NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033197

Metagenome / Metatranscriptome Family F033197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033197
Family Type Metagenome / Metatranscriptome
Number of Sequences 178
Average Sequence Length 38 residues
Representative Sequence MNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW
Number of Associated Samples 111
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 84.83 %
% of genes near scaffold ends (potentially truncated) 19.66 %
% of genes from short scaffolds (< 2000 bps) 83.15 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (62.360 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(14.045 % of family members)
Environment Ontology (ENVO) Unclassified
(25.281 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.067 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.03%    β-sheet: 0.00%    Coil/Unstructured: 46.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF08734GYD 3.37
PF00571CBS 2.81
PF00501AMP-binding 1.69
PF03466LysR_substrate 1.69
PF00126HTH_1 1.12
PF16861Carbam_trans_C 1.12
PF07045DUF1330 1.12
PF00583Acetyltransf_1 1.12
PF00550PP-binding 1.12
PF13230GATase_4 0.56
PF03734YkuD 0.56
PF02518HATPase_c 0.56
PF09339HTH_IclR 0.56
PF031712OG-FeII_Oxy 0.56
PF01977UbiD 0.56
PF01207Dus 0.56
PF00291PALP 0.56
PF00884Sulfatase 0.56
PF01068DNA_ligase_A_M 0.56
PF00171Aldedh 0.56
PF01814Hemerythrin 0.56
PF01844HNH 0.56
PF01928CYTH 0.56
PF00490ALAD 0.56
PF13454NAD_binding_9 0.56
PF01032FecCD 0.56
PF01381HTH_3 0.56
PF01161PBP 0.56
PF02682CT_C_D 0.56
PF12146Hydrolase_4 0.56
PF00486Trans_reg_C 0.56
PF08379Bact_transglu_N 0.56
PF02652Lactate_perm 0.56
PF14403CP_ATPgrasp_2 0.56
PF12071DUF3551 0.56
PF16177ACAS_N 0.56
PF04392ABC_sub_bind 0.56
PF03401TctC 0.56
PF01925TauE 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 3.37
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 1.12
COG1620L-lactate permeaseEnergy production and conversion [C] 0.56
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.56
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.56
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.56
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.56
COG20495-oxoprolinase subunit B/Allophanate hydrolase subunit 1Amino acid transport and metabolism [E] 0.56
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 0.56
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.56
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.56
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.56
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.56
COG1305Transglutaminase-like enzyme, putative cysteine proteasePosttranslational modification, protein turnover, chaperones [O] 0.56
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.56
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.56
COG0113Delta-aminolevulinic acid dehydratase, porphobilinogen synthaseCoenzyme transport and metabolism [H] 0.56
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.56
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A62.36 %
All OrganismsrootAll Organisms37.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B01DD52UNot Available507Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1002165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3151Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1005969Not Available1979Open in IMG/M
3300005332|Ga0066388_100671848All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300005434|Ga0070709_11187576Not Available613Open in IMG/M
3300005533|Ga0070734_10000376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria100573Open in IMG/M
3300005560|Ga0066670_10287562Not Available999Open in IMG/M
3300005764|Ga0066903_100479786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2095Open in IMG/M
3300005764|Ga0066903_101137483Not Available1443Open in IMG/M
3300005764|Ga0066903_101191579Not Available1413Open in IMG/M
3300005764|Ga0066903_101319715All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300005764|Ga0066903_101715924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1196Open in IMG/M
3300005764|Ga0066903_106285229All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300006028|Ga0070717_10276358Not Available1489Open in IMG/M
3300006028|Ga0070717_11145992Not Available708Open in IMG/M
3300006028|Ga0070717_11929168Not Available533Open in IMG/M
3300006041|Ga0075023_100121250Not Available930Open in IMG/M
3300006047|Ga0075024_100440274All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300006052|Ga0075029_100082706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1903Open in IMG/M
3300006057|Ga0075026_100435781Not Available743Open in IMG/M
3300006057|Ga0075026_100657594Not Available622Open in IMG/M
3300006059|Ga0075017_100974258Not Available660Open in IMG/M
3300006059|Ga0075017_101131241Not Available612Open in IMG/M
3300006086|Ga0075019_10760594Not Available616Open in IMG/M
3300006102|Ga0075015_100271599Not Available924Open in IMG/M
3300006102|Ga0075015_100794739Not Available568Open in IMG/M
3300006102|Ga0075015_101041318Not Available502Open in IMG/M
3300006172|Ga0075018_10494130Not Available637Open in IMG/M
3300006174|Ga0075014_100053469Not Available1743Open in IMG/M
3300006175|Ga0070712_100093477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2207Open in IMG/M
3300006175|Ga0070712_100524963All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli995Open in IMG/M
3300006175|Ga0070712_101502670Not Available588Open in IMG/M
3300006800|Ga0066660_11608223Not Available515Open in IMG/M
3300006804|Ga0079221_10028095All Organisms → cellular organisms → Bacteria → Proteobacteria2357Open in IMG/M
3300006893|Ga0073928_10074302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2935Open in IMG/M
3300009038|Ga0099829_11485249Not Available560Open in IMG/M
3300009137|Ga0066709_103884797Not Available543Open in IMG/M
3300009792|Ga0126374_10039322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2303Open in IMG/M
3300009792|Ga0126374_10080259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1781Open in IMG/M
3300009792|Ga0126374_10273432All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300009792|Ga0126374_10815204Not Available715Open in IMG/M
3300010047|Ga0126382_10400357Not Available1071Open in IMG/M
3300010048|Ga0126373_10341037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1507Open in IMG/M
3300010048|Ga0126373_11578577Not Available721Open in IMG/M
3300010359|Ga0126376_10324017Not Available1352Open in IMG/M
3300010360|Ga0126372_10647496Not Available1022Open in IMG/M
3300010361|Ga0126378_10541276Not Available1279Open in IMG/M
3300010361|Ga0126378_13326671Not Available511Open in IMG/M
3300010366|Ga0126379_10782223Not Available1053Open in IMG/M
3300010376|Ga0126381_100977241All Organisms → cellular organisms → Bacteria → Proteobacteria1221Open in IMG/M
3300010376|Ga0126381_101362820All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300012198|Ga0137364_10182151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1533Open in IMG/M
3300012198|Ga0137364_11162313Not Available579Open in IMG/M
3300012198|Ga0137364_11169240Not Available577Open in IMG/M
3300012207|Ga0137381_10261058Not Available1506Open in IMG/M
3300012208|Ga0137376_10734248Not Available851Open in IMG/M
3300012209|Ga0137379_10226767Not Available1782Open in IMG/M
3300012209|Ga0137379_10958185Not Available760Open in IMG/M
3300012209|Ga0137379_11143266Not Available685Open in IMG/M
3300012285|Ga0137370_10388064Not Available844Open in IMG/M
3300012359|Ga0137385_10587947All Organisms → cellular organisms → Bacteria → Proteobacteria937Open in IMG/M
3300012971|Ga0126369_13230846Not Available534Open in IMG/M
3300016319|Ga0182033_11370152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300016341|Ga0182035_10050273Not Available2824Open in IMG/M
3300016341|Ga0182035_11993943Not Available527Open in IMG/M
3300016341|Ga0182035_12157715Not Available505Open in IMG/M
3300016357|Ga0182032_10087353Not Available2161Open in IMG/M
3300016422|Ga0182039_10841696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium816Open in IMG/M
3300017822|Ga0187802_10010967All Organisms → cellular organisms → Bacteria2927Open in IMG/M
3300017822|Ga0187802_10026145Not Available2044Open in IMG/M
3300017822|Ga0187802_10028424All Organisms → cellular organisms → Bacteria → Proteobacteria1970Open in IMG/M
3300017822|Ga0187802_10089107Not Available1155Open in IMG/M
3300017823|Ga0187818_10537642Not Available526Open in IMG/M
3300017924|Ga0187820_1034491Not Available1324Open in IMG/M
3300017924|Ga0187820_1280130Not Available543Open in IMG/M
3300017943|Ga0187819_10103012All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_81705Open in IMG/M
3300017955|Ga0187817_10230194Not Available1181Open in IMG/M
3300017955|Ga0187817_10775767All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300017959|Ga0187779_10757157Not Available660Open in IMG/M
3300017961|Ga0187778_10180854Not Available1339Open in IMG/M
3300017970|Ga0187783_10041428Not Available3411Open in IMG/M
3300017970|Ga0187783_10142048Not Available1769Open in IMG/M
3300017972|Ga0187781_10672549Not Available748Open in IMG/M
3300017973|Ga0187780_10535201All Organisms → cellular organisms → Bacteria → Proteobacteria838Open in IMG/M
3300017974|Ga0187777_10114033Not Available1784Open in IMG/M
3300017994|Ga0187822_10358430Not Available528Open in IMG/M
3300018001|Ga0187815_10111353All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300018001|Ga0187815_10512268Not Available514Open in IMG/M
3300018007|Ga0187805_10573820Not Available532Open in IMG/M
3300018062|Ga0187784_10000784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales24250Open in IMG/M
3300018062|Ga0187784_11154622Not Available615Open in IMG/M
3300018433|Ga0066667_12195193Not Available514Open in IMG/M
3300019888|Ga0193751_1002067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria12389Open in IMG/M
3300019888|Ga0193751_1009719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae5117Open in IMG/M
3300019888|Ga0193751_1010359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4931Open in IMG/M
3300020010|Ga0193749_1007705Not Available2088Open in IMG/M
3300020581|Ga0210399_10146792All Organisms → cellular organisms → Bacteria1950Open in IMG/M
3300021168|Ga0210406_11297118Not Available525Open in IMG/M
3300021433|Ga0210391_11026627Not Available642Open in IMG/M
3300021560|Ga0126371_10078183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3239Open in IMG/M
3300021560|Ga0126371_10117987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2672Open in IMG/M
3300021560|Ga0126371_10291446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium1756Open in IMG/M
3300021560|Ga0126371_10331428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1654Open in IMG/M
3300021560|Ga0126371_10997214Not Available979Open in IMG/M
3300022557|Ga0212123_10062885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3268Open in IMG/M
3300025915|Ga0207693_10442988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1015Open in IMG/M
3300025939|Ga0207665_11302677Not Available579Open in IMG/M
3300026330|Ga0209473_1244354Not Available625Open in IMG/M
3300026552|Ga0209577_10295255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1210Open in IMG/M
3300026552|Ga0209577_10369719Not Available1047Open in IMG/M
3300026896|Ga0207730_1012668Not Available721Open in IMG/M
3300026979|Ga0207817_1016906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris796Open in IMG/M
3300026997|Ga0207784_1030795Not Available550Open in IMG/M
3300027042|Ga0207766_1030647All Organisms → cellular organisms → Bacteria → Proteobacteria604Open in IMG/M
3300027050|Ga0209325_1005993All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300027680|Ga0207826_1155550Not Available623Open in IMG/M
3300027824|Ga0209040_10464489Not Available572Open in IMG/M
3300027826|Ga0209060_10000061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales294831Open in IMG/M
3300027842|Ga0209580_10657910Not Available518Open in IMG/M
3300027874|Ga0209465_10231481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria923Open in IMG/M
3300027898|Ga0209067_10119762Not Available1381Open in IMG/M
3300027898|Ga0209067_10828834Not Available541Open in IMG/M
3300027898|Ga0209067_10914892Not Available516Open in IMG/M
3300027910|Ga0209583_10193977All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300027910|Ga0209583_10403937Not Available651Open in IMG/M
3300030844|Ga0075377_11686015Not Available506Open in IMG/M
3300031057|Ga0170834_109479439Not Available520Open in IMG/M
3300031057|Ga0170834_113905066Not Available812Open in IMG/M
3300031128|Ga0170823_12007422All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300031128|Ga0170823_12975906Not Available510Open in IMG/M
3300031128|Ga0170823_16098464All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300031128|Ga0170823_16483875Not Available607Open in IMG/M
3300031231|Ga0170824_104144544All Organisms → cellular organisms → Bacteria3574Open in IMG/M
3300031231|Ga0170824_108239543Not Available559Open in IMG/M
3300031231|Ga0170824_118199175Not Available521Open in IMG/M
3300031231|Ga0170824_127945427Not Available792Open in IMG/M
3300031474|Ga0170818_102047501Not Available702Open in IMG/M
3300031474|Ga0170818_104548795Not Available546Open in IMG/M
3300031545|Ga0318541_10063198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1926Open in IMG/M
3300031545|Ga0318541_10208085Not Available1083Open in IMG/M
3300031545|Ga0318541_10849116Not Available509Open in IMG/M
3300031573|Ga0310915_10499329Not Available864Open in IMG/M
3300031679|Ga0318561_10486656Not Available679Open in IMG/M
3300031682|Ga0318560_10510719Not Available651Open in IMG/M
3300031708|Ga0310686_119156766All Organisms → cellular organisms → Bacteria → Proteobacteria2722Open in IMG/M
3300031719|Ga0306917_10439770Not Available1021Open in IMG/M
3300031719|Ga0306917_11417326Not Available536Open in IMG/M
3300031748|Ga0318492_10254484Not Available908Open in IMG/M
3300031768|Ga0318509_10125602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1402Open in IMG/M
3300031771|Ga0318546_10227153All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300031879|Ga0306919_10185236Not Available1539Open in IMG/M
3300031879|Ga0306919_10319634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1181Open in IMG/M
3300031890|Ga0306925_10122349All Organisms → cellular organisms → Bacteria → Proteobacteria2785Open in IMG/M
3300031890|Ga0306925_10418596Not Available1434Open in IMG/M
3300031890|Ga0306925_10522241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1262Open in IMG/M
3300031897|Ga0318520_11073878All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031910|Ga0306923_10093139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3392Open in IMG/M
3300031910|Ga0306923_11320901Not Available764Open in IMG/M
3300031912|Ga0306921_10033816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68605725Open in IMG/M
3300031912|Ga0306921_10241397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL282117Open in IMG/M
3300031941|Ga0310912_10114659All Organisms → cellular organisms → Bacteria2002Open in IMG/M
3300031941|Ga0310912_10295323Not Available1253Open in IMG/M
3300031941|Ga0310912_10757108Not Available751Open in IMG/M
3300031945|Ga0310913_10058905Not Available2525Open in IMG/M
3300031946|Ga0310910_10078459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp.2400Open in IMG/M
3300031947|Ga0310909_10833239Not Available760Open in IMG/M
3300032035|Ga0310911_10847948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales528Open in IMG/M
3300032059|Ga0318533_10216329Not Available1376Open in IMG/M
3300032076|Ga0306924_11561678Not Available697Open in IMG/M
3300032180|Ga0307471_100287161Not Available1724Open in IMG/M
3300032180|Ga0307471_100472463All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300032180|Ga0307471_100826124Not Available1094Open in IMG/M
3300032180|Ga0307471_101632970All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300032261|Ga0306920_103664950All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300032261|Ga0306920_104252985Not Available515Open in IMG/M
3300033289|Ga0310914_11277640Not Available636Open in IMG/M
3300033290|Ga0318519_10445803Not Available775Open in IMG/M
3300033290|Ga0318519_10647900Not Available644Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.04%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.24%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds10.11%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil7.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.18%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.06%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.06%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.69%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.12%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.12%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.56%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026896Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes)EnvironmentalOpen in IMG/M
3300026979Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes)EnvironmentalOpen in IMG/M
3300026997Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes)EnvironmentalOpen in IMG/M
3300027042Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300030844Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_019637402170459023Grass SoilMNTQIFNKGGLAGNFWLQIAALVIVTLVVIALASKYVW
AF_2010_repII_A01DRAFT_100216523300000580Forest SoilMNTQTSNKAGFANNFWVQMTALLVVTVGIIALAAKYIW*
AF_2010_repII_A01DRAFT_100596923300000580Forest SoilMPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW*
Ga0066388_10067184833300005332Tropical Forest SoilMIREGGDQMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW*
Ga0070709_1118757623300005434Corn, Switchgrass And Miscanthus RhizosphereLYSTGYQPKEVIQYETQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW*
Ga0070734_10000376123300005533Surface SoilMTTQAANKNSLANNLWVQMAALIVVTVVIIALAAKYIW*
Ga0066670_1028756223300005560SoilMDTQLANKGDITNNFWLQMAALVIVTVAMIALAAKYVW*
Ga0066903_10047978633300005764Tropical Forest SoilMDTRISPKTGFANNAWVQIAALLVLTIVVIALAAKYIW*
Ga0066903_10113748323300005764Tropical Forest SoilMATQITSKHGFTDNFWLQMAALVIVTLVMIALAAEYVW*
Ga0066903_10119157933300005764Tropical Forest SoilMDTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW*
Ga0066903_10131971523300005764Tropical Forest SoilMNTQTSNKAGFANNFWVQMAALVVVTVVIIALAAKYIW*
Ga0066903_10171592413300005764Tropical Forest SoilMNTQITSKRSFANNFWLQAAALVVMTLVVIALAANYVW*
Ga0066903_10628522913300005764Tropical Forest SoilMNTQTSNKTGFANNFWVQMTALVVVTVLIIALAAKYIW*
Ga0070717_1027635823300006028Corn, Switchgrass And Miscanthus RhizosphereMNTQIRNTGGFTNNFWVQMAALVIVSLAVIAVAAKYIW*
Ga0070717_1114599233300006028Corn, Switchgrass And Miscanthus RhizosphereMDTQIAPKSGFANNVWVQMAALVIVTIVVIALAAKYIW*
Ga0070717_1192916813300006028Corn, Switchgrass And Miscanthus RhizosphereMNTQIRSTGGLANNFWVQMAALIVVVAVLIALAAKYLW*
Ga0075023_10012125023300006041WatershedsMNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW*
Ga0075024_10044027413300006047WatershedsMNTQIRNTDGFTNSFWVQIAALVIVTLAVIALAAKYIW*
Ga0075029_10008270623300006052WatershedsMDTQITPKGGVANNVWVQMAALVIVTIVVIALAAKYIW*
Ga0075026_10043578133300006057WatershedsLLDRCVPSGHRLKGGNRAMNTQIRNKGGFTNNFWVQMAALVIVTLAVIALAAKYIW*
Ga0075026_10065759413300006057WatershedsMDTQTTPKSGFARNFWVQMAALVIVTIVVIALAAKYIW*
Ga0075017_10097425823300006059WatershedsMDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYIW*
Ga0075017_10113124113300006059WatershedsMDTQITRKSGFANKFWVQMAALVIVTIVVIALAAKYIW*
Ga0075019_1076059423300006086WatershedsLTMNTQITTKQGFTNNFWVQMAAMVILTVVVIALAAKYIW*
Ga0075015_10027159913300006102WatershedsMDTQIPRKSGFANNFWVQMAALVVVTIAVIALAAKYIW*
Ga0075015_10079473913300006102WatershedsMDTQIAPKSGFANNVWVQMAAMVILTVVVIALAAKYIW
Ga0075015_10104131813300006102WatershedsQIPPQKRGFANNVWVQMAALVIVTIVVIALAAKYIW*
Ga0075018_1049413013300006172WatershedsMNTQIFNKGGLAGNFWLQIAALVIVTLVVIALASKYVW*
Ga0075014_10005346953300006174WatershedsMNTQIFNKGGFADNFWVQMAALVIVTLVVIALAAKYVW*
Ga0070712_10009347753300006175Corn, Switchgrass And Miscanthus RhizosphereMNTQTSNKAGFTNNFWVQMAALVIVTVVIIALAAKYIW*
Ga0070712_10052496323300006175Corn, Switchgrass And Miscanthus RhizosphereMDNTQITRKSGFANNFWVQMAALVIVTIVVIAIAAKYVW*
Ga0070712_10150267013300006175Corn, Switchgrass And Miscanthus RhizosphereMNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW*
Ga0066660_1160822323300006800SoilMNTQIFNKGGFANNLWVQMATLVIVTLVVVALAAMYVW*
Ga0079221_1002809523300006804Agricultural SoilMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW*
Ga0073928_1007430243300006893Iron-Sulfur Acid SpringMNTQIRNIGSFANNFWVQMAALVVVVAIVIAFAAKYLW*
Ga0099829_1148524913300009038Vadose Zone SoilMDTRADSRRGFVNNLWVQMAALVIVVLVLLALAAKYIW*
Ga0066709_10388479713300009137Grasslands SoilMNTQTFNKGGFANNFWVQMAALVIVTLVVIAFAAKYVW*
Ga0126374_1003932223300009792Tropical Forest SoilMNTQIGNTSGFANNIWVQMAALVIVVGGLIALAAKYIW*
Ga0126374_1008025933300009792Tropical Forest SoilMDSQITSKSGLANDFWLQMAALAILTIVVIALAAKYVW*
Ga0126374_1027343213300009792Tropical Forest SoilMNTQISNKAGFANNFWVQVTALIVVTVVIIALAAKYIW*
Ga0126374_1081520423300009792Tropical Forest SoilMATQITSKHGFTDNLWLQMVALVIVTLVVIALAAEYVW*
Ga0126382_1040035723300010047Tropical Forest SoilMATQITSKHGFTDNLWLQMAALVIVTLVVITLAAEYVW*
Ga0126373_1034103733300010048Tropical Forest SoilMATQIASKHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126373_1157857713300010048Tropical Forest SoilMATQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126376_1032401723300010359Tropical Forest SoilMDSQITSKSGLANDFWLQMAALTILTIVVIALAAKYVW*
Ga0126372_1064749623300010360Tropical Forest SoilMATQITSNHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126378_1054127623300010361Tropical Forest SoilMATQITSKHGFADNFWLQMAALVIVTLIVIALAAEYVW*
Ga0126378_1332667113300010361Tropical Forest SoilMNTQITGKRSFANNFWLQAAALVVVTLVVIALAANYV
Ga0126379_1078222313300010366Tropical Forest SoilMNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW*
Ga0126381_10097724113300010376Tropical Forest SoilMDTQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126381_10136282013300010376Tropical Forest SoilMPTQINKGGFTNNVWVQMAALGVITVIIIALAAKYIW*
Ga0137364_1018215113300012198Vadose Zone SoilSMNTQIFKKGGLANNFWVQMAALVIVTLVVIALAANYIW*
Ga0137364_1116231323300012198Vadose Zone SoilVIQYESQTFNKGGFANNFWVQMAALVIVTLVVIAFAAKYVW*
Ga0137364_1116924013300012198Vadose Zone SoilMDAWADRKSGFANNFWVPIAALVIVVVVIIALAAKYIW*
Ga0137381_1026105813300012207Vadose Zone SoilMNTQIRNTDGFANNFWVQMAALVVVVAVVIVLAAKYVW*
Ga0137376_1073424823300012208Vadose Zone SoilMNTQIFNKGGFANNLWVQMAALVIVTLVVIALAAKYVW*
Ga0137379_1022676733300012209Vadose Zone SoilMNTQIRNTGGFANNFWVQMAALVVVVAVVIVLAAKYVW*
Ga0137379_1095818513300012209Vadose Zone SoilMNTQIFKKGGFANNFWVQMAALVIVTLVVIALAAKYVW*
Ga0137379_1114326623300012209Vadose Zone SoilMDTKADSRSGFVNKLWVQMAALVIVVLVLIALATKYIW*
Ga0137370_1038806423300012285Vadose Zone SoilMNTQIRNIGGLANNFWVQMAALVIVTLVVIALAANYIW*
Ga0137385_1058794743300012359Vadose Zone SoilMDTRADSRSGFVNKLWVQMAALVIVVLVLIALAAKYIW*
Ga0126369_1323084613300012971Tropical Forest SoilMNTQITSKRSFANNFWLQAAAMVVVTLVVIALAANYVW*
Ga0182033_1137015213300016319SoilGDPLMDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0182035_1005027343300016341SoilEIRMDTQITHKSGLANNLWVQMAALVIVKNVVIALAAEFIW
Ga0182035_1199394313300016341SoilVDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0182035_1215771523300016341SoilMATPITSKHGFADNFWLQMAALVIVTLVVIALAAEYVW
Ga0182032_1008735323300016357SoilMDTQISPKTGFTNNAWVQITALVVLTIIVIALAAKYIW
Ga0182039_1084169613300016422SoilLMDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0187802_1001096733300017822Freshwater SedimentMDTQITGKSGFANNVWVQMAALVIVTIAVIALAAKYIW
Ga0187802_1002614533300017822Freshwater SedimentMDTPTRQRSGLANNFWLQMAALVIVVAIIIALAAKYIW
Ga0187802_1002842423300017822Freshwater SedimentMNTQIRNTGGFINNFWVQMAALVVVTLAVIALAAKYIW
Ga0187802_1008910713300017822Freshwater SedimentMDTQITPKSGFANNFWVQMAAMVIVTIVVIALAAKYIW
Ga0187818_1053764223300017823Freshwater SedimentMDTPTRQKSGLANNFWLQMAALVIVVAIIIALAAKYIW
Ga0187820_103449113300017924Freshwater SedimentMDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYIW
Ga0187820_128013013300017924Freshwater SedimentMDTQITPKSGFANNFWVQMAAMVIVTIVVIALEAKY
Ga0187819_1010301213300017943Freshwater SedimentMATQITSRHGFTDNFWLQMAGLVIVTLVVIALAAEYIW
Ga0187817_1023019413300017955Freshwater SedimentMDTQVGNTSGFTNNFWVQIAALVIVTLVVIALAAQYIW
Ga0187817_1077576713300017955Freshwater SedimentQITPKSGFANNFWVQMAAMVIVTIVVIALAAKYIW
Ga0187779_1075715713300017959Tropical PeatlandMDTQITRKSGLTNNLWVQMAALVIVTIAVIALAAKFIW
Ga0187778_1018085433300017961Tropical PeatlandMNMQTKGSLANNFWLQMAALVIVTVVIIALAAKYIW
Ga0187783_1004142843300017970Tropical PeatlandMNTQIRKRGGLANNFWVQAAALAVVAVVLIALAAKYVW
Ga0187783_1014204813300017970Tropical PeatlandMDSQTTNKTGLANNFWMQTAALVIVVVVLIALAAKYIW
Ga0187781_1067254923300017972Tropical PeatlandMNTQTDSKSGLANNLWVQIAALVIVGVVLIVFAAKYIW
Ga0187780_1053520113300017973Tropical PeatlandMDTQITHKSGLANNLWVQMAALVIVTIAVIALAAKFIW
Ga0187777_1011403333300017974Tropical PeatlandMNTQLENKGGLTNNFWVQIAALIIVTLVVIALAAKYIW
Ga0187822_1035843023300017994Freshwater SedimentMDTQVGNTSGFTNNFWVQIAALVIVTLVVIALAAQY
Ga0187815_1011135313300018001Freshwater SedimentMDTQITPKRGFTNNVWVQIAALVIVTIVVIALAAKYIW
Ga0187815_1051226823300018001Freshwater SedimentMDTQITRKSGFANNFWVQMTALVIVTIAVIALAAKYVW
Ga0187805_1057382023300018007Freshwater SedimentRGGGDSAMDTQITGKSGFANNVWVQMAALVIVTIAVIALAAKYIW
Ga0187784_10000784213300018062Tropical PeatlandMNMQTKGSLANNFWLQIAALVIVTVVIIALAAKYIW
Ga0187784_1115462213300018062Tropical PeatlandMNAQTTHKGGFASSFWLQRAALVVVTVVALAAKYI
Ga0066667_1219519313300018433Grasslands SoilMNTQIFNKGGFANNLWVQMAALVIVTLVVIALAAKYVW
Ga0193751_100206773300019888SoilMNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW
Ga0193751_100971923300019888SoilMNTQADSKSGFAKNFWVQMAALVIVAVVLIALAAKYVW
Ga0193751_101035963300019888SoilMDTQITRKSGFANNFWVQMTALVIVTVVVIALAAKYVW
Ga0193749_100770523300020010SoilMNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYV
Ga0210399_1014679233300020581SoilMNAQTSNRTGFANNFWVQMAAMVIVTVVIIALAAKYIW
Ga0210406_1129711813300021168SoilMNTQTFNKSGFANSFWVQIAVLVIVTLVVIAVAAKYVW
Ga0210391_1102662723300021433SoilMNAQTSNKAGFANNFWVQMAALVVVTVGIIALAAKYIW
Ga0126371_1007818383300021560Tropical Forest SoilMATQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW
Ga0126371_1011798713300021560Tropical Forest SoilMDSQITSKSGLANDFWLQMAALAILTIVVIALAAKYVW
Ga0126371_1029144633300021560Tropical Forest SoilMDTRISPKTGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0126371_1033142823300021560Tropical Forest SoilMDTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW
Ga0126371_1099721433300021560Tropical Forest SoilMATQITSKHGFTDNFWLQMAALVIVTLVMIALAAEYVW
Ga0212123_1006288533300022557Iron-Sulfur Acid SpringMNTQIRNIGSFANNFWVQMAALVVVVAIVIAFAAKYLW
Ga0207693_1044298813300025915Corn, Switchgrass And Miscanthus RhizosphereMNTQASNKPGFANNLWVQMAALVIVTVVIIALAAKY
Ga0207665_1130267723300025939Corn, Switchgrass And Miscanthus RhizosphereMNTQIFNKGGLAGNFWLQIAALVIVTLVVVALAAKYVW
Ga0209473_124435413300026330SoilMDTQLANKGDITNNFWLQMAALVIVTVAMIALAAKYVW
Ga0209577_1029525513300026552SoilMNTQIFNKGGFANNLWVQMATLVIVTLVVVALAAMYVW
Ga0209577_1036971933300026552SoilMNTQTFNKGGFANNFWVQIAALVIVTLVVIDVAAKYVW
Ga0207730_101266813300026896Tropical Forest SoilMDTQITHKSGLANNLWVQMAALVFVTIAVIALAAKFIW
Ga0207817_101690623300026979Tropical Forest SoilMDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0207784_103079513300026997Tropical Forest SoilMATQITSKHGFTDNFWLQMAALVIMTLIVILAAEYVW
Ga0207766_103064733300027042Tropical Forest SoilMDTQITRKSGLANNFWVQMAALVIVTIAVIALAAKFIW
Ga0209325_100599323300027050Forest SoilMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW
Ga0207826_115555023300027680Tropical Forest SoilMATQITSKHGFTDNFWLQMAALVIMTLVVIALAAEYIW
Ga0209040_1046448913300027824Bog Forest SoilSSMNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW
Ga0209060_10000061973300027826Surface SoilMTTQAANKNSLANNLWVQMAALIVVTVVIIALAAKYIW
Ga0209580_1065791013300027842Surface SoilMSTQAANKNSLANNLWVQMAALIVVTVVVIALAAKYIW
Ga0209465_1023148123300027874Tropical Forest SoilMATQITSKHGFADNFWLQMAALVIVTLVVIALAAEYVW
Ga0209067_1011976233300027898WatershedsMNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW
Ga0209067_1082883413300027898WatershedsMDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYI
Ga0209067_1091489223300027898WatershedsMATQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYV
Ga0209583_1019397723300027910WatershedsMNTQTSNKAGFANNFWVQMAALVIVTVAIIALAAKYIW
Ga0209583_1040393723300027910WatershedsRPRGGDPAMDTQIPRKSGFANNFWVQMAALVIVTIAVIALAAKYIW
Ga0075377_1168601513300030844SoilMNTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYLW
Ga0170834_10947943913300031057Forest SoilMNTQTSNKAGFANNVWMQVAALVVVTVVIIALGAKYIW
Ga0170834_11390506613300031057Forest SoilMNTQTFNKGGFANNFWVQIAVLVIVTLVVIAVAAKYVW
Ga0170823_1200742223300031128Forest SoilMNTQIRNIGGLANNFWVQMAALVIVTLVVIAVAANYIW
Ga0170823_1297590613300031128Forest SoilMNTQTSNKAGFANNVWMQVAALVVVTVVIIALAAKYIW
Ga0170823_1609846413300031128Forest SoilMDTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYLW
Ga0170823_1648387513300031128Forest SoilMNTQIFKTGGFANNFWVQMAALVIVTLVVIALAAKYVW
Ga0170824_10414454433300031231Forest SoilMNTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYIW
Ga0170824_10823954313300031231Forest SoilMDTQIAPKSGFANNVWVQIAALVIVTIVVIALAAKYIW
Ga0170824_11819917523300031231Forest SoilMNTQIRNTGGFINNFWVQIAALVVVTLAVIALAAKYIW
Ga0170824_12794542723300031231Forest SoilMNTQIRNTGGFTNNFWVQMAALVIVSLAVIALAAKYIW
Ga0170818_10204750113300031474Forest SoilMDTRIAPKSGFANNFWVQMAALVIVTIVVIALAAKYIW
Ga0170818_10454879513300031474Forest SoilQIRNTGGFTNNFWVQMAALVIVSLAVIALAAKYIW
Ga0318541_1006319823300031545SoilMIIQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW
Ga0318541_1020808513300031545SoilMATQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYVW
Ga0318541_1084911613300031545SoilMATQIASKHGFTDNLWLQMAALVIVTLVVIALAAEYVW
Ga0310915_1049932923300031573SoilMDTQLANKSGLTNNFWVQIAALVILTVVVIALAAEYIW
Ga0318561_1048665623300031679SoilMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0318560_1051071913300031682SoilMNTQIRNTGGLVNNIWVQMAALVIVTLVVIALAAKYIW
Ga0310686_11915676633300031708SoilMSTRIGNKGGFANITWVQLAALVIVPAFLIAVAAKCVWLPT
Ga0306917_1043977023300031719SoilMPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0306917_1141732613300031719SoilMNTQTSNKAGLANNFWVQMAAMVVVTVVIIALAAK
Ga0318492_1025448423300031748SoilMNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYLW
Ga0318509_1012560213300031768SoilMATQITSKHGFTDNFWLQRAALVIMTLVVIALAAEYVW
Ga0318546_1022715313300031771SoilMDTQISPQTGFTNNAWVQITALVVLTIVVIALAAK
Ga0306919_1018523633300031879SoilMATQITSKHGFTDNFWLQMAALVIMTLVVIALAAEYVW
Ga0306919_1031963423300031879SoilMNTQTSNKTGFANNFWVQMTALVVVTVLIIALAAKYIW
Ga0306925_1012234943300031890SoilMDTQISPKTGFTNNAWVQITALVVLTILVIALAAKYIW
Ga0306925_1041859613300031890SoilIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0306925_1052224113300031890SoilMDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0318520_1107387823300031897SoilHMNTQTSNKAGFANNFWVQMAALVVVTVVIIALAAKYIW
Ga0306923_1009313933300031910SoilMNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW
Ga0306923_1132090113300031910SoilMNTQSANKGGLANNLWVQMAALVIVTVVVIALAAKFIW
Ga0306921_1003381663300031912SoilMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0306921_1024139713300031912SoilMPNRGEVIRMDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310912_1011465913300031941SoilNRGEVIRMDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310912_1029532313300031941SoilLDTQITHKSGLANNLWVQMAALLIVTIVVIALAAKFIW
Ga0310912_1075710823300031941SoilVCPSRGGDNMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0310913_1005890513300031945SoilVIRLDTQITHKSGLANNLWVQMAALLIVTIVVIALAAKFIW
Ga0310910_1007845923300031946SoilMIREGGDQMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW
Ga0310909_1083323913300031947SoilFSWITVCPSRGGDNMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310911_1084794813300032035SoilVDTQITRKSGFVNNFWVQMAALLIVTIAVIALAAKYVW
Ga0318533_1021632923300032059SoilMDTQISPQTGFTNNAWVQITALVVLTIVVIALAAKYI
Ga0306924_1156167813300032076SoilDMDTQISPKTGFTNNAWVQITALVVLTIIVIALAAKYIW
Ga0307471_10028716133300032180Hardwood Forest SoilMNTQSSNKAGFANNFWVQMAALVIVTVVIIALAAKYIW
Ga0307471_10047246333300032180Hardwood Forest SoilMNTQASNKPGFANNLWVQMAALAIVTVVIIALAAKYIW
Ga0307471_10082612423300032180Hardwood Forest SoilMDTRAGNKSGFASNLWVQMAALVIVVLVLIALAAKYIW
Ga0307471_10163297023300032180Hardwood Forest SoilMNTQISNKAGFANNFWVQMAALVIVTVAIIALAAKYIW
Ga0306920_10366495013300032261SoilMNTQTSNKAGFANNFWVQMTALAVVTVGIIALAAKYIW
Ga0306920_10425298523300032261SoilMPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310914_1127764023300033289SoilDTQITRKSGLANNLWVQMAALVIVTIVVIALAVKFIW
Ga0318519_1044580313300033290SoilAAQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYVW
Ga0318519_1064790013300033290SoilMNTQTSNKAGFANNFWVQMAALVVVTIVIIALAAKYIW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.