| Basic Information | |
|---|---|
| Family ID | F033175 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRPQAQTVSR |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.88 % |
| % of genes near scaffold ends (potentially truncated) | 98.88 % |
| % of genes from short scaffolds (< 2000 bps) | 88.76 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.045 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.404 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.146 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.944 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.29% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 25.84 |
| PF13534 | Fer4_17 | 23.03 |
| PF02910 | Succ_DH_flav_C | 7.30 |
| PF00805 | Pentapeptide | 7.30 |
| PF09084 | NMT1 | 3.93 |
| PF13183 | Fer4_8 | 3.37 |
| PF07969 | Amidohydro_3 | 2.81 |
| PF03401 | TctC | 1.12 |
| PF01127 | Sdh_cyt | 1.12 |
| PF13180 | PDZ_2 | 1.12 |
| PF13599 | Pentapeptide_4 | 1.12 |
| PF13365 | Trypsin_2 | 0.56 |
| PF03466 | LysR_substrate | 0.56 |
| PF03928 | HbpS-like | 0.56 |
| PF13340 | DUF4096 | 0.56 |
| PF13936 | HTH_38 | 0.56 |
| PF04069 | OpuAC | 0.56 |
| PF06240 | COXG | 0.56 |
| PF13379 | NMT1_2 | 0.56 |
| PF00196 | GerE | 0.56 |
| PF00501 | AMP-binding | 0.56 |
| PF02585 | PIG-L | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 7.30 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.93 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.93 |
| COG2009 | Succinate dehydrogenase/fumarate reductase, cytochrome b subunit | Energy production and conversion [C] | 1.12 |
| COG2142 | Succinate dehydrogenase, hydrophobic anchor subunit | Energy production and conversion [C] | 1.12 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.12 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.04 % |
| Unclassified | root | N/A | 35.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320006|FACEOR_FYWIORV02G9R45 | Not Available | 501 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101991767 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300000955|JGI1027J12803_100036438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. 86_A | 711 | Open in IMG/M |
| 3300001661|JGI12053J15887_10206391 | Not Available | 996 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10371669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300004114|Ga0062593_102544190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300005177|Ga0066690_10214620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1284 | Open in IMG/M |
| 3300005332|Ga0066388_101368979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1226 | Open in IMG/M |
| 3300005332|Ga0066388_101739294 | Not Available | 1105 | Open in IMG/M |
| 3300005332|Ga0066388_108433244 | Not Available | 513 | Open in IMG/M |
| 3300005436|Ga0070713_101789621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300005546|Ga0070696_100752329 | Not Available | 799 | Open in IMG/M |
| 3300005559|Ga0066700_10290999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1150 | Open in IMG/M |
| 3300005564|Ga0070664_101170689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300005576|Ga0066708_10099682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1723 | Open in IMG/M |
| 3300005602|Ga0070762_10552768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 760 | Open in IMG/M |
| 3300005713|Ga0066905_100404469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1108 | Open in IMG/M |
| 3300005713|Ga0066905_100461965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1046 | Open in IMG/M |
| 3300005713|Ga0066905_101134877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 696 | Open in IMG/M |
| 3300005764|Ga0066903_100845702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. | 1646 | Open in IMG/M |
| 3300005764|Ga0066903_106633237 | Not Available | 602 | Open in IMG/M |
| 3300005764|Ga0066903_108231271 | Not Available | 533 | Open in IMG/M |
| 3300005833|Ga0074472_10476392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300005937|Ga0081455_10928088 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005983|Ga0081540_1167550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300006028|Ga0070717_11545699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300006028|Ga0070717_11898748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300006032|Ga0066696_10016462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3706 | Open in IMG/M |
| 3300006038|Ga0075365_10870368 | Not Available | 635 | Open in IMG/M |
| 3300006173|Ga0070716_101197624 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006175|Ga0070712_101667366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 558 | Open in IMG/M |
| 3300006797|Ga0066659_11912248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 504 | Open in IMG/M |
| 3300006844|Ga0075428_100100682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. DBB001 | 3150 | Open in IMG/M |
| 3300006844|Ga0075428_100142849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2602 | Open in IMG/M |
| 3300006853|Ga0075420_101229606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300006969|Ga0075419_10039719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2941 | Open in IMG/M |
| 3300009090|Ga0099827_10688127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 883 | Open in IMG/M |
| 3300009090|Ga0099827_11121799 | Not Available | 683 | Open in IMG/M |
| 3300009098|Ga0105245_10424174 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300009147|Ga0114129_10139558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3323 | Open in IMG/M |
| 3300009184|Ga0114976_10212011 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300009553|Ga0105249_13095542 | Not Available | 534 | Open in IMG/M |
| 3300010037|Ga0126304_11199186 | Not Available | 520 | Open in IMG/M |
| 3300010040|Ga0126308_11297488 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010044|Ga0126310_10052435 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300010045|Ga0126311_11225786 | Not Available | 621 | Open in IMG/M |
| 3300010046|Ga0126384_10304943 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1311 | Open in IMG/M |
| 3300010047|Ga0126382_11057099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 716 | Open in IMG/M |
| 3300010303|Ga0134082_10394043 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010333|Ga0134080_10364790 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010359|Ga0126376_10404704 | Not Available | 1231 | Open in IMG/M |
| 3300010359|Ga0126376_11630183 | Not Available | 678 | Open in IMG/M |
| 3300010360|Ga0126372_12861665 | Not Available | 535 | Open in IMG/M |
| 3300010362|Ga0126377_10112662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2500 | Open in IMG/M |
| 3300010362|Ga0126377_10761408 | Not Available | 1025 | Open in IMG/M |
| 3300010376|Ga0126381_104298204 | Not Available | 552 | Open in IMG/M |
| 3300010401|Ga0134121_10767300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300010863|Ga0124850_1126157 | Not Available | 642 | Open in IMG/M |
| 3300010868|Ga0124844_1166954 | Not Available | 823 | Open in IMG/M |
| 3300011119|Ga0105246_12582266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300011271|Ga0137393_11455469 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012212|Ga0150985_111622845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1382 | Open in IMG/M |
| 3300012351|Ga0137386_11168686 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012362|Ga0137361_10257907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1589 | Open in IMG/M |
| 3300012362|Ga0137361_11586393 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012363|Ga0137390_11556385 | Not Available | 600 | Open in IMG/M |
| 3300012929|Ga0137404_12271794 | Not Available | 507 | Open in IMG/M |
| 3300012930|Ga0137407_12006472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300012948|Ga0126375_10412045 | Not Available | 980 | Open in IMG/M |
| 3300012948|Ga0126375_10626777 | Not Available | 826 | Open in IMG/M |
| 3300012951|Ga0164300_10055749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1581 | Open in IMG/M |
| 3300012955|Ga0164298_10465207 | Not Available | 836 | Open in IMG/M |
| 3300012985|Ga0164308_10132064 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
| 3300012988|Ga0164306_10675993 | Not Available | 818 | Open in IMG/M |
| 3300013105|Ga0157369_10715887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1030 | Open in IMG/M |
| 3300015242|Ga0137412_10169232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. Root700 | 1757 | Open in IMG/M |
| 3300015373|Ga0132257_101271184 | Not Available | 933 | Open in IMG/M |
| 3300016294|Ga0182041_10318521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1296 | Open in IMG/M |
| 3300016294|Ga0182041_11084239 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300016341|Ga0182035_10028721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3566 | Open in IMG/M |
| 3300016341|Ga0182035_10061933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2591 | Open in IMG/M |
| 3300016341|Ga0182035_10524081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1015 | Open in IMG/M |
| 3300016341|Ga0182035_11673076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
| 3300016357|Ga0182032_10192312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1547 | Open in IMG/M |
| 3300016371|Ga0182034_11234097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 651 | Open in IMG/M |
| 3300016387|Ga0182040_10240715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1354 | Open in IMG/M |
| 3300016404|Ga0182037_10142683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1794 | Open in IMG/M |
| 3300016422|Ga0182039_10018625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4234 | Open in IMG/M |
| 3300016445|Ga0182038_10110673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2018 | Open in IMG/M |
| 3300018054|Ga0184621_10356948 | Not Available | 514 | Open in IMG/M |
| 3300018058|Ga0187766_10891639 | Not Available | 627 | Open in IMG/M |
| 3300018073|Ga0184624_10033172 | Not Available | 2007 | Open in IMG/M |
| 3300018076|Ga0184609_10220060 | Not Available | 887 | Open in IMG/M |
| 3300018081|Ga0184625_10116037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1390 | Open in IMG/M |
| 3300018469|Ga0190270_10822577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300019887|Ga0193729_1075833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1318 | Open in IMG/M |
| 3300020005|Ga0193697_1014325 | Not Available | 1944 | Open in IMG/M |
| 3300020581|Ga0210399_10920538 | Not Available | 708 | Open in IMG/M |
| 3300021073|Ga0210378_10310338 | Not Available | 592 | Open in IMG/M |
| 3300021372|Ga0213877_10082832 | Not Available | 958 | Open in IMG/M |
| 3300021405|Ga0210387_11724531 | Not Available | 530 | Open in IMG/M |
| 3300021510|Ga0222621_1122046 | Not Available | 554 | Open in IMG/M |
| 3300021560|Ga0126371_12996900 | Not Available | 572 | Open in IMG/M |
| 3300022724|Ga0242665_10243587 | Not Available | 609 | Open in IMG/M |
| 3300022726|Ga0242654_10136404 | Not Available | 807 | Open in IMG/M |
| 3300025922|Ga0207646_10046735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3883 | Open in IMG/M |
| 3300025922|Ga0207646_11374738 | Not Available | 615 | Open in IMG/M |
| 3300025972|Ga0207668_10982530 | Not Available | 754 | Open in IMG/M |
| 3300025986|Ga0207658_11390674 | Not Available | 642 | Open in IMG/M |
| 3300026089|Ga0207648_10142048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2116 | Open in IMG/M |
| 3300026490|Ga0257153_1092428 | Not Available | 603 | Open in IMG/M |
| 3300026494|Ga0257159_1101177 | Not Available | 505 | Open in IMG/M |
| 3300026551|Ga0209648_10809903 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300027035|Ga0207776_1040116 | Not Available | 575 | Open in IMG/M |
| 3300027527|Ga0209684_1015391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
| 3300027671|Ga0209588_1263546 | Not Available | 524 | Open in IMG/M |
| 3300027684|Ga0209626_1037829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1191 | Open in IMG/M |
| 3300027727|Ga0209328_10049766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1287 | Open in IMG/M |
| 3300027873|Ga0209814_10440528 | Not Available | 575 | Open in IMG/M |
| 3300027882|Ga0209590_10249624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1132 | Open in IMG/M |
| 3300027911|Ga0209698_10303334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1264 | Open in IMG/M |
| 3300028536|Ga0137415_10295117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1425 | Open in IMG/M |
| 3300028713|Ga0307303_10034523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1026 | Open in IMG/M |
| 3300028791|Ga0307290_10087559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1133 | Open in IMG/M |
| 3300028796|Ga0307287_10090559 | Not Available | 1151 | Open in IMG/M |
| 3300028884|Ga0307308_10435719 | Not Available | 628 | Open in IMG/M |
| 3300028906|Ga0308309_10537117 | Not Available | 1012 | Open in IMG/M |
| 3300031544|Ga0318534_10143559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1376 | Open in IMG/M |
| 3300031544|Ga0318534_10401333 | Not Available | 787 | Open in IMG/M |
| 3300031546|Ga0318538_10111241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1423 | Open in IMG/M |
| 3300031546|Ga0318538_10211717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1036 | Open in IMG/M |
| 3300031561|Ga0318528_10120675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1385 | Open in IMG/M |
| 3300031564|Ga0318573_10098402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1498 | Open in IMG/M |
| 3300031572|Ga0318515_10061367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1914 | Open in IMG/M |
| 3300031572|Ga0318515_10197309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1078 | Open in IMG/M |
| 3300031668|Ga0318542_10757523 | Not Available | 508 | Open in IMG/M |
| 3300031713|Ga0318496_10107849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1499 | Open in IMG/M |
| 3300031713|Ga0318496_10120623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1419 | Open in IMG/M |
| 3300031724|Ga0318500_10181228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1002 | Open in IMG/M |
| 3300031736|Ga0318501_10049749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1954 | Open in IMG/M |
| 3300031740|Ga0307468_100172745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1423 | Open in IMG/M |
| 3300031748|Ga0318492_10721651 | Not Available | 534 | Open in IMG/M |
| 3300031751|Ga0318494_10050701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2193 | Open in IMG/M |
| 3300031763|Ga0318537_10006022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3974 | Open in IMG/M |
| 3300031763|Ga0318537_10073032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1258 | Open in IMG/M |
| 3300031769|Ga0318526_10145972 | Not Available | 961 | Open in IMG/M |
| 3300031771|Ga0318546_10402862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 955 | Open in IMG/M |
| 3300031777|Ga0318543_10395712 | Not Available | 619 | Open in IMG/M |
| 3300031796|Ga0318576_10092221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1373 | Open in IMG/M |
| 3300031821|Ga0318567_10582372 | Not Available | 635 | Open in IMG/M |
| 3300031832|Ga0318499_10025495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2095 | Open in IMG/M |
| 3300031833|Ga0310917_10847936 | Not Available | 616 | Open in IMG/M |
| 3300031845|Ga0318511_10063256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1513 | Open in IMG/M |
| 3300031845|Ga0318511_10269269 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031846|Ga0318512_10045730 | Not Available | 1935 | Open in IMG/M |
| 3300031846|Ga0318512_10048825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1882 | Open in IMG/M |
| 3300031880|Ga0318544_10004876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3991 | Open in IMG/M |
| 3300031890|Ga0306925_10565921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1203 | Open in IMG/M |
| 3300031890|Ga0306925_10869691 | Not Available | 930 | Open in IMG/M |
| 3300031893|Ga0318536_10101292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1444 | Open in IMG/M |
| 3300031910|Ga0306923_11850198 | Not Available | 618 | Open in IMG/M |
| 3300031942|Ga0310916_11380175 | Not Available | 578 | Open in IMG/M |
| 3300031946|Ga0310910_10383762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1112 | Open in IMG/M |
| 3300032001|Ga0306922_11914129 | Not Available | 580 | Open in IMG/M |
| 3300032025|Ga0318507_10033487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1935 | Open in IMG/M |
| 3300032039|Ga0318559_10553491 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300032041|Ga0318549_10016861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2692 | Open in IMG/M |
| 3300032041|Ga0318549_10545802 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032059|Ga0318533_10188220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1474 | Open in IMG/M |
| 3300032065|Ga0318513_10358137 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300032090|Ga0318518_10662654 | Not Available | 531 | Open in IMG/M |
| 3300032091|Ga0318577_10074419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1561 | Open in IMG/M |
| 3300032174|Ga0307470_11473479 | Not Available | 565 | Open in IMG/M |
| 3300032180|Ga0307471_103810541 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032205|Ga0307472_102325266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 543 | Open in IMG/M |
| 3300032261|Ga0306920_100016178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10258 | Open in IMG/M |
| 3300032261|Ga0306920_100665527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1536 | Open in IMG/M |
| 3300033289|Ga0310914_10178498 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.25% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.12% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.56% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORE_456560 | 2032320006 | Soil | MAMSKDVRRVVTTVDKDGKAVVLLDDVNQHAKVRPHGTVTRLLWVADETP |
| INPhiseqgaiiFebDRAFT_1019917671 | 3300000364 | Soil | MALSADVRRVVTTIDKSDKAVVLLDGPNPHKKXRPHAQTVSRVXWVTDQTPADLSGXXDRAAVDIGIM |
| JGI1027J12803_1000364382 | 3300000955 | Soil | MPLSADVRRVVTTVDKNDKAVVLFDGPEPNKKVRPDTQTVLRL |
| JGI12053J15887_102063912 | 3300001661 | Forest Soil | MALSENVRRVVTTVDKGDKAVVLFDAATPHKKVRAVAQTVSR |
| JGIcombinedJ51221_103716692 | 3300003505 | Forest Soil | MPLSENVRRVVTTVDRGDKAVVLFDAATPHKKVRAVAQTVSRLIWVTDQTPA |
| Ga0062593_1025441901 | 3300004114 | Soil | MPVSENIRRVVTTVDRSGKAVVLSDGPNPHKLVRPNRGVTSRLMWV |
| Ga0066690_102146201 | 3300005177 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHRKVRPQAQTVSRLL |
| Ga0066388_1013689793 | 3300005332 | Tropical Forest Soil | MALSADVRRVVTTIDKNDKAVVLLDGPNPHKKVRPHAQTV |
| Ga0066388_1017392942 | 3300005332 | Tropical Forest Soil | MALSADVRRVVTTIDSNDKAVVLLDGATPHKKVRPQTQTVSRLLWVTNQTPADLSGTTDRAA |
| Ga0066388_1084332442 | 3300005332 | Tropical Forest Soil | MALSADVRRVVTTIDKNDKAVVLLDGPNPHKKVRPHAQTVSRVCW |
| Ga0070713_1017896212 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLSDDVRRVVTVVDDHGKAVVLFDGANPHTAIRPNRSVVS |
| Ga0070696_1007523291 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MALSADVRRVVTTIDSNDKAVVLLDGATPHKKVRPQTQTVSRLLWVTDQ |
| Ga0066700_102909992 | 3300005559 | Soil | MALSANVRRVVTTIDSNDKAVVLLDGPTPHKKVRPQTQTV |
| Ga0070664_1011706892 | 3300005564 | Corn Rhizosphere | MALSADVRRVVTTIDNNDKAVVLLDGANPHKKVRPQ |
| Ga0066708_100996821 | 3300005576 | Soil | MALSANVRRVVTTIDSNDKAVVLLDGPTPHKKVRPQTQTVSRLLWV |
| Ga0070762_105527682 | 3300005602 | Soil | MALSENVRRVVTTVDKGDKAVVLFDAATPHKKVRPVAQTVSRLIWVTDQTPA |
| Ga0066905_1004044691 | 3300005713 | Tropical Forest Soil | MALSADVRRVVTTIDKKDKAVVLLDGPNPHKKVRPHAQTVSRVLWVTDQTPADLSG |
| Ga0066905_1004619651 | 3300005713 | Tropical Forest Soil | MALSADVRRVVTTIDKNDKAVVLLDGPNPHKKVRPHAQTVSRVLWVTDQ |
| Ga0066905_1011348772 | 3300005713 | Tropical Forest Soil | MALSANVRRVVTTVDKNDKAVVLFDGPNPHKRVRPHAQTVS |
| Ga0066903_1008457023 | 3300005764 | Tropical Forest Soil | MPLSADVRRVVTSVDAKDKAVLLFDGPTPHKKVRPHA |
| Ga0066903_1066332371 | 3300005764 | Tropical Forest Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTVARL |
| Ga0066903_1082312711 | 3300005764 | Tropical Forest Soil | MAMSKDVRRVVTTVDKDGKAVVLLDDVNPHSKVRPHGTVTRLLWVADET |
| Ga0074472_104763921 | 3300005833 | Sediment (Intertidal) | MALSEDIRRVVTTVDRNGKAVVLFDGANPHKMVRPN |
| Ga0081455_109280882 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MALSADVRRIVTTIDRNDKAVVLLDGPNPHKKVRPQTQ |
| Ga0081540_11675501 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MPLSNNVRRIVTTVDENGKAVVLFDGENPHTIKRPDRPNT |
| Ga0070717_115456991 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MALSADVRRVVTTIDSNDKAVVLLDGATPHKKVRPQTQTISRLLWVTNQTPADLSGTTD |
| Ga0070717_118987481 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLSDDVRRVVTVVDDHGKAVVLFDGANPHTAIRPNRSVVSRLLWVT |
| Ga0066696_100164625 | 3300006032 | Soil | MALSADVRRVVTTIDSNDKAVVLLDGPTPHKKVRPQTQTVSRLLWV |
| Ga0075365_108703681 | 3300006038 | Populus Endosphere | MALSADVRRVVTTIDKDDKAVVLLDGANPHKKVRPQAQ |
| Ga0070716_1011976242 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLSEDIRRVVTTVDKDGKAVVLFDGANPHKVVRPNR |
| Ga0070712_1016673662 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLSKNIRRVVTTIDSSGKAVALFDGDNPHAKLRPQ |
| Ga0066659_119122481 | 3300006797 | Soil | MSLSADVRRVVTTIDAKDKAVVLFDGPNPHKKVRPHAQTVSRVIWVTDQTPADLSGTK |
| Ga0075428_1001006825 | 3300006844 | Populus Rhizosphere | MALSADVRRVVTTIDNNDKAVVLLDGANPHKKVRP |
| Ga0075428_1001428491 | 3300006844 | Populus Rhizosphere | MALSADVRRVVTTVDKNDKAVVLFDGPNPHKRVRPHAQTVSRVIWVTDQSPADI |
| Ga0075420_1012296061 | 3300006853 | Populus Rhizosphere | MALSADVRRVVTTIDNNDKAVVLLDGANPHKKVRPQAQ |
| Ga0075419_100397194 | 3300006969 | Populus Rhizosphere | MALSADVRRVVTTVDKNDKAVVLFDGPNPHKRVRPHAQTVSRVI |
| Ga0099827_106881272 | 3300009090 | Vadose Zone Soil | MPLSEDIRRVVTTLDDTGKAVVLLDGANPHKIVRPNRSVTSRLVWV |
| Ga0099827_111217991 | 3300009090 | Vadose Zone Soil | MTLSEEIRRVVTTVDQTGKAVVLFDGDNPHKIVRANRSTVSRLLWV |
| Ga0105245_104241741 | 3300009098 | Miscanthus Rhizosphere | MALSADIRRVVTTIDKNDKAVVLLDGANPHKKVRPQAQTVSRLLWVT |
| Ga0114129_101395584 | 3300009147 | Populus Rhizosphere | MALSADVRRVVTTIDRNDKAVVLFDGATPHKKVRPQTQTV |
| Ga0114976_102120112 | 3300009184 | Freshwater Lake | MMDLSEEVRRVVTTVDASGKAVVLFDGDNPNKVVR* |
| Ga0105249_130955421 | 3300009553 | Switchgrass Rhizosphere | MALSADVRRVVTTIDSKDKAVVLLDGANPHRKVRPQAQTVSRLLWVTDQTP |
| Ga0126304_111991861 | 3300010037 | Serpentine Soil | MTYELRRVVTGLDETGKAVVLFDGENPHKAVRPVRNNVSR |
| Ga0126308_112974882 | 3300010040 | Serpentine Soil | MPLSEDIRRIVTTVDKDGKAVVLFDGDNPHKVIRPNR |
| Ga0126310_100524351 | 3300010044 | Serpentine Soil | MAYSNAVRRVVTTVDRSGAAVVLLDGENPHKRPRSKH |
| Ga0126311_112257861 | 3300010045 | Serpentine Soil | MALSADVRRVVTTIDKDDKAVVLLDGANPHKKVRP |
| Ga0126384_103049432 | 3300010046 | Tropical Forest Soil | MPLSEDIRRVVTTVDRDGKAVVLFEGANPHKVVRPNRSV |
| Ga0126382_110570992 | 3300010047 | Tropical Forest Soil | MRMPLSEDIRRVVTTVDKNGKAVVLFDGANPHKVVRPNRSVTSRLVWVTDQ |
| Ga0134082_103940432 | 3300010303 | Grasslands Soil | MSLSADVRRVVTTIDAKDKAVVLFDGPNPHKKVRPHAQTVSRVIWVTDQTPADLSGTKDRAAIDI |
| Ga0134080_103647902 | 3300010333 | Grasslands Soil | MALSANVRRVVTTIDSNDKAVVLLDGPTPHKKVRPQTQTVSRLLWVTDQ |
| Ga0126376_104047043 | 3300010359 | Tropical Forest Soil | MALSANVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTV |
| Ga0126376_116301832 | 3300010359 | Tropical Forest Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVARLLWV |
| Ga0126372_128616652 | 3300010360 | Tropical Forest Soil | MALSADVRRVVTTVDKNDKAVVLFDGTDLRKKVRPNAQTVSRVCWVTDQTPADLSGSRDRAAV |
| Ga0126377_101126624 | 3300010362 | Tropical Forest Soil | MPLSEDIRRVVTTVDKDGKAVVLFDGANPHKVVRPNRSVTSRLIWVT |
| Ga0126377_107614083 | 3300010362 | Tropical Forest Soil | MALSADVRRVVTTIDKNDKAVVLLDGPNPHKKVRPHAQTVSRVLWVTD |
| Ga0126381_1042982041 | 3300010376 | Tropical Forest Soil | MALSANVRRVVTTIDGKDKAVVLLDGANPHKKVRPQAQTVARL |
| Ga0134121_107673001 | 3300010401 | Terrestrial Soil | MALSSEIRRVVTTVDKNDKAVVMIDGATLHKKVPPTTKTASHLMWVTDQS |
| Ga0124850_11261572 | 3300010863 | Tropical Forest Soil | MALSADVRRVVTTIDSKDKAVVLLDGVNPHKKVRPQAQT |
| Ga0124844_11669542 | 3300010868 | Tropical Forest Soil | MALSADVRRVVTTIDSKDKAVVLLDGTNPHKKVRPQAQTVSRLLWVTDQT |
| Ga0105246_125822662 | 3300011119 | Miscanthus Rhizosphere | MPPSEDIRRVVTTVDASGKAVVLFDGANPHKVVRPNRSVT |
| Ga0137393_114554692 | 3300011271 | Vadose Zone Soil | MALSADVRRVVTTIDKSDKAVVLLDGATPHKKVRP |
| Ga0150985_1116228452 | 3300012212 | Avena Fatua Rhizosphere | MPPSEDIRRVVTTVDASGKAVVLFDGANPHKVVRPNRSV |
| Ga0137386_111686861 | 3300012351 | Vadose Zone Soil | MALSADVRRVVTTVDKNDKAVVLFDGANPHKKVRPHAQTVSRVI |
| Ga0137361_102579071 | 3300012362 | Vadose Zone Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHRKVRPQAQTV |
| Ga0137361_115863932 | 3300012362 | Vadose Zone Soil | MALSADVRRVVTTIDKSDKAVVLLDGATPHKKVRPQSQTVSRLLWV |
| Ga0137390_115563851 | 3300012363 | Vadose Zone Soil | MALSADVRRVVTTLDSKDKAVVLLDGANPHKKVRP |
| Ga0137404_122717942 | 3300012929 | Vadose Zone Soil | MALSADVRRVVTTVDAKDKAVVLFDGANPHKKVRPHAQTVSRVCWVTDQTPA |
| Ga0137407_120064722 | 3300012930 | Vadose Zone Soil | MPLSKDIRRVVTTVDKDGKAVVLFDGVNPHKVVRPNRSVTSRLV |
| Ga0126375_104120451 | 3300012948 | Tropical Forest Soil | MPLSEDIRRVVTTVDQDGKAVVLFDGANPHKVVRANRSVTSRLV |
| Ga0126375_106267771 | 3300012948 | Tropical Forest Soil | MPLSEDIRRVVTTVDKNGKAVVLFDGANPHKVVRPNRSVTSR |
| Ga0164300_100557491 | 3300012951 | Soil | MALSAGVRRVVTTIDSNDKAVVLFDGATPHKKVRPQTQTVSRLLWVTD |
| Ga0164298_104652071 | 3300012955 | Soil | MALSAGVRRVVTTIDSNDKAVVLLDGATPHKKVRPQTQTVSR |
| Ga0164308_101320641 | 3300012985 | Soil | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRPQAQTVSRLL |
| Ga0164306_106759932 | 3300012988 | Soil | MPLSENVRRVVTTVDKGDKAVVLLDAATPHKKVRAVAQTVSRLIWVTDQTPADLCGAADRAAVDI |
| Ga0157369_107158872 | 3300013105 | Corn Rhizosphere | MALSKDVRRVVTTVDENGKAVVLLDGVNPHNKARAHGTVS |
| Ga0137412_101692321 | 3300015242 | Vadose Zone Soil | MPLSEDIRRVVTTVDKDGKAVVLFDGANPHKVVRPNRSVTSRLVWV |
| Ga0132257_1012711843 | 3300015373 | Arabidopsis Rhizosphere | MALSADVRRVVTTVDSKDKAVVLLDGANPHKKVRPQA |
| Ga0182041_103185211 | 3300016294 | Soil | MALSADVRRVVTTVDKNDKAGVLLDGTNPHKKVRPQAQTVSRLLWVTGESPADLSGT |
| Ga0182041_110842391 | 3300016294 | Soil | MPLSADVRRVVTTIDAKDKAVALFDGPTPHKKVRPHAQTVSRLIWVTDQTPAD |
| Ga0182035_100287211 | 3300016341 | Soil | MPLSADVRRVVTTIDAKDKAVALFDGPTPHKKVRPHAQTVSRL |
| Ga0182035_100619331 | 3300016341 | Soil | MPLSENVRRVVTTIDRNDKAVVLMDSPIPHKKVRPQAQTVS |
| Ga0182035_105240811 | 3300016341 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVS |
| Ga0182035_116730762 | 3300016341 | Soil | MALSAEVRRVITTINKNDKAVVLLDGPTPHKKVRPQAQTVSRLLWVTHETPADLSGEADRAAIDIGIMPPRG |
| Ga0182032_101923123 | 3300016357 | Soil | MALNADVRRVVTTIDSKDKAVVLLDSANPHKKVRPQAQTVSRLLWVTD |
| Ga0182034_112340972 | 3300016371 | Soil | MALSADVRRVVTTIDKNDRAVVLLDGPTPHKKVRPQAQTVSRLLWVT |
| Ga0182040_102407151 | 3300016387 | Soil | MALSANVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQT |
| Ga0182037_101426834 | 3300016404 | Soil | MALSANVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVSRLLWVTDQTP |
| Ga0182039_100186256 | 3300016422 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGTNPHKKVRPQTQTVSRLLWV |
| Ga0182038_101106733 | 3300016445 | Soil | MPLSADVRRVVTTIDAKDKAVALFDGPTPHKKVRPHAQTVSR |
| Ga0184621_103569483 | 3300018054 | Groundwater Sediment | MASSADVRRVVTTVDKTDKAAVLLDGANPHKKVRPHAQTVSRLIWVTGETPA |
| Ga0187766_108916391 | 3300018058 | Tropical Peatland | MTLSADVRRVVTTVDKNDKAVVLLEGANPHKKVRPQAQTVSRLLWVT |
| Ga0184624_100331724 | 3300018073 | Groundwater Sediment | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRPQAQ |
| Ga0184609_102200602 | 3300018076 | Groundwater Sediment | MPLSEDIRRVVTTVDKDGKAVVLFDGANPHKVVRPNRSVT |
| Ga0184625_101160373 | 3300018081 | Groundwater Sediment | MALSADVRRVVTTVDKNDKAVVLFDGPNPHKRVRPHA |
| Ga0190270_108225772 | 3300018469 | Soil | MALSADIRRVVTTVDKNDKAVVLIDGATPHKKVRPHAQTVSRLLWVT |
| Ga0193729_10758331 | 3300019887 | Soil | MALSENVRRVVTTVDKGDKAVVLFDAATPHKKLRPVAQTVSRLIWVTDQTPADLCG |
| Ga0193697_10143254 | 3300020005 | Soil | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRPQAQTVS |
| Ga0210399_109205381 | 3300020581 | Soil | MALSENVRRVVTTVDKGDKAVVLLDAATPHKKVRAVAQTVSRL |
| Ga0210378_103103381 | 3300021073 | Groundwater Sediment | MALSADVRRVVTTVDKNDKAVVLFDGPNPHKRVRPHAQTVSRVIWVTDQSPADITGAADRAAVE |
| Ga0213877_100828321 | 3300021372 | Bulk Soil | MALSADIRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQT |
| Ga0210387_117245311 | 3300021405 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGTNPHKKVRPQAQTVSRLLWVT |
| Ga0222621_11220462 | 3300021510 | Groundwater Sediment | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRSQAQTVSRLLWVT |
| Ga0126371_129969002 | 3300021560 | Tropical Forest Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRP |
| Ga0242665_102435871 | 3300022724 | Soil | MALSENVRRVVTTVDKGDKAVVLLDAATPHKKVRAVAQTV |
| Ga0242654_101364041 | 3300022726 | Soil | MALSENVRRVVTTVDKGDKAVVLFDAATPHKKVRPVAQTVSRLIWVTDQTPADLCGAADRAAVDIGIM |
| Ga0207646_100467355 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MALSADVRRVVTTIDSKDKAVVLLDGANPHRKVRPQ |
| Ga0207646_113747382 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVSRLLWV |
| Ga0207668_109825301 | 3300025972 | Switchgrass Rhizosphere | MALSADVRRVVTTIDKDDKAVVLLDGANPHKKVRPQAQTIS |
| Ga0207658_113906741 | 3300025986 | Switchgrass Rhizosphere | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRPQ |
| Ga0207648_101420483 | 3300026089 | Miscanthus Rhizosphere | MALSADVRRVVTTIDKDDKAVVLLDGANPHKKVRPQAQTV |
| Ga0257153_10924281 | 3300026490 | Soil | MALSPDVRRVVTAIDSNDKAVVLLDGATPHKKVRPQTQT |
| Ga0257159_11011772 | 3300026494 | Soil | MALSADVRRVVTTIDSKDKAVALLDGANPHKKVRPQAQTVSRLLWVTD |
| Ga0209648_108099031 | 3300026551 | Grasslands Soil | MASSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPQAQTVSRLIWVTSETPADLSGTADRAAIDIGI |
| Ga0207776_10401162 | 3300027035 | Tropical Forest Soil | MTLSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPQAQTVSRLLWVT |
| Ga0209684_10153913 | 3300027527 | Tropical Forest Soil | MALSADVRRVVTTIDTKDKAVVFFDGPTPHKKVRPQTQTVSRLLWVT |
| Ga0209588_12635462 | 3300027671 | Vadose Zone Soil | MALSADVRRVVTTIDSKDKAVALLDGANPHKKVRPQ |
| Ga0209626_10378293 | 3300027684 | Forest Soil | MALSENVRRVVTTVDKGDKAVVLFDAATPHKKVRPVAQTVSRLIWVTDQTPADLCGAADR |
| Ga0209328_100497663 | 3300027727 | Forest Soil | MALSENVRRVVTTVDKGDKAVVLFDAATPHKKVRAVAQTVSRLIWVTDQTPADLC |
| Ga0209814_104405281 | 3300027873 | Populus Rhizosphere | MALSADVRRVVTTIDRNDKAVVLFDGATPHKKVRPQTQTVSRL |
| Ga0209590_102496242 | 3300027882 | Vadose Zone Soil | MALSADVRRVVTTVDTNDKAVVLFDGANPHKKVRPHA |
| Ga0209698_103033342 | 3300027911 | Watersheds | MPLRANIRRVVTVVDDDGKAVVLLDGNNPHKMVRPNRNTVSRMLWMTDRSS |
| Ga0137415_102951172 | 3300028536 | Vadose Zone Soil | MLLSENIRRVVTVVDDDGKAVVLFDGENPHDHAWVN |
| Ga0307303_100345233 | 3300028713 | Soil | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRP |
| Ga0307290_100875593 | 3300028791 | Soil | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRPQAQTVSR |
| Ga0307287_100905592 | 3300028796 | Soil | MPLSEDIRRVVTTVDKDGKAVVLFDGANPHKVVRPNRSVTSRLVW |
| Ga0307308_104357191 | 3300028884 | Soil | MALSADVRRVVTTIDKNDKAVVLLDGANPHKKVRPQA |
| Ga0308309_105371172 | 3300028906 | Soil | MALSENVRRVVTTVDKGDKAVVLFDAATPHKKVRPVAQTVSRLIWVTDQTPADLCGAADRAAVDIGIMPPAG |
| Ga0318534_101435593 | 3300031544 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHA |
| Ga0318534_104013332 | 3300031544 | Soil | MALSADVRRVVTTVDKNDKAGVLLDGTNPHKKVRPQAQTVSRLLWV |
| Ga0318538_101112413 | 3300031546 | Soil | MPLSADVRRVVTTIDAKDKAVALFDGPTPHKKVRPHAQTVSRLIWVTDQTP |
| Ga0318538_102117173 | 3300031546 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVSRLLW |
| Ga0318528_101206751 | 3300031561 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQT |
| Ga0318573_100984023 | 3300031564 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAHTVSRLLWITDQTPSDLS |
| Ga0318515_100613673 | 3300031572 | Soil | MTLSADVRRVVTTVDKNDKAVVLLDGANPHKTVRPHAPTVSRL |
| Ga0318515_101973091 | 3300031572 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTLSRLLWVTD |
| Ga0318542_107575231 | 3300031668 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTLSRLLW |
| Ga0318496_101078491 | 3300031713 | Soil | MTLSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPHAQVSRLLW |
| Ga0318496_101206231 | 3300031713 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTLSRLLWVT |
| Ga0318500_101812281 | 3300031724 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTVSLLWVTDQ |
| Ga0318501_100497493 | 3300031736 | Soil | MTLSADVRRVVTTVDKNDKAGVLLDGTNPHKKVRPQAQTVSRL |
| Ga0307468_1001727451 | 3300031740 | Hardwood Forest Soil | MALSADVRRVVTTIDKKDKAVVLLDGPNPHKKVRPH |
| Ga0318492_107216511 | 3300031748 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVSRLLWVT |
| Ga0318494_100507011 | 3300031751 | Soil | MTLSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPHAQTVSRLLWVTGESPADLSGHPEQ |
| Ga0318537_100060221 | 3300031763 | Soil | MTLSADVRRVVTTVDKNDKAVVLLDGTNPHKKVRPQAQTVSRL |
| Ga0318537_100730323 | 3300031763 | Soil | MALNADVRRVVTTIDSKDKAVVLLDGVNPHKKVRPQAQTVSRLLWIT |
| Ga0318526_101459722 | 3300031769 | Soil | MALSADIRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVSRLLW |
| Ga0318546_104028621 | 3300031771 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPQ |
| Ga0318543_103957122 | 3300031777 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPQAQTVSRLLWVTD |
| Ga0318576_100922213 | 3300031796 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTVS |
| Ga0318567_105823722 | 3300031821 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGTNPHKKVRPQTQTVSRLLWVTDQT |
| Ga0318499_100254951 | 3300031832 | Soil | MALSADVRRVVTTIDSKDKAVVMLDGANPHKKVRPHAQTVSRLLWITDQTPADLSG |
| Ga0310917_108479362 | 3300031833 | Soil | MPLSENVRRVVTTIDKNDKAVVLTDAPIPHKKVRAQAQTVSR |
| Ga0318511_100632563 | 3300031845 | Soil | MTLSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPHAQTVSRL |
| Ga0318511_102692691 | 3300031845 | Soil | MPLSADVRRVVTTIDAKDKAVALFDGPTPHKKVRPH |
| Ga0318512_100457304 | 3300031846 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTLS |
| Ga0318512_100488253 | 3300031846 | Soil | MTLSADVRRVVTTVDKNDKAGVLLDGTNPHKKVRPQAQTVSRLLWVTGGSPAD |
| Ga0318544_100048766 | 3300031880 | Soil | MTLSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPHAQTVSRLLWVTGESPADLSGT |
| Ga0306925_105659211 | 3300031890 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGTNPHKKVRPQ |
| Ga0306925_108696912 | 3300031890 | Soil | MPLTESVRRVVTTIDKNDKAVVLMDAPIPHKKVRPQAQTVSRLVWVT |
| Ga0318536_101012923 | 3300031893 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPH |
| Ga0306923_118501981 | 3300031910 | Soil | MALSADIRRVVTTIDGKDKAVVLLDGANPHKKVRPQAQTVSRLLWVT |
| Ga0310916_113801751 | 3300031942 | Soil | MPLTENVRRVVTTIDKNDKAVVLMDAPIPHKKVRPQAQTVSR |
| Ga0310910_103837621 | 3300031946 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGATPHKKVRP |
| Ga0306922_119141292 | 3300032001 | Soil | MALNTDVRRVVTTIDSKNKAVVLLDNPHRKVRPQAQTVSR |
| Ga0318507_100334873 | 3300032025 | Soil | MTLSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPHAQTVSRLLWVTGESPADLSG |
| Ga0318559_105534911 | 3300032039 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAHTVSRLLWITDQTPADLSGSADRAAIDIGIMP |
| Ga0318549_100168611 | 3300032041 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAHTVSRLLWITDQTPAD |
| Ga0318549_105458022 | 3300032041 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQTVSRLLWITDQTPADLSGSADRAAID |
| Ga0318533_101882203 | 3300032059 | Soil | MPLSENVRRVVTTIDRNDKAVVLMDSPIPHKKVRPQAQTVSRMIWVT |
| Ga0318513_103581371 | 3300032065 | Soil | MGLSAEVRRVVTTLDNSDKAVVLFDGACPHKKVRPHTQIVSRPLWATAEAPADLSATADRAAVDIGIMPTPGG |
| Ga0318518_106626542 | 3300032090 | Soil | MALNADVRRVVTTIDSKDKAVVLLDGVNPHKKVRPQAQTVSRLLW |
| Ga0318577_100744193 | 3300032091 | Soil | MALSADVRRVVTTIDSKDKAVVLLDGANPHKKVRPHAQ |
| Ga0307470_114734791 | 3300032174 | Hardwood Forest Soil | MALSADVRRVVTTIDKNDKAVVLLDGSNPHKKVRPQAQTV |
| Ga0307471_1038105412 | 3300032180 | Hardwood Forest Soil | MALSANVRRVVTTIDKNDKAVVLMDGATPHKKVRPQ |
| Ga0307472_1023252662 | 3300032205 | Hardwood Forest Soil | MPLSREVRRVVTTIDKSGKAVALFDGDNPHSKLRPQR |
| Ga0306920_10001617813 | 3300032261 | Soil | MPLSENVRRVVTTIDRNDKAVVLMDSPIPHKKVRPQAQTVSRMI |
| Ga0306920_1006655271 | 3300032261 | Soil | MALSADVRRVVTTVDKNDKAVVLLDGANPHKKVRPQAQTVSRLLWVTGES |
| Ga0310914_101784982 | 3300033289 | Soil | MGLSENIRRVVTAIDDSGKAVVLFDGDDPHRPQTTPG |
| ⦗Top⦘ |