| Basic Information | |
|---|---|
| Family ID | F033207 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLTTLHP |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.09 % |
| % of genes near scaffold ends (potentially truncated) | 23.03 % |
| % of genes from short scaffolds (< 2000 bps) | 77.53 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.539 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (21.348 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.393 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.371 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.88% β-sheet: 0.00% Coil/Unstructured: 53.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF09361 | Phasin_2 | 13.48 |
| PF00166 | Cpn10 | 5.06 |
| PF00118 | Cpn60_TCP1 | 2.25 |
| PF08379 | Bact_transglu_N | 1.69 |
| PF01521 | Fe-S_biosyn | 1.69 |
| PF13439 | Glyco_transf_4 | 1.12 |
| PF13545 | HTH_Crp_2 | 1.12 |
| PF00011 | HSP20 | 1.12 |
| PF01391 | Collagen | 1.12 |
| PF13581 | HATPase_c_2 | 0.56 |
| PF03734 | YkuD | 0.56 |
| PF01883 | FeS_assembly_P | 0.56 |
| PF07929 | PRiA4_ORF3 | 0.56 |
| PF06568 | DUF1127 | 0.56 |
| PF13751 | DDE_Tnp_1_6 | 0.56 |
| PF14534 | DUF4440 | 0.56 |
| PF13358 | DDE_3 | 0.56 |
| PF07883 | Cupin_2 | 0.56 |
| PF08734 | GYD | 0.56 |
| PF12973 | Cupin_7 | 0.56 |
| PF02653 | BPD_transp_2 | 0.56 |
| PF07724 | AAA_2 | 0.56 |
| PF02826 | 2-Hacid_dh_C | 0.56 |
| PF00271 | Helicase_C | 0.56 |
| PF07238 | PilZ | 0.56 |
| PF04226 | Transgly_assoc | 0.56 |
| PF04134 | DCC1-like | 0.56 |
| PF00152 | tRNA-synt_2 | 0.56 |
| PF00534 | Glycos_transf_1 | 0.56 |
| PF01329 | Pterin_4a | 0.56 |
| PF07568 | HisKA_2 | 0.56 |
| PF00582 | Usp | 0.56 |
| PF03401 | TctC | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 5.06 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.25 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.69 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.12 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.56 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.56 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.56 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.56 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.56 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.56 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.56 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.54 % |
| Unclassified | root | N/A | 31.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig30004 | Not Available | 1070 | Open in IMG/M |
| 2189573004|GZGWRS402FL579 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101209247 | Not Available | 539 | Open in IMG/M |
| 3300000567|JGI12270J11330_10052119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2181 | Open in IMG/M |
| 3300002677|Ga0005475J37263_107383 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300004091|Ga0062387_100626280 | Not Available | 776 | Open in IMG/M |
| 3300004152|Ga0062386_101717157 | Not Available | 524 | Open in IMG/M |
| 3300005538|Ga0070731_10011790 | All Organisms → cellular organisms → Bacteria | 6387 | Open in IMG/M |
| 3300005542|Ga0070732_10000190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 49671 | Open in IMG/M |
| 3300005561|Ga0066699_11020232 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005569|Ga0066705_10424390 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300006041|Ga0075023_100044871 | Not Available | 1362 | Open in IMG/M |
| 3300006041|Ga0075023_100291441 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006041|Ga0075023_100313518 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006047|Ga0075024_100395466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 702 | Open in IMG/M |
| 3300006050|Ga0075028_100204575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300006052|Ga0075029_100126687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1554 | Open in IMG/M |
| 3300006052|Ga0075029_100678759 | Not Available | 693 | Open in IMG/M |
| 3300006052|Ga0075029_101177758 | Not Available | 534 | Open in IMG/M |
| 3300006057|Ga0075026_100047603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2011 | Open in IMG/M |
| 3300006057|Ga0075026_100177302 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300006059|Ga0075017_100526178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 899 | Open in IMG/M |
| 3300006059|Ga0075017_101662371 | Not Available | 504 | Open in IMG/M |
| 3300006086|Ga0075019_10384831 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300006172|Ga0075018_10034817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2032 | Open in IMG/M |
| 3300006174|Ga0075014_100083347 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300006175|Ga0070712_100045141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3041 | Open in IMG/M |
| 3300006176|Ga0070765_100748366 | Not Available | 923 | Open in IMG/M |
| 3300006755|Ga0079222_10099160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1525 | Open in IMG/M |
| 3300006755|Ga0079222_10366270 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006893|Ga0073928_10099921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2438 | Open in IMG/M |
| 3300006893|Ga0073928_10322394 | Not Available | 1153 | Open in IMG/M |
| 3300006914|Ga0075436_101293476 | Not Available | 551 | Open in IMG/M |
| 3300007982|Ga0102924_1020930 | All Organisms → cellular organisms → Bacteria | 4769 | Open in IMG/M |
| 3300009519|Ga0116108_1005438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5434 | Open in IMG/M |
| 3300009519|Ga0116108_1023545 | Not Available | 2083 | Open in IMG/M |
| 3300009521|Ga0116222_1162479 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300009522|Ga0116218_1021341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2880 | Open in IMG/M |
| 3300009522|Ga0116218_1560066 | Not Available | 508 | Open in IMG/M |
| 3300009524|Ga0116225_1567118 | Not Available | 502 | Open in IMG/M |
| 3300009623|Ga0116133_1119338 | Not Available | 679 | Open in IMG/M |
| 3300009630|Ga0116114_1015444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2369 | Open in IMG/M |
| 3300009683|Ga0116224_10309694 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300009698|Ga0116216_10305478 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300009698|Ga0116216_10990704 | Not Available | 502 | Open in IMG/M |
| 3300009700|Ga0116217_10070991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2445 | Open in IMG/M |
| 3300009700|Ga0116217_10118676 | Not Available | 1792 | Open in IMG/M |
| 3300009700|Ga0116217_10958507 | Not Available | 524 | Open in IMG/M |
| 3300009824|Ga0116219_10199697 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300009839|Ga0116223_10049725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2743 | Open in IMG/M |
| 3300009839|Ga0116223_10285830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
| 3300009839|Ga0116223_10337193 | Not Available | 894 | Open in IMG/M |
| 3300009839|Ga0116223_10347704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 878 | Open in IMG/M |
| 3300010343|Ga0074044_10037354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3385 | Open in IMG/M |
| 3300010343|Ga0074044_10154559 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300010343|Ga0074044_10368383 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300010379|Ga0136449_100951289 | Not Available | 1391 | Open in IMG/M |
| 3300010379|Ga0136449_101013322 | Not Available | 1335 | Open in IMG/M |
| 3300010379|Ga0136449_101116192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1253 | Open in IMG/M |
| 3300010379|Ga0136449_101182753 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300010379|Ga0136449_101749461 | Not Available | 933 | Open in IMG/M |
| 3300010379|Ga0136449_103434372 | Not Available | 605 | Open in IMG/M |
| 3300010396|Ga0134126_10996571 | Not Available | 938 | Open in IMG/M |
| 3300010937|Ga0137776_1680496 | Not Available | 703 | Open in IMG/M |
| 3300011089|Ga0138573_1233860 | Not Available | 730 | Open in IMG/M |
| 3300011120|Ga0150983_10256034 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300011120|Ga0150983_10477750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 528 | Open in IMG/M |
| 3300011120|Ga0150983_10606139 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300011120|Ga0150983_13952786 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300011120|Ga0150983_14260436 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300011120|Ga0150983_15038390 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300011120|Ga0150983_15601617 | Not Available | 686 | Open in IMG/M |
| 3300011120|Ga0150983_16610024 | Not Available | 574 | Open in IMG/M |
| 3300012206|Ga0137380_10051194 | All Organisms → cellular organisms → Bacteria | 3787 | Open in IMG/M |
| 3300012208|Ga0137376_10060236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3128 | Open in IMG/M |
| 3300012364|Ga0134027_1074048 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012955|Ga0164298_10145969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1322 | Open in IMG/M |
| 3300014156|Ga0181518_10136274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1330 | Open in IMG/M |
| 3300014158|Ga0181521_10041960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3275 | Open in IMG/M |
| 3300014159|Ga0181530_10050801 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
| 3300014159|Ga0181530_10428168 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300014162|Ga0181538_10698693 | Not Available | 525 | Open in IMG/M |
| 3300014164|Ga0181532_10041077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3120 | Open in IMG/M |
| 3300014164|Ga0181532_10246505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300014164|Ga0181532_10737316 | Not Available | 530 | Open in IMG/M |
| 3300014165|Ga0181523_10103145 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300014165|Ga0181523_10731548 | Not Available | 540 | Open in IMG/M |
| 3300014169|Ga0181531_10659973 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300014638|Ga0181536_10139352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1295 | Open in IMG/M |
| 3300014638|Ga0181536_10254880 | Not Available | 838 | Open in IMG/M |
| 3300015373|Ga0132257_102857892 | Not Available | 629 | Open in IMG/M |
| 3300016750|Ga0181505_10298468 | Not Available | 1321 | Open in IMG/M |
| 3300017823|Ga0187818_10026529 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300017924|Ga0187820_1297556 | Not Available | 530 | Open in IMG/M |
| 3300017925|Ga0187856_1013748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4460 | Open in IMG/M |
| 3300017925|Ga0187856_1025958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2876 | Open in IMG/M |
| 3300017929|Ga0187849_1053256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1877 | Open in IMG/M |
| 3300017931|Ga0187877_1025538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3067 | Open in IMG/M |
| 3300017932|Ga0187814_10005670 | All Organisms → cellular organisms → Bacteria | 5026 | Open in IMG/M |
| 3300017933|Ga0187801_10217025 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300017934|Ga0187803_10021153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2594 | Open in IMG/M |
| 3300017935|Ga0187848_10165401 | Not Available | 967 | Open in IMG/M |
| 3300017942|Ga0187808_10043137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1894 | Open in IMG/M |
| 3300017943|Ga0187819_10555376 | Not Available | 652 | Open in IMG/M |
| 3300017946|Ga0187879_10177286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1199 | Open in IMG/M |
| 3300017955|Ga0187817_10177308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1357 | Open in IMG/M |
| 3300017988|Ga0181520_10564325 | Not Available | 795 | Open in IMG/M |
| 3300017996|Ga0187891_1185453 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018009|Ga0187884_10096272 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300018013|Ga0187873_1386284 | Not Available | 510 | Open in IMG/M |
| 3300018014|Ga0187860_1402602 | Not Available | 513 | Open in IMG/M |
| 3300018016|Ga0187880_1184774 | Not Available | 955 | Open in IMG/M |
| 3300018017|Ga0187872_10210225 | Not Available | 892 | Open in IMG/M |
| 3300018018|Ga0187886_1222439 | Not Available | 721 | Open in IMG/M |
| 3300018023|Ga0187889_10182240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
| 3300018024|Ga0187881_10142407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1051 | Open in IMG/M |
| 3300018038|Ga0187855_10146783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1408 | Open in IMG/M |
| 3300018040|Ga0187862_10901995 | Not Available | 505 | Open in IMG/M |
| 3300018042|Ga0187871_10299011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas citri group → Xanthomonas citri | 891 | Open in IMG/M |
| 3300019185|Ga0184587_100241 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300019186|Ga0184588_118141 | Not Available | 678 | Open in IMG/M |
| 3300019186|Ga0184588_124152 | Not Available | 529 | Open in IMG/M |
| 3300019187|Ga0184584_133844 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300019194|Ga0184586_135238 | Not Available | 614 | Open in IMG/M |
| 3300019888|Ga0193751_1009434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5207 | Open in IMG/M |
| 3300020579|Ga0210407_10385756 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300020579|Ga0210407_10570870 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300020580|Ga0210403_10062238 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300020580|Ga0210403_10453571 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300020580|Ga0210403_10526440 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300020580|Ga0210403_10596250 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300020580|Ga0210403_10786062 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300021168|Ga0210406_10520195 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300021168|Ga0210406_10575135 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300021178|Ga0210408_10032604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4115 | Open in IMG/M |
| 3300021402|Ga0210385_10359861 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300021403|Ga0210397_10844429 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300021404|Ga0210389_10790166 | Not Available | 742 | Open in IMG/M |
| 3300021478|Ga0210402_11263896 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300022557|Ga0212123_10117861 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300023536|Ga0247552_101314 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300024271|Ga0224564_1043918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 863 | Open in IMG/M |
| 3300025320|Ga0209171_10352347 | Not Available | 768 | Open in IMG/M |
| 3300025473|Ga0208190_1027923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1278 | Open in IMG/M |
| 3300025915|Ga0207693_10034200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4009 | Open in IMG/M |
| 3300027497|Ga0208199_1034539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1100 | Open in IMG/M |
| 3300027570|Ga0208043_1073802 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300027625|Ga0208044_1027929 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300027696|Ga0208696_1016805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2825 | Open in IMG/M |
| 3300027696|Ga0208696_1196754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 640 | Open in IMG/M |
| 3300027768|Ga0209772_10259258 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027783|Ga0209448_10069410 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300027824|Ga0209040_10491446 | Not Available | 547 | Open in IMG/M |
| 3300027842|Ga0209580_10000004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 708731 | Open in IMG/M |
| 3300027854|Ga0209517_10200185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1233 | Open in IMG/M |
| 3300027869|Ga0209579_10021119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3669 | Open in IMG/M |
| 3300027884|Ga0209275_10243382 | Not Available | 985 | Open in IMG/M |
| 3300027905|Ga0209415_10079022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3813 | Open in IMG/M |
| 3300027915|Ga0209069_10217015 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300029636|Ga0222749_10349785 | Not Available | 774 | Open in IMG/M |
| 3300030597|Ga0210286_1098055 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300030659|Ga0316363_10272113 | Not Available | 684 | Open in IMG/M |
| 3300031057|Ga0170834_102713422 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300031128|Ga0170823_15392478 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300031446|Ga0170820_15235261 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300032160|Ga0311301_10003038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 62791 | Open in IMG/M |
| 3300032160|Ga0311301_10066514 | All Organisms → cellular organisms → Bacteria | 7724 | Open in IMG/M |
| 3300032160|Ga0311301_10319413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2465 | Open in IMG/M |
| 3300032160|Ga0311301_10347986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2321 | Open in IMG/M |
| 3300032160|Ga0311301_10710018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1410 | Open in IMG/M |
| 3300032160|Ga0311301_11090724 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300032160|Ga0311301_11310456 | Not Available | 914 | Open in IMG/M |
| 3300032515|Ga0348332_11164556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1486 | Open in IMG/M |
| 3300032515|Ga0348332_12534564 | Not Available | 535 | Open in IMG/M |
| 3300032515|Ga0348332_12763401 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300032756|Ga0315742_12459696 | Not Available | 593 | Open in IMG/M |
| 3300032770|Ga0335085_10716254 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300032892|Ga0335081_10143815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3427 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 21.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.67% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.99% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.69% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.12% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.12% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002677 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300019185 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019186 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019187 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019194 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0004.00002760 | 2166559005 | Simulated | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLTALHP |
| FG2_08128750 | 2189573004 | Grass Soil | MTTNVLPDRVIRTVFFSLAAAIAVFVGMLLLTTLYL |
| INPhiseqgaiiFebDRAFT_1012092472 | 3300000364 | Soil | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLTALHP* |
| JGI12270J11330_100521192 | 3300000567 | Peatlands Soil | MHVNVLPDYVMRAVFFSLTGAIFVFVAMLLFTALHP* |
| Ga0005475J37263_1073832 | 3300002677 | Forest Soil | MTANVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHPYETRAVRSATDARIV* |
| Ga0062387_1006262802 | 3300004091 | Bog Forest Soil | MTINVLPDHVMRTVFFSLAAAIVVFVGMLLLTTLHSKETHAV* |
| Ga0062386_1017171573 | 3300004152 | Bog Forest Soil | TLLGETMTINVLPDHVMRTVFFSLAAAIVVSVGMLFLTALHP* |
| Ga0070731_100117904 | 3300005538 | Surface Soil | MTSNVLRENAMRAVFFLIAAVFFVFVGMLLLTTLHP* |
| Ga0070732_1000019042 | 3300005542 | Surface Soil | MTTNVLADHVMRTVFFSLAAAVVVFVGMLLLTTLHP* |
| Ga0066699_110202321 | 3300005561 | Soil | MTINVLPDRGMRTVLYCLAAVIVVFVGMLLLTIHS* |
| Ga0066705_104243902 | 3300005569 | Soil | MSINVLPDYMMRTGLFLLAVAIVVFAGMLLLTVL* |
| Ga0075023_1000448712 | 3300006041 | Watersheds | MTINVLPDHVMRTVFFSLTAAIVVSVGMLLLTALHP* |
| Ga0075023_1002914412 | 3300006041 | Watersheds | MTANVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHP* |
| Ga0075023_1003135181 | 3300006041 | Watersheds | MTINVLADHVARTVFFSLAAAIIVFVGMLLLTTLHP* |
| Ga0075024_1003954663 | 3300006047 | Watersheds | MTINVLHDHVVRTVFFSLAAAIIVFVGMLLLTTLHP* |
| Ga0075028_1002045752 | 3300006050 | Watersheds | MTTNVLPDRVIRTVFFSLPAAIAVFVGMLLLTTLYL* |
| Ga0075029_1001266872 | 3300006052 | Watersheds | MTINVLRDHMMRTVFFSLAAAIIVFIAMLLLTTV* |
| Ga0075029_1006787591 | 3300006052 | Watersheds | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLTTLHS* |
| Ga0075029_1011777582 | 3300006052 | Watersheds | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLTTLHP* |
| Ga0075026_1000476033 | 3300006057 | Watersheds | MTINVLPDHVVRTVFFSLAAAIIVFVGMLLLTTLHP* |
| Ga0075026_1001773021 | 3300006057 | Watersheds | MTINVLPDRGTRTVFYCLAAVIVVFVGMLLLTIHP* |
| Ga0075017_1005261781 | 3300006059 | Watersheds | MTSNILRDYVKRTVFFSLAAAIVVFFGMLLLTTLHP* |
| Ga0075017_1016623712 | 3300006059 | Watersheds | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLITLHP* |
| Ga0075019_103848311 | 3300006086 | Watersheds | NKEEIMTINVLRDHMMRTVFFSLAAAIIVFIAMLLLTTV* |
| Ga0075018_100348172 | 3300006172 | Watersheds | MTINVLPDHVARTVFFSLAAAIIVFVGMLLLTTLHP* |
| Ga0075014_1000833471 | 3300006174 | Watersheds | GTLLGETMTINVLPDHVMRTVFFSLAAAIVVSVGMLLLITLHP* |
| Ga0070712_1000451412 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTINVLPDRGMRTVFYCLTAVILVFVGMLLLTSHS* |
| Ga0070765_1007483662 | 3300006176 | Soil | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLSTALHP* |
| Ga0079222_100991604 | 3300006755 | Agricultural Soil | MTINVLPDRGMRTVLYCLAAVIVVFVGMLLLTIHP* |
| Ga0079222_103662702 | 3300006755 | Agricultural Soil | MTINVFPDRGMRTVLYCLAAVIVVFVGMLLLTIHS* |
| Ga0073928_100999215 | 3300006893 | Iron-Sulfur Acid Spring | VTTNVLTDRVMRTVFLSLAAAIAVFVGMLLLTTLHP* |
| Ga0073928_103223943 | 3300006893 | Iron-Sulfur Acid Spring | MTINVLPDHVMRTVFFSLAAAIVVSGGMLLLTTLHP* |
| Ga0075436_1012934763 | 3300006914 | Populus Rhizosphere | EIMTINVLPDRGMRTALYCLAAVIVVFVGMLLLTIHS* |
| Ga0102924_10209301 | 3300007982 | Iron-Sulfur Acid Spring | MHINVLPDHVMRTVFLSLTAAIFVLVGMLLVTTLHP* |
| Ga0116108_100543810 | 3300009519 | Peatland | MHVNVLPDYVMRAVFFALTGAIFVFVAMLLFTALHP* |
| Ga0116108_10235453 | 3300009519 | Peatland | MHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALFP* |
| Ga0116222_11624791 | 3300009521 | Peatlands Soil | MAISVLPSYVMRTVVLSLPGAIAVFVGMLLLTVLHP* |
| Ga0116218_10213412 | 3300009522 | Peatlands Soil | MTINVLPDYVMRTVFFSLAAAIVVFVGMFLLTTLHP* |
| Ga0116218_15600661 | 3300009522 | Peatlands Soil | MTTNVLRDHMMRTVFFSLVAAIVVFIAMLLLTTV* |
| Ga0116225_15671182 | 3300009524 | Peatlands Soil | FNNVLPDYVMRTVFLSLTGAIFVFVVMLLVTALHP* |
| Ga0116133_11193381 | 3300009623 | Peatland | MHFSNVLPDYVMRTVFFSLTGAIFVFVLILLLTALHP* |
| Ga0116114_10154442 | 3300009630 | Peatland | MHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP* |
| Ga0116224_103096941 | 3300009683 | Peatlands Soil | MNINVLPDHVMRTVFLSLTAAIFVLVGMLLVTTLHF* |
| Ga0116216_103054781 | 3300009698 | Peatlands Soil | INVLPDHVMRTVFFSLAAAIVVSVGMLLLTSLHP* |
| Ga0116216_109907041 | 3300009698 | Peatlands Soil | MTINVLPDHVMRTVFFSLAAAIVVSVGMLFLTALHP* |
| Ga0116217_100709912 | 3300009700 | Peatlands Soil | VTINDLPDYVMRAVFLSLAAAIVVFIGMLLLTIHS* |
| Ga0116217_101186763 | 3300009700 | Peatlands Soil | MHFSNVLPDYVMRTVFFSLTGAIFVFVLMSLLTALFP* |
| Ga0116217_109585072 | 3300009700 | Peatlands Soil | MHFNNVLPDYVMRTVFLSLTGAIFVFVVMLLVTALHP* |
| Ga0116219_101996971 | 3300009824 | Peatlands Soil | MNINVLPDHVMRTVFLSLTVATFVLVGMLLVTTLHFWETHAV* |
| Ga0116223_100497252 | 3300009839 | Peatlands Soil | MTIHVLPDYVLRTVFLSLAVAIVVFVGMLLLTILHP* |
| Ga0116223_102858301 | 3300009839 | Peatlands Soil | HFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP* |
| Ga0116223_103371932 | 3300009839 | Peatlands Soil | SNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALFP* |
| Ga0116223_103477043 | 3300009839 | Peatlands Soil | IMTINVLPDHVMRTVFLSLTVATFVIVGMLLVTTLHF* |
| Ga0074044_100373543 | 3300010343 | Bog Forest Soil | MHINVHPDHVMQTVLFSLTAAIFVFVGMLLLTTLHP* |
| Ga0074044_101545592 | 3300010343 | Bog Forest Soil | MTINVLPDHVMGTVFLSLTAAIFALAGMLLLTTLHP* |
| Ga0074044_103683832 | 3300010343 | Bog Forest Soil | MTSNVLRDYVMRTVFFSLAAAIVVFFGMLLLTTLHP* |
| Ga0136449_1009512891 | 3300010379 | Peatlands Soil | MTTDVLPDYVMRTVFFSLTTAIVAFVGMLLLTTLRP* |
| Ga0136449_1010133222 | 3300010379 | Peatlands Soil | MHVNVLPDYVMRTVFFSLTGAIFVFVVMLLLTALHP* |
| Ga0136449_1011161922 | 3300010379 | Peatlands Soil | MTINILPEHVTRTVFFSLTAAIVVFFGMLFLTTLHP* |
| Ga0136449_1011827532 | 3300010379 | Peatlands Soil | MTINVLPDYVMRTVFLSLAVAIVVFVGMLLLTTLHS* |
| Ga0136449_1017494612 | 3300010379 | Peatlands Soil | MTINVLPDHVMRTVFLSLTVATFVLVGMLLVTTLHP* |
| Ga0136449_1034343722 | 3300010379 | Peatlands Soil | YEEGIMHFNNVLPDYVMRTVFFSLTGAIFVFVGMLLLTPLHP* |
| Ga0134126_109965711 | 3300010396 | Terrestrial Soil | MTINVLPDRGMRRVLYCLAAVIVVFVGMLLLTIHP* |
| Ga0137776_16804961 | 3300010937 | Sediment | MTVNVIHANVMLTVFFSLAATIVVFDGMLLLTMAHP* |
| Ga0138573_12338602 | 3300011089 | Peatlands Soil | MHVNVLPDYVMRAVFFSLTGAFFVFVAMLLFTALHP* |
| Ga0150983_102560344 | 3300011120 | Forest Soil | TINVLSDHVVRTVFFSLAAAIIVFVGMLLLTTLHP* |
| Ga0150983_104777502 | 3300011120 | Forest Soil | MTTNVLPAYLMRTVFFSLAAAIVVFVGMLLLTTLHP* |
| Ga0150983_106061392 | 3300011120 | Forest Soil | VTVKDLPDYVMRAVFLSLAAAIVVVVGMLLLTAIHSS* |
| Ga0150983_139527862 | 3300011120 | Forest Soil | VTTNVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHP* |
| Ga0150983_142604362 | 3300011120 | Forest Soil | MTTNVLSDHVMRMVFLGLAVAIVVFVGMLVLTTLHP* |
| Ga0150983_150383901 | 3300011120 | Forest Soil | TINVLPDHVMRTVFFSLGAAIVVSGGMLLLTTLHP* |
| Ga0150983_156016171 | 3300011120 | Forest Soil | ETMTINVLPDHVVRTVFFSLAAAIIVFVGMLLLTTLHP* |
| Ga0150983_166100241 | 3300011120 | Forest Soil | MTINVLPDHVMRTVFFSLAAAIVVSGGILLLLTTLHP* |
| Ga0137380_100511945 | 3300012206 | Vadose Zone Soil | MTINVLPDRGMRTVFYCLAAVIVVFVGMLLLNDPSLETHAARTTHPA* |
| Ga0137376_100602366 | 3300012208 | Vadose Zone Soil | MTINVLPDRGMRTVLYCFAAVIVVFVGMLLLTIHP* |
| Ga0134027_10740482 | 3300012364 | Grasslands Soil | MTINVIPDYMTRTGFFLLAVAIVVFAGMLLLTVL* |
| Ga0164298_101459691 | 3300012955 | Soil | MTINVLPDHVMRTVFFSLAAAIVVYVGMLLLTALHP* |
| Ga0181518_101362741 | 3300014156 | Bog | MHFNNVLPDYVMRTVFFSLTGAIFVFVGMLLLMPLHP* |
| Ga0181521_100419602 | 3300014158 | Bog | MTTNVLPDYVMRTVFFSLATAIVVFVGMLLLTTLHP* |
| Ga0181530_100508014 | 3300014159 | Bog | MTTNVLPDYAIRTVFFSLAAAIVVFVGMLLLTTLHP* |
| Ga0181530_104281681 | 3300014159 | Bog | MTFNVLPDHVMRMVFLSLAAAIVLAFADMLLLTTLHR* |
| Ga0181538_106986932 | 3300014162 | Bog | EEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALFP* |
| Ga0181532_100410772 | 3300014164 | Bog | MTINVLPDHVMRTVFFTLTVAVVVSIAMLLVTTLHS* |
| Ga0181532_102465052 | 3300014164 | Bog | LYEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP* |
| Ga0181532_107373162 | 3300014164 | Bog | LYEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALFP* |
| Ga0181523_101031453 | 3300014165 | Bog | MMTINVLPDHVVMRTVFLSLAAAIVVFVGMLLLITLHP* |
| Ga0181523_107315482 | 3300014165 | Bog | RKKLYEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLILLLTALHP* |
| Ga0181531_106599732 | 3300014169 | Bog | MTIKALADRVTQTVFLSLAVAIVVFAGMLLFTILHP* |
| Ga0181536_101393523 | 3300014638 | Bog | EGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP* |
| Ga0181536_102548802 | 3300014638 | Bog | MHFSNVLPDYVMRTVFFSLTGAIFVFVGMLLLMPLHP* |
| Ga0132257_1028578921 | 3300015373 | Arabidopsis Rhizosphere | EEIMTINVLPDRGMRTALYCLAAAIVVFVGMLLLTIHS* |
| Ga0181505_102984683 | 3300016750 | Peatland | MHINVLSDHVMRTVFFSLTSAIFVFVGMLLLTTMLP |
| Ga0187818_100265294 | 3300017823 | Freshwater Sediment | MTINVLPDRGMRTVLYCLAAVIVVFVGMLLLTIHP |
| Ga0187820_12975561 | 3300017924 | Freshwater Sediment | MHFNNVLPDYVMRTVFFSLTGAIFVFVGMLLLTPLHP |
| Ga0187856_10137484 | 3300017925 | Peatland | MTTNVLPDYVMRTVFFSLATAIVVFVGMLLLTTLHP |
| Ga0187856_10259581 | 3300017925 | Peatland | MHVNVLPDYVMRAVFFSLTGAIFVFVAMLLFTALHP |
| Ga0187849_10532562 | 3300017929 | Peatland | MHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP |
| Ga0187877_10255384 | 3300017931 | Peatland | LYEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP |
| Ga0187814_100056709 | 3300017932 | Freshwater Sediment | MTINVLPDRGMRKVLYCLAAVIVVFVGMLLLTIHP |
| Ga0187801_102170251 | 3300017933 | Freshwater Sediment | MTINVLPSPGMRTVLYCLAAVIVVFVGMLLLTIHP |
| Ga0187803_100211532 | 3300017934 | Freshwater Sediment | MTINVLPDHVMGTVFLSLTAAIFALAGMLLLTTLHP |
| Ga0187848_101654012 | 3300017935 | Peatland | MHVNVLPDYVMRAVFFALTGAIFVFVAMLLFTALHP |
| Ga0187808_100431373 | 3300017942 | Freshwater Sediment | MHFNNVLPDYVMRTVFFSLTGAIFVFVVTLLLTALHP |
| Ga0187819_105553761 | 3300017943 | Freshwater Sediment | MTINVLPDHVMRTVFFTLTVAVVVSIAMLLVTTLHS |
| Ga0187879_101772861 | 3300017946 | Peatland | MHFTVLPDYVMRTVFLSLTGATFVFVAMLLLTALHP |
| Ga0187817_101773081 | 3300017955 | Freshwater Sediment | MHINVLPDYVMRAVFLSLTGAIFVFVVTLLLTALHP |
| Ga0181520_105643251 | 3300017988 | Bog | MTIKALADRVTQTVFLSLAVAIVVFAGMLLFTILHP |
| Ga0187891_11854531 | 3300017996 | Peatland | MTTNVLPDYVMRTVFFSLAAAIVVFVGMLLLTTLHL |
| Ga0187884_100962722 | 3300018009 | Peatland | MHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALFP |
| Ga0187873_13862842 | 3300018013 | Peatland | HFSNVLPDYVMRTVFFSLTGAIFVFVLILLLTALHP |
| Ga0187860_14026022 | 3300018014 | Peatland | YEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLILLLTALHP |
| Ga0187880_11847741 | 3300018016 | Peatland | MHVNVLPDYVMRAVFFSLTGVIFVFVTMLLFTALHP |
| Ga0187872_102102251 | 3300018017 | Peatland | GIMHFSNVLPDYVMRTVFFSLTGAIFVFVLILLLTALHP |
| Ga0187886_12224392 | 3300018018 | Peatland | MHFSNVLPDYVMRTVFFSLTGAIFVFVLILLLTALHP |
| Ga0187889_101822402 | 3300018023 | Peatland | YEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP |
| Ga0187881_101424071 | 3300018024 | Peatland | KLYEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALHP |
| Ga0187855_101467831 | 3300018038 | Peatland | TINVLPDHVVMRTVFLSLAAAIVVFVGMLLLITLHP |
| Ga0187862_109019951 | 3300018040 | Peatland | FSNVLPDYVMRTVFFSLTGAIFVFVLMLLLTALFP |
| Ga0187871_102990112 | 3300018042 | Peatland | MMTINVLPDHVVMRTVFLSLAAAIVVFVGMLLLITLHP |
| Ga0184587_1002412 | 3300019185 | Soil | MTINVLSDHVVRTVFFSLAAAIIVFVGMLLLTTLHP |
| Ga0184588_1181412 | 3300019186 | Soil | MTINVLPDHVMRTVFLSLAAAIIVFVGMLLLITFHP |
| Ga0184588_1241522 | 3300019186 | Soil | AVSIGAIMTTNVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHP |
| Ga0184584_1338441 | 3300019187 | Soil | MTTNVLPDRVIRTVFFSLPAAIAVFVGMLLLTTLYL |
| Ga0184586_1352383 | 3300019194 | Soil | LLGETMTINVLPDHVMRTVFFSLAAAIVVSGGMLLLTTLHP |
| Ga0193751_100943410 | 3300019888 | Soil | MTINVLPDRGMRTVFYCLAAVIVVFLGMLLLTIHP |
| Ga0210407_103857562 | 3300020579 | Soil | MTINVLPDHVVRTVFFSLAAAIIVFVGMLLLTTLHP |
| Ga0210407_105708702 | 3300020579 | Soil | MHINVLPDHVMRTVFLSLTAAIFVFVGMLLVTPLHP |
| Ga0210403_100622382 | 3300020580 | Soil | MTINVLPDHVVRTVFFSLAAASIVFVGMLLLTTLHP |
| Ga0210403_104535712 | 3300020580 | Soil | MTTNALSDRVIRTVFFSLPAAIAVFVGMLLLTTLYL |
| Ga0210403_105264402 | 3300020580 | Soil | MTTNVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHP |
| Ga0210403_105962502 | 3300020580 | Soil | GETMTINVLPDHVMRTVFFSLAAAIVVSVGMLLLTALHP |
| Ga0210403_107860622 | 3300020580 | Soil | MTANVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHPYETRAVRSATDARIV |
| Ga0210406_105201953 | 3300021168 | Soil | MHINVLPDHVMRTVFLSLTAAIFVLVGMLLVTTLHP |
| Ga0210406_105751352 | 3300021168 | Soil | MHINVLPDHVMRTVFLSLTAAIFVFVGMLLVTTLHP |
| Ga0210408_100326049 | 3300021178 | Soil | MTANVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHP |
| Ga0210385_103598612 | 3300021402 | Soil | MATNVLRDNVMRAVFFSIAAAFVVFVGMLLLTTLHP |
| Ga0210397_108444291 | 3300021403 | Soil | MTANVLHDRVMRTVYFSLLAAIAVFVGMLLLTSLHPWETRAVRSATDARIV |
| Ga0210389_107901661 | 3300021404 | Soil | MTINVLPDHVMRTVFFSLTAAIVVSVGMLLLTALHP |
| Ga0210402_112638962 | 3300021478 | Soil | MTANVRHDRVMRTVYFSLLAAIAVFVGMLLLTTLHP |
| Ga0212123_101178611 | 3300022557 | Iron-Sulfur Acid Spring | MAINVLRDHVMRVVFFSLAAAIVVFVGMLLLTIHNP |
| Ga0247552_1013141 | 3300023536 | Soil | MTTNVLLDRVIRTVFFSLPAAIAVFVGMLLLTTLYL |
| Ga0224564_10439182 | 3300024271 | Soil | VTINVRPDHVVRTVFFSLAAAIIVFVGMLLLTTLHP |
| Ga0209171_103523471 | 3300025320 | Iron-Sulfur Acid Spring | GTLLGDDVTINDLPNYVMRAVFLSLAAAIVVFVGMLLLTIHP |
| Ga0208190_10279231 | 3300025473 | Peatland | KLYEEGIMHFSNVLPDYVMRTVFFSLTGAIFVFVLILLLTALHP |
| Ga0207693_100342006 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTINVLPDRGMRTVFYCLTAVILVFVGMLLLTSHS |
| Ga0208199_10345393 | 3300027497 | Peatlands Soil | VTINDLPDYVMRAVFLSLAAAIVVFIGMLLLTIHS |
| Ga0208043_10738021 | 3300027570 | Peatlands Soil | MAISVLPSYVMRTVVLSLPGAIAVFVGMLLLTVLHP |
| Ga0208044_10279293 | 3300027625 | Peatlands Soil | MTINVLPDYVMRTVFFSLAAAIVVFVGMFLLTTLHP |
| Ga0208696_10168052 | 3300027696 | Peatlands Soil | MHFSNVLPDYVMRTVFFSLTGAIFVFVAMLLFTALHP |
| Ga0208696_11967541 | 3300027696 | Peatlands Soil | MRFNNVLPDYVMRTVFFSLTGAIFVFVGMLLLTPLHP |
| Ga0209772_102592582 | 3300027768 | Bog Forest Soil | MTSNVLRDYVMRTVFFSLAAAIVVFFGMLLLTTLHP |
| Ga0209448_100694102 | 3300027783 | Bog Forest Soil | MTINVLPDHVMRTVLFSLAAAIVVSVGMLLLTTLHL |
| Ga0209040_104914462 | 3300027824 | Bog Forest Soil | MHFNNVLPDYVMRTVFLSLTGAIFVFVVMLLLTALHP |
| Ga0209580_10000004659 | 3300027842 | Surface Soil | MTTNVLADHVMRTVFFSLAAAVVVFVGMLLLTTLHP |
| Ga0209517_102001852 | 3300027854 | Peatlands Soil | MTINILPEHVTRTVFFSLTAAIVVFFGMLFLTTLHP |
| Ga0209579_100211194 | 3300027869 | Surface Soil | MTSNVLRENAMRAVFFLIAAVFFVFVGMLLLTTLHP |
| Ga0209275_102433821 | 3300027884 | Soil | MTINVLADHVMRTVFFSLAAAIVVSVGMLLLTCLHP |
| Ga0209415_100790223 | 3300027905 | Peatlands Soil | MTINVLPDHVMRTVFFTLTVAVVLSIAMLLVTTLHS |
| Ga0209069_102170153 | 3300027915 | Watersheds | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLITLHP |
| Ga0222749_103497851 | 3300029636 | Soil | MTINVLPDHVMRTVFFSLAAAIVVSVGMLLLNALHP |
| Ga0210286_10980552 | 3300030597 | Soil | MFFMIVLHDRVMRTVYFSLLAAIAVFVGMLLLTTLHP |
| Ga0316363_102721132 | 3300030659 | Peatlands Soil | MTTDVLPDYVMRTVFFSLTTAIVAFVGMLLLTTLRP |
| Ga0170834_1027134223 | 3300031057 | Forest Soil | MTTNVFPDRVIRTVFFSRPAAIAVFVGMLLLTTLYH |
| Ga0170823_153924783 | 3300031128 | Forest Soil | MTTNVLPDRVIRTVFFSRPAAIAVFVGMLLLTTLYL |
| Ga0170820_152352613 | 3300031446 | Forest Soil | MTINVLHDHVVRTVFFSLAAAIIVFVGMLLLTTLHP |
| Ga0311301_1000303854 | 3300032160 | Peatlands Soil | MTIHVLPDYVLRTVFLSLAVAIVVFVGMLLLTILHP |
| Ga0311301_1006651410 | 3300032160 | Peatlands Soil | MTINVLPDYVMRTVFLSLAVAIVVFVGMLLLTTLHS |
| Ga0311301_103194132 | 3300032160 | Peatlands Soil | MHVNVLPDYVMRTVFFSLTGAIFVFVVMLLLTALHP |
| Ga0311301_103479862 | 3300032160 | Peatlands Soil | MEKIMHINVLPDHVMRTVFLSLTVATFVLVGMLLVTTLHFWETHAV |
| Ga0311301_107100182 | 3300032160 | Peatlands Soil | MTINVLPDYVMRTVFLSLAVAIVVFVGMLLLTVLHP |
| Ga0311301_110907241 | 3300032160 | Peatlands Soil | MNINVLPDHVMRTVFLSLTAAIFVLVGMLLVTTLHF |
| Ga0311301_113104562 | 3300032160 | Peatlands Soil | EEIVHFNNVLPDYVMRTVFLSLTGAIFVFVVMLLVTALHP |
| Ga0348332_111645563 | 3300032515 | Plant Litter | VTINVLPDHVVRTVFFSLAAAIIVFVGMLLLTTLHP |
| Ga0348332_125345641 | 3300032515 | Plant Litter | MHINVLPDHVMRTVFLSLTAAIFVFVGMLLMTTMHP |
| Ga0348332_127634012 | 3300032515 | Plant Litter | MTSNVLADHVMRTVFFSLAAAVVVFVGMLLLTTLHP |
| Ga0315742_124596961 | 3300032756 | Forest Soil | MTINVLPDHVMRTVFFSLAAAIVVSGGMLLLLTTLHP |
| Ga0335085_107162541 | 3300032770 | Soil | MTIDVLRVHVMRTVLFSLAATLVVFVGMLLLTILHP |
| Ga0335081_101438156 | 3300032892 | Soil | MTIDVLRDHVMRTVLFSLAATLVVFVGMLLLTILHP |
| ⦗Top⦘ |