795 | Open in IMG/M |
| 3300015053|Ga0137405_1061080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4807 | Open in IMG/M |
| 3300017930|Ga0187825_10315491 | Not Available | 585 | Open in IMG/M |
| 3300017959|Ga0187779_10063629 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300017959|Ga0187779_10764860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300017959|Ga0187779_11046717 | Not Available | 568 | Open in IMG/M |
| 3300018088|Ga0187771_11286609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300018431|Ga0066655_10009560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4143 | Open in IMG/M |
| 3300018431|Ga0066655_10102405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1607 | Open in IMG/M |
| 3300018433|Ga0066667_11204494 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300018468|Ga0066662_11416895 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018468|Ga0066662_12647691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300019887|Ga0193729_1004296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6915 | Open in IMG/M |
| 3300019890|Ga0193728_1043388 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
| 3300020170|Ga0179594_10191627 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300020199|Ga0179592_10028009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2534 | Open in IMG/M |
| 3300020199|Ga0179592_10048072 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300020579|Ga0210407_10675084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300020579|Ga0210407_10727659 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300020579|Ga0210407_11089042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300020580|Ga0210403_11201484 | Not Available | 584 | Open in IMG/M |
| 3300020581|Ga0210399_10142934 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300020581|Ga0210399_11239505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300020583|Ga0210401_10146293 | All Organisms → cellular organisms → Bacteria | 2210 | Open in IMG/M |
| 3300021168|Ga0210406_11007254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300021171|Ga0210405_10028262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4505 | Open in IMG/M |
| 3300021180|Ga0210396_10135815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2215 | Open in IMG/M |
| 3300021181|Ga0210388_10380966 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300021384|Ga0213876_10046840 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300021384|Ga0213876_10693013 | Not Available | 542 | Open in IMG/M |
| 3300021401|Ga0210393_10806941 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300021402|Ga0210385_11483386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300021403|Ga0210397_11148561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300021404|Ga0210389_11127580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300021405|Ga0210387_10583987 | Not Available | 993 | Open in IMG/M |
| 3300021406|Ga0210386_11550469 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300021479|Ga0210410_10706087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300021479|Ga0210410_11611890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300021559|Ga0210409_11396625 | Not Available | 576 | Open in IMG/M |
| 3300021559|Ga0210409_11595323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300023056|Ga0233357_1029802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300024330|Ga0137417_1042340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300025910|Ga0207684_10524403 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300025914|Ga0207671_10613628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300025921|Ga0207652_11467066 | Not Available | 586 | Open in IMG/M |
| 3300025928|Ga0207700_11930396 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026334|Ga0209377_1100165 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300026508|Ga0257161_1105745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7 | 587 | Open in IMG/M |
| 3300026527|Ga0209059_1184156 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300026527|Ga0209059_1184479 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300026532|Ga0209160_1125608 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300026551|Ga0209648_10379651 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300026557|Ga0179587_10011156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4652 | Open in IMG/M |
| 3300026557|Ga0179587_10452312 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300027610|Ga0209528_1055005 | Not Available | 882 | Open in IMG/M |
| 3300027635|Ga0209625_1094814 | Not Available | 669 | Open in IMG/M |
| 3300027635|Ga0209625_1109875 | Not Available | 619 | Open in IMG/M |
| 3300027651|Ga0209217_1016027 | All Organisms → cellular organisms → Bacteria | 2429 | Open in IMG/M |
| 3300027671|Ga0209588_1279988 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027698|Ga0209446_1149134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300027775|Ga0209177_10220150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300027862|Ga0209701_10213840 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300027862|Ga0209701_10214701 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300027867|Ga0209167_10086444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1587 | Open in IMG/M |
| 3300027882|Ga0209590_10639818 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027884|Ga0209275_10302562 | Not Available | 888 | Open in IMG/M |
| 3300027894|Ga0209068_10909086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300027898|Ga0209067_10147905 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300027903|Ga0209488_10015482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5552 | Open in IMG/M |
| 3300027903|Ga0209488_10529798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300028047|Ga0209526_10381835 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300028536|Ga0137415_11201255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300030058|Ga0302179_10170761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300030878|Ga0265770_1130763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031018|Ga0265773_1036790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300031715|Ga0307476_10925089 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031718|Ga0307474_10827975 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300031720|Ga0307469_10283412 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300031753|Ga0307477_10413692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300031753|Ga0307477_10897944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300031754|Ga0307475_10139660 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin374 | 1918 | Open in IMG/M |
| 3300031754|Ga0307475_10799537 | Not Available | 748 | Open in IMG/M |
| 3300031754|Ga0307475_10905606 | Not Available | 696 | Open in IMG/M |
| 3300031779|Ga0318566_10590989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300031962|Ga0307479_10190612 | Not Available | 2018 | Open in IMG/M |
| 3300031962|Ga0307479_10447829 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300031962|Ga0307479_10626176 | Not Available | 1057 | Open in IMG/M |
| 3300031962|Ga0307479_10865333 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300032001|Ga0306922_10800410 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300032059|Ga0318533_10737557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300032059|Ga0318533_10764544 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300032205|Ga0307472_100022390 | Not Available | 3492 | Open in IMG/M |
| 3300032261|Ga0306920_103802959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300032895|Ga0335074_10383499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae | 1537 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.34% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.26% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.13% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.13% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.13% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_100219133 | 3300001545 | Forest Soil | MSRLTSKQRWGFAAAALFLILLLAAVFTFGSLGVPFEPKNWRDVLTLYAVSSF |
| JGIcombinedJ26739_1010557412 | 3300002245 | Forest Soil | MSHLDNRQRWGLAVGGILLTLLLAAVFTFGSLNIPFEPKNWRAVVLLYA |
| JGIcombinedJ26739_1011457531 | 3300002245 | Forest Soil | MSHLDSKQRWSLVIGGSLLTLLLAAVFTFGSLDVPF |
| JGI25617J43924_103649261 | 3300002914 | Grasslands Soil | MSRSDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLYAVS |
| JGI26340J50214_101777311 | 3300003368 | Bog Forest Soil | MSRLDSKQRWSLVVGGLLVTLLLAAVFTFGSLEVPFQPKSW |
| Ga0062385_110667252 | 3300004080 | Bog Forest Soil | MSSLASRQRLRLAVAGILLSLLLAAVFTFGSLGVPFEPKN |
| Ga0062385_111889401 | 3300004080 | Bog Forest Soil | MSSLESRQRFRLAIVGILLTLLLAAVFTFGSLDVPFEPKNWRDAVT |
| Ga0062384_1000223741 | 3300004082 | Bog Forest Soil | MSRLDSKQRWRLVIGGVFLTLLLAAVFTFGSLDVPFEPKNWRDALTLYAVS |
| Ga0062384_1011278361 | 3300004082 | Bog Forest Soil | MSRLDSKQHWSLVIGGSLLTLLLAAVFTFGSLEVPFEPKSWRTLMPLYAVSS |
| Ga0062387_1003817431 | 3300004091 | Bog Forest Soil | MSSLESRQRFRLVIAGIVLTLLLAAVFTFGSLDVPFEPKNWRDALTLYA |
| Ga0062595_1013977091 | 3300004479 | Soil | MSLAPKHRWGLGFGGVLLALLLAAVFTFGSLDVPFEPGNWRA |
| Ga0066672_104242331 | 3300005167 | Soil | MRPLDNKQRWGLAFGGILLTLLLAAVFTFGSLNVPFEPKSWRDVMVLYA |
| Ga0066684_100324271 | 3300005179 | Soil | MSRLESKQRWVLGIGGILLTLLLAAVFTFGSLDVPFHPKSWREVMALYAVSSFI |
| Ga0070711_1017477541 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLAPKHRWGLAFGGVLLALLLAAVFTFGSLDVPFEPENWRPLLSLYSVSAFI |
| Ga0070706_1005992391 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHLDNRQRWGLVIGGILLTLLLAAVFTFGSLTAPFEPKNWR |
| Ga0073909_102416921 | 3300005526 | Surface Soil | MSHLDNRQRWGLAVGGILLTLLLAAVFTFGSLTIPFEP |
| Ga0070733_103371562 | 3300005541 | Surface Soil | MSSLQPKHRWSLAIGGILLSLLLAAVFTFGSLDVPF |
| Ga0066701_100506083 | 3300005552 | Soil | MSRLDNKQRWGLAIGGILLTLLMAAVFTFGSLNVPFEPKSWRDVMVLYAVSSF |
| Ga0066707_103302591 | 3300005556 | Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFE |
| Ga0066700_108897381 | 3300005559 | Soil | MRPLDNKQRWGLAFGGILLTLLLAAVFTFGSLNVPF |
| Ga0066699_100369983 | 3300005561 | Soil | MSHLDSKQRWGLATGAILLTLLLAAVFTFGSLDVPFHPKSWREVMVLYAVSSF |
| Ga0066699_106563663 | 3300005561 | Soil | MSRLDSKQRWGLAIGAILLTLLLAAVFTFGSLDVPFHPKSWREVMVLYAVSSF |
| Ga0066702_103902363 | 3300005575 | Soil | MSRLDSKQRWGLAIGAILLTLLLAAVFTFGSLDVPFHPKS |
| Ga0066691_105440461 | 3300005586 | Soil | MSRLDTKQRWALIVGGILLTLLLAAVFTFGSLDVPFKPKNWRDVMALYAVSSFI |
| Ga0070764_103171341 | 3300005712 | Soil | MSRLDSKQRWSLVIGGSLLTLLLAAVFTFGSLEVPFEPKSWRTLMPLYAVS |
| Ga0066788_100700832 | 3300005944 | Soil | MSPLQPKHRWSLVIGGILLSLLLAAVFTFGSLDLPFEPGTWRANISLF |
| Ga0075017_1002722051 | 3300006059 | Watersheds | MSRTDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVL |
| Ga0099794_102164051 | 3300007265 | Vadose Zone Soil | MSHLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVM |
| Ga0099795_106488331 | 3300007788 | Vadose Zone Soil | MSSLEPKQRWTLGIGAALLALLLAAVFTFGSLDVPFEPKNWRETIALLSV |
| Ga0066710_1022985331 | 3300009012 | Grasslands Soil | MSRLESKQRWVLGIGGILLTLLLAAVFTFGSLDVPFHPKSWREVMALY |
| Ga0099829_113036132 | 3300009038 | Vadose Zone Soil | MSRLDKKQSWGLAIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVMVLYAV |
| Ga0099830_114321432 | 3300009088 | Vadose Zone Soil | MSRLENKQRWGLAIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVMVLY |
| Ga0099830_118215461 | 3300009088 | Vadose Zone Soil | MSRLETKQRWGLAIGGILLTVLLAGVFTFGSLDVPF |
| Ga0099828_100974131 | 3300009089 | Vadose Zone Soil | MSSLEPKQRWTLAIGAALLALLLAAVFTFGSLAVPFEPGNWREAMAL |
| Ga0105245_125766722 | 3300009098 | Miscanthus Rhizosphere | MSLAPKHRWGLAFGGVLLALLLAAVFTFGSLDVPFE |
| Ga0066709_1035835601 | 3300009137 | Grasslands Soil | MSLAPKHRWGLAFGGILLALLLAAVFTFGSLDVPFE |
| Ga0116105_10510601 | 3300009624 | Peatland | MSSLASSQRLRLAVAGILLTLLLAAAFTFGSLGVPF |
| Ga0126373_100970973 | 3300010048 | Tropical Forest Soil | MTRLESKQRWVLSVGGILLTLLLAAVFTLGSLDVPFKPKSWGDVMALYAVSSLVT |
| Ga0126373_104201862 | 3300010048 | Tropical Forest Soil | MSRLETRQRLGLTIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVMAL |
| Ga0134082_100525972 | 3300010303 | Grasslands Soil | MSRLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKS |
| Ga0134067_100020571 | 3300010321 | Grasslands Soil | MSRLESKQRWVLGIGGILLTLLLAAVFTFGSLDIPFHPKSWREVMA |
| Ga0134067_100126751 | 3300010321 | Grasslands Soil | MSRLDNKQRWGLAIGGILLTVLLAAVFTFGSLNVPFEPKSWRD |
| Ga0134086_102856081 | 3300010323 | Grasslands Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLYAVSS |
| Ga0134071_105650942 | 3300010336 | Grasslands Soil | MSHLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEP |
| Ga0134062_104463142 | 3300010337 | Grasslands Soil | MSHLDSKQRWGLGIGGILLTLLLAAVFTLGSLDVPFKPKSWRDVMVLYAVSSFV |
| Ga0126370_102539932 | 3300010358 | Tropical Forest Soil | MSRLESKQRWVLSVGGILLTLLLAAVFTLGSLDVPFKPKSWGDVMAL |
| Ga0126376_120083062 | 3300010359 | Tropical Forest Soil | MSSLQPRQRWTLVIGGILLSLLLGAVFTFGSLDVPFEPGNWRALLP |
| Ga0126381_1041043321 | 3300010376 | Tropical Forest Soil | MSRLESKQRWGLGIGGILLTLLLAAVFTFGSLDVPFHPKSWREVMVLYAVSS |
| Ga0126383_105855131 | 3300010398 | Tropical Forest Soil | MSREGSKHRLPLILGGIGLSLLLAAVFTFGSLNVPFEPQDWRDVLT |
| Ga0126383_105993031 | 3300010398 | Tropical Forest Soil | MSRVDSKQRWVLVIGGILLTLLLAAVFTFGSLDVPFHPKSWREVMALYAV |
| Ga0150983_133148292 | 3300011120 | Forest Soil | MSSLEPKQRWTLGIGAALLTLLLAAVFTFGSLDMPFEPRNWR |
| Ga0137392_101999372 | 3300011269 | Vadose Zone Soil | MSQIDSKQRWGLTVGGILLTLLLAAVFTFGSLDVPFE |
| Ga0137392_112669652 | 3300011269 | Vadose Zone Soil | MSRLDNKQRWGLTIGGILLTLLLAAVFTFGSLNVPF |
| Ga0137391_102540571 | 3300011270 | Vadose Zone Soil | MSPLESKQRWSLAIGGVLLTLLLAAVFTFGSLDVPFEPKDWREVMAL |
| Ga0137391_112359811 | 3300011270 | Vadose Zone Soil | MSRLDKKQSWGLAIGGILLTLLLAAVFTFGSLTVPLEPKSWRAVMVLY |
| Ga0137391_112849641 | 3300011270 | Vadose Zone Soil | MSRLDNKQSWGLAIGGILLTLLLAAVFTFGSLNVPFEP |
| Ga0137389_103148291 | 3300012096 | Vadose Zone Soil | MSRLDNKQRWGLAIGGILLALLLAAVFTFGSLDVPFEPK |
| Ga0137388_107390022 | 3300012189 | Vadose Zone Soil | AACLMSSLEPKQRWTLAIVAALLALLLSAVFTFGSLAVPFEP* |
| Ga0137383_105989422 | 3300012199 | Vadose Zone Soil | MSRLESKQRWGLGIGGILLTLLLAVVFTFGSLDVPFHP |
| Ga0137399_107240812 | 3300012203 | Vadose Zone Soil | MSRLDKKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRDVMVL |
| Ga0137399_113851021 | 3300012203 | Vadose Zone Soil | MDNKQQWGLAIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVM |
| Ga0137362_100179935 | 3300012205 | Vadose Zone Soil | MSRLDTKQRWALAVGGILLTLLLAAVFTFGSLDVPFKP |
| Ga0137362_113988701 | 3300012205 | Vadose Zone Soil | MSHLNNKQRWGLAIGGILLTLLLAALFTFGSLNVPFEPKSWRAVMVLYAVSSF |
| Ga0137362_116855031 | 3300012205 | Vadose Zone Soil | MSHLHNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVL |
| Ga0137378_107610672 | 3300012210 | Vadose Zone Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLY |
| Ga0137377_103170812 | 3300012211 | Vadose Zone Soil | MSRLESKQRWGLGIGGILLTLLLAVVFTFGSLDVPFHPKSWREVM |
| Ga0137387_109828622 | 3300012349 | Vadose Zone Soil | MSRLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEP |
| Ga0137387_111178451 | 3300012349 | Vadose Zone Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVM |
| Ga0137360_108231951 | 3300012361 | Vadose Zone Soil | MSHLHNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLYA |
| Ga0137361_101682191 | 3300012362 | Vadose Zone Soil | MSHLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWR |
| Ga0137390_101546611 | 3300012363 | Vadose Zone Soil | MSRLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLYAVSS |
| Ga0137358_100295985 | 3300012582 | Vadose Zone Soil | MSRLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLYAVSSF |
| Ga0137397_112407671 | 3300012685 | Vadose Zone Soil | MSSLEPKQRWTLGIGAALLALLLAAVFTFGSLDVPFEPKNWRETIALLSVSSFVT |
| Ga0137396_108070152 | 3300012918 | Vadose Zone Soil | MSRLDNRQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPK |
| Ga0137396_110650741 | 3300012918 | Vadose Zone Soil | MSHLNNRQRWGLAIGGILLTLLMAAVFTFGSLTVPFEPKDWRAGMM |
| Ga0137359_102863301 | 3300012923 | Vadose Zone Soil | MSSLEPKQRWTLGVGAALLTLLLSAVFTFGSLDVPFEPKS |
| Ga0137419_104598931 | 3300012925 | Vadose Zone Soil | MSHLHNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSLRAVM |
| Ga0137419_112710382 | 3300012925 | Vadose Zone Soil | MSSLEPRQRWTLGIGAALLTLLLAAVFTFGSLDVPFE |
| Ga0137416_104090661 | 3300012927 | Vadose Zone Soil | MSSLEPKQRWTLAIGAALLALLLAAVFTFGSLDVPFEPKNWRET |
| Ga0137410_103256502 | 3300012944 | Vadose Zone Soil | MSHLNNRQRWGLVIGGILLTLLLAAVFTFGSLNVPFEA |
| Ga0126369_134614271 | 3300012971 | Tropical Forest Soil | MSRLESKQRWGLGIGGILLTLLLAAVFTFGSLDVP |
| Ga0134087_100122421 | 3300012977 | Grasslands Soil | MSHLNSKQRWGLGFGGILLTLLLAAVFTFGSLDVPFHPKSWREVLALYTVSSFVTA |
| Ga0137411_11651032 | 3300015052 | Vadose Zone Soil | MSHLNNRQRWGLVIGGILLTLLLAAVFTFGSLNVP |
| Ga0137405_10480622 | 3300015053 | Vadose Zone Soil | MSSLQPKHRWSLAIGGILLSLLLAAVFTFGSLDVPFEPGSWRARISLFAVS |
| Ga0137405_10610801 | 3300015053 | Vadose Zone Soil | MSHLDNRQRWGLVIGGILLTLLLAAVFTFGSLNVPFELKDWRARMPLF |
| Ga0187825_103154911 | 3300017930 | Freshwater Sediment | MSHLQPKQRWTLVFGGLLFTLLLAAVFTFGSLDVPFAPKS |
| Ga0187779_100636291 | 3300017959 | Tropical Peatland | MSREGSKHRLPLTLGGIGLSLLLAAVFTFGSLNVPFEPQNWRDVLTLYAV |
| Ga0187779_107648601 | 3300017959 | Tropical Peatland | MSRLENKQRWVLAIGGILLTLLLAAIFTFGSLDVPFEPKS |
| Ga0187779_110467172 | 3300017959 | Tropical Peatland | MSSLPPKQRWSLVLGGVLLSLLLGAVFTFGSLDVPFEPGNWRAVLAL |
| Ga0187771_112866092 | 3300018088 | Tropical Peatland | MSRLENKQRLVLTVGGILLTLLLAAIFTFGSLDVPFEPKSWRAVLVL |
| Ga0066655_100095601 | 3300018431 | Grasslands Soil | MSRLDNKQRWGLAIGGILLTVLLAAVFTFGSLNVPFEPKS |
| Ga0066655_101024051 | 3300018431 | Grasslands Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAV |
| Ga0066667_112044942 | 3300018433 | Grasslands Soil | MSRLDNKQRWGLAIGGILLTLLLAAVFTFGSLNVP |
| Ga0066662_114168951 | 3300018468 | Grasslands Soil | MSHLESKQRWVLGIGGILLTLLLAAVFTFGSLDVPFHPKSWRE |
| Ga0066662_126476911 | 3300018468 | Grasslands Soil | MSRLDNKQRWGLAIGGILLTLLFAAVFTFGSLNVPFEPKSWR |
| Ga0193729_10042961 | 3300019887 | Soil | MSRLTSKQRWGFAAGALFLILLLAAVFTFGSLGVPFEPKNWR |
| Ga0193728_10433882 | 3300019890 | Soil | MSRLNSKQRWGISLGALFLTLLLAAVFTFGSLGVPFEPKNW |
| Ga0179594_101916272 | 3300020170 | Vadose Zone Soil | MSRLNIKQHWGLAVGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMALYAVSSFI |
| Ga0179592_100280091 | 3300020199 | Vadose Zone Soil | MSRLNIKQRWGLAVGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMALYAVS |
| Ga0179592_100480721 | 3300020199 | Vadose Zone Soil | MSSLEPKQRWTLGIGAALLALLLAAVFTFGSLDVPFEPKNWRETIALLSVSSF |
| Ga0210407_106750841 | 3300020579 | Soil | MSRLEPKQRLQLAIGGVCLTLLFAAVFTFGSLNVPFEPQNW |
| Ga0210407_107276591 | 3300020579 | Soil | MSRLDSKQRWSLVIGGSLLTLLLAAVFTFGSLDVPF |
| Ga0210407_110890422 | 3300020579 | Soil | MSRLDSKQRWTLVTGGILLTLLLAAVFTFGSLEVPFEPKSWRAL |
| Ga0210403_112014842 | 3300020580 | Soil | MSRLDSKQRWTLVTGGILLTLLLAAVFTFGSLEVPFEPKS |
| Ga0210399_101429341 | 3300020581 | Soil | MSSLQPKHRWSLAVGGILLTLLLAAVFTFGSLDFPF |
| Ga0210399_112395051 | 3300020581 | Soil | MSRLDSKQRWRLVLGGIFLTLLMAAVFTFGSLDVPFEPKNWR |
| Ga0210401_101462933 | 3300020583 | Soil | MSSHQPKHRWSLAIGGILLSLLLAAVFTFGSLDVPFEPGSWRAK |
| Ga0210406_110072541 | 3300021168 | Soil | MSHLDSKQRWSLVIGGSLLTLLLAAVFTFGSLDVPFEPKSWRAL |
| Ga0210405_100282621 | 3300021171 | Soil | MSSLEPKQRWTLGVGAALLTLLLAAVFTFGSLDVPFEPKNWREAMALYAVSSLI |
| Ga0210396_101358153 | 3300021180 | Soil | MSRLDSKQRWSLVIGGSLLTLLLAAVFTFGSLEVPFEPKSW |
| Ga0210388_103809661 | 3300021181 | Soil | MSHLNKRQSWGLAISGILLTLLLAAVFTFGSLNVPFEPKGWRAGMVLFA |
| Ga0213876_100468401 | 3300021384 | Plant Roots | VSLRPRQRWTLVFGGITIALLLAAIFTFGSLDVPFKPGNWRAVMGLYSVSS |
| Ga0213876_106930132 | 3300021384 | Plant Roots | VSLRPRQRWTLVFGGITIALLLAAIFTFGSLDVPINPAN |
| Ga0210393_108069411 | 3300021401 | Soil | MSRLDSKQRWTLVTGGILLTLLLAAVFTFGSLEVPFE |
| Ga0210385_114833861 | 3300021402 | Soil | MSRLDSKQRWSLVFGGILLTLLLAAVFTFGSLEVPFEPKSWRTLMPLY |
| Ga0210397_111485612 | 3300021403 | Soil | MSRLTAKQRWGFAAGALFLILLLAAVFTFGSLGVPFEPKNWRELLTLYAVT |
| Ga0210389_111275802 | 3300021404 | Soil | MSPLESKHRFRLILAGIFLTMLLAAVFTFGSLDVPFEPKNWR |
| Ga0210387_105839871 | 3300021405 | Soil | MSPLQPKHRWSLAIGGVLLSFLLAAVFTFGSLDVP |
| Ga0210386_115504692 | 3300021406 | Soil | MSRLDSKQRWSLVIGGSLLTLLLAAVFTFGSLDVP |
| Ga0210410_107060872 | 3300021479 | Soil | MSRPDNKQRWGLAIGGILLTLLLAAVFTFGSLTVPFEPK |
| Ga0210410_116118902 | 3300021479 | Soil | MDNKQQWGLAIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVMVL |
| Ga0210409_113966251 | 3300021559 | Soil | MSSLQPKHRWSLAVGGILLTLLLAAVFTFGSLDFPFEPGTWRAAMALYAVSSFI |
| Ga0210409_115953231 | 3300021559 | Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLYAVSSFI |
| Ga0233357_10298021 | 3300023056 | Soil | MSRLTSKQRWGFAAGALFLILLLAAVFTFGSLGVPFEPKNWRELLTLY |
| Ga0137417_10423401 | 3300024330 | Vadose Zone Soil | MSRLDTKQRWMLVGGGFCLTILLAAVFTFGSLDVPFEPKNWRDALTLYA |
| Ga0207684_105244032 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHLDNRQRWGLVIGGILLTLLLAAVFTFGSLTAPFEPK |
| Ga0207671_106136282 | 3300025914 | Corn Rhizosphere | MSLRPRQRWTLVFGGIAITLLLAAIFTFGSLDVPFKPGNWRAVMGLYS |
| Ga0207652_114670662 | 3300025921 | Corn Rhizosphere | MSRLDSKQRWSLVIGGILLTLLFAAVFTFGSLEVPF |
| Ga0207700_119303961 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSLEPKQRWTLGIGAALLALLLAAVFTFGSLDVPFEPKNWRET |
| Ga0209377_11001652 | 3300026334 | Soil | MSRLDNKQRWGLAIGGILLTVLLAAVFTFGSLNVPF |
| Ga0257161_11057451 | 3300026508 | Soil | MSSLEPKQRWTLGIGAALLTLLLSAVFTFGSLDVPFEPKNWREAIALYAV |
| Ga0209059_11841561 | 3300026527 | Soil | MSHLDSKQRWGLATGAILLTLLLAAVFTFGSLDVPFHPKSWREVMV |
| Ga0209059_11844791 | 3300026527 | Soil | MSRLDSKQRWGLAIGAILLTLLLAAVFTFGSLDVPFHPKSWREVMV |
| Ga0209160_11256081 | 3300026532 | Soil | MSRLESKQRWGLGIGGILLTLLLAVVFTFGSLDVPFHPKSWREVMVLYAVSSF |
| Ga0209648_103796512 | 3300026551 | Grasslands Soil | MSRLDSKQRWSLLIGGVLLTLLLAAVFTFGSLDVPFEPSSW |
| Ga0179587_100111564 | 3300026557 | Vadose Zone Soil | MSHLDNKQRWGLAIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVMAL |
| Ga0179587_104523121 | 3300026557 | Vadose Zone Soil | MSPLEPKQRWTLATGAALLALLLAAVFTFGSLAVPFEPGNWREAMALYA |
| Ga0209528_10550052 | 3300027610 | Forest Soil | MSSHQPKHRWTLAIGGILLSLLLAAVFTFGSLDMPFE |
| Ga0209625_10948142 | 3300027635 | Forest Soil | MSSLEPKQRWTLGIGAALLTLLLAAVFTFGSLDVPFEPKNWRET |
| Ga0209625_11098751 | 3300027635 | Forest Soil | VSPLAPKQRWTLGIGAALLTLLLAAVFTFGSLDVNFEPSNWRQLLPLYAVS |
| Ga0209217_10160273 | 3300027651 | Forest Soil | MSPLHPKQRWSLAIGGILLTLLLAAVFTFGSLDVPFEPGNWRAAMALYAV |
| Ga0209588_12799882 | 3300027671 | Vadose Zone Soil | MSSLEPKQRWTLGIGAALLALLLAAVFTFGSLDVPF |
| Ga0209446_11491342 | 3300027698 | Bog Forest Soil | MSSPESRQRLRLAIAGIFLTLLLAAVFTFGSLDVPFEPKNWRDALTLYAV |
| Ga0209177_102201502 | 3300027775 | Agricultural Soil | MSRLESKQRWGLGIGGILLTLLLAAVFTFGSLDVPFHPK |
| Ga0209701_102138401 | 3300027862 | Vadose Zone Soil | MSHLNNRQRWGLAIGGILLTLLMAAVFTFGSLNVPFEPKS |
| Ga0209701_102147011 | 3300027862 | Vadose Zone Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPRSW |
| Ga0209167_100864441 | 3300027867 | Surface Soil | MSLRPRQRWTLVIGGIAITLLLAAIFTFGSLDVPFKPGNW |
| Ga0209590_106398182 | 3300027882 | Vadose Zone Soil | MSRLDSKQRWGLAIGGILLTLLLAAVFTFGSLDVPFEPKS |
| Ga0209275_103025621 | 3300027884 | Soil | MSSLQPKHRWSLAIGGILLSLLLAAVFTFGSLDVPFEPGGWRAKLVLFA |
| Ga0209068_109090861 | 3300027894 | Watersheds | MSRTDNKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMVLY |
| Ga0209067_101479052 | 3300027898 | Watersheds | MSRLDNRQRLGLAIGGILLSLLLAAVFTFGSLDTPFDPKSWRAVMVLYAV |
| Ga0209488_100154826 | 3300027903 | Vadose Zone Soil | MSPLEPKQRWTLATGAALLALLLAAVFTFGSLAVPFEPGNWREAMALY |
| Ga0209488_105297982 | 3300027903 | Vadose Zone Soil | MSRLDSKQRWGLAIGGILLALLLAAVFTFGSLNVPFEPKS |
| Ga0209526_103818352 | 3300028047 | Forest Soil | MSHLDNRQRWGLAVGGILLTLLLAAVFTFGSLNIPFEPKNWR |
| Ga0137415_112012551 | 3300028536 | Vadose Zone Soil | MSRLDTKQRWMLVGGGFCLTILLAAVFTFGSLDVPFEPKNWRDALTLYAVSS |
| Ga0302179_101707612 | 3300030058 | Palsa | MSNFISRPRFRLAIAGVFLTLLLAAVFTFGSLDVPFEPKNWRDALTLYA |
| Ga0265770_11307631 | 3300030878 | Soil | MSRLDSKQRWTLVIGGILVTLLLAAVFTFGSLEVPFEPKSWRTLM |
| Ga0265773_10367902 | 3300031018 | Soil | MSRLDSKQRWTLVIGGILVTLLLAAVFTFGSLEVPFEPKSWRTLMPLYAVSSF |
| Ga0307476_109250892 | 3300031715 | Hardwood Forest Soil | MSSHQSKHRWSLAIGGILLSLLLAAVFTFGSLDVPFEPGS |
| Ga0307474_108279752 | 3300031718 | Hardwood Forest Soil | MSRLEPRQTLRLVVAGIFLTLLLAAVFTFGSLGVPFE |
| Ga0307469_102834121 | 3300031720 | Hardwood Forest Soil | MSRLDSKQRWSLAIGGILLTLLFAAVFTFGSLEVPFEPKS |
| Ga0307477_104136921 | 3300031753 | Hardwood Forest Soil | MSRLNNKQRWGLAVGGILLTLLLAAVFTFGSLNVPFEPKSWRAVMALYAVSSFI |
| Ga0307477_108979441 | 3300031753 | Hardwood Forest Soil | MSHLDSKQRWSLVIGGSLLTLLLAAVFTFGSLDVPFEPKSWRALMPLYAVS |
| Ga0307475_101396602 | 3300031754 | Hardwood Forest Soil | MSRMDNKQQWGLAIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVMVLYAVSS |
| Ga0307475_107995372 | 3300031754 | Hardwood Forest Soil | MSSLEPKQRWTLGIGAALLALLLAAVFTFGSLDVP |
| Ga0307475_109056062 | 3300031754 | Hardwood Forest Soil | MSSLEPKQRWTLGIGAALLALLLAAVFTFGSLDVPFEPKNW |
| Ga0318566_105909892 | 3300031779 | Soil | MSRPGSKHRFPLILGGIGLSLLLAAVFTFGSLNVPFEPQSWREVLT |
| Ga0307479_101906121 | 3300031962 | Hardwood Forest Soil | MSRLDKKQRWGLAIGGILLTLLLAAVFTFGSLNVPFEPRSW |
| Ga0307479_104478292 | 3300031962 | Hardwood Forest Soil | MSRMDNKQQWGLAIGGILLTLLLAAVFTFGSLDVPFEPKSWRAVMV |
| Ga0307479_106261762 | 3300031962 | Hardwood Forest Soil | MSSLEPRQRWTLGIGAALLTLLLAAVFTFGSLDVPFEPGN |
| Ga0307479_108653332 | 3300031962 | Hardwood Forest Soil | MSRLTSKQRWGFAVGALFLILLLAAVFTFGSLGVPFEPKNWRDVLTLY |
| Ga0306922_108004102 | 3300032001 | Soil | MSRLESKQRWGLATGGILLTLLLAAVFTFGSLDVPFHPKSWREVM |
| Ga0318533_107375572 | 3300032059 | Soil | MSRLESKQRWGLATGGILLTLLLAAVFTFGSLDVPFHPKSWREVMVLYAVSSFV |
| Ga0318533_107645442 | 3300032059 | Soil | MSRPGSKHRFPLILGGIGLSLLLAAVFTFGSLNVPFEPQSW |
| Ga0307472_1000223904 | 3300032205 | Hardwood Forest Soil | MSHLNKRQRLGLVIGGILLTLLLAAVFTFGSLNVPFEPKD |
| Ga0306920_1038029592 | 3300032261 | Soil | VSRLDSKQRWVLGIGGVLLTLLLAAVFTFGSLDVPFHPKSWREVMAL |
| Ga0335074_103834991 | 3300032895 | Soil | MSHLEPKQRWSLAIGGVLLTLLLAAVFTFGSLDVPFEPSSWRAL |
| ⦗Top⦘ |