| Basic Information | |
|---|---|
| Family ID | F033164 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LELARREAFALAADSAQHETMQRLLRQLPPEWQRRYHLARIG |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.19 % |
| % of genes from short scaffolds (< 2000 bps) | 88.76 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.820 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.966 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.090 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.809 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF03602 | Cons_hypoth95 | 60.67 |
| PF08546 | ApbA_C | 3.93 |
| PF03544 | TonB_C | 2.25 |
| PF03551 | PadR | 1.12 |
| PF06925 | MGDG_synth | 1.12 |
| PF05076 | SUFU | 1.12 |
| PF14014 | DUF4230 | 0.56 |
| PF13419 | HAD_2 | 0.56 |
| PF14415 | DUF4424 | 0.56 |
| PF13274 | DUF4065 | 0.56 |
| PF05506 | PLipase_C_C | 0.56 |
| PF08308 | PEGA | 0.56 |
| PF04226 | Transgly_assoc | 0.56 |
| PF13620 | CarboxypepD_reg | 0.56 |
| PF07228 | SpoIIE | 0.56 |
| PF00400 | WD40 | 0.56 |
| PF08281 | Sigma70_r4_2 | 0.56 |
| PF05593 | RHS_repeat | 0.56 |
| PF14437 | MafB19-deam | 0.56 |
| PF01145 | Band_7 | 0.56 |
| PF08238 | Sel1 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 60.67 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 60.67 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 60.67 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 60.67 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 60.67 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 3.93 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.25 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 1.12 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.12 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.12 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.12 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.56 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.56 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.82 % |
| Unclassified | root | N/A | 6.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100660148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 857 | Open in IMG/M |
| 3300005332|Ga0066388_106701718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300005336|Ga0070680_101185575 | Not Available | 660 | Open in IMG/M |
| 3300005451|Ga0066681_10007728 | All Organisms → cellular organisms → Bacteria | 5104 | Open in IMG/M |
| 3300005454|Ga0066687_10278035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300005540|Ga0066697_10789625 | Not Available | 516 | Open in IMG/M |
| 3300005554|Ga0066661_10023548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3311 | Open in IMG/M |
| 3300005555|Ga0066692_10615223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300005556|Ga0066707_10893940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300005560|Ga0066670_10649844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 640 | Open in IMG/M |
| 3300005575|Ga0066702_10965096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 509 | Open in IMG/M |
| 3300005610|Ga0070763_10177513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
| 3300006102|Ga0075015_100481416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 712 | Open in IMG/M |
| 3300006174|Ga0075014_100140244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1171 | Open in IMG/M |
| 3300006174|Ga0075014_100210734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300006175|Ga0070712_100300824 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300006794|Ga0066658_10132894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1234 | Open in IMG/M |
| 3300006796|Ga0066665_10387726 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300006800|Ga0066660_11046699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300006800|Ga0066660_11221969 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006953|Ga0074063_10329400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 571 | Open in IMG/M |
| 3300009012|Ga0066710_102344327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300009038|Ga0099829_10568138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300009088|Ga0099830_10417574 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300009088|Ga0099830_10482409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300009088|Ga0099830_11334862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300009089|Ga0099828_11955383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300009522|Ga0116218_1516680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 532 | Open in IMG/M |
| 3300009700|Ga0116217_10979157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 518 | Open in IMG/M |
| 3300009792|Ga0126374_11154478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300009839|Ga0116223_10828160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 529 | Open in IMG/M |
| 3300010048|Ga0126373_12642225 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010333|Ga0134080_10632507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300010341|Ga0074045_10085802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2197 | Open in IMG/M |
| 3300010358|Ga0126370_11692934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300010360|Ga0126372_13180459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300010376|Ga0126381_101455926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300010376|Ga0126381_104375300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300010376|Ga0126381_104753621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010379|Ga0136449_100041093 | All Organisms → cellular organisms → Bacteria | 10737 | Open in IMG/M |
| 3300010379|Ga0136449_102991079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300010880|Ga0126350_11302538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1722 | Open in IMG/M |
| 3300011269|Ga0137392_10058608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2924 | Open in IMG/M |
| 3300011269|Ga0137392_10532137 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 976 | Open in IMG/M |
| 3300011269|Ga0137392_11085613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300011270|Ga0137391_10671564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 863 | Open in IMG/M |
| 3300011270|Ga0137391_11174260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012189|Ga0137388_10133038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2181 | Open in IMG/M |
| 3300012199|Ga0137383_10162037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1638 | Open in IMG/M |
| 3300012201|Ga0137365_10849555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300012202|Ga0137363_10338817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300012202|Ga0137363_10397281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300012202|Ga0137363_10900021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300012205|Ga0137362_10094948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2504 | Open in IMG/M |
| 3300012206|Ga0137380_11301988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300012207|Ga0137381_10191717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300012207|Ga0137381_10258422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1514 | Open in IMG/M |
| 3300012207|Ga0137381_11146378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300012211|Ga0137377_10518986 | Not Available | 1129 | Open in IMG/M |
| 3300012349|Ga0137387_10092681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2094 | Open in IMG/M |
| 3300012359|Ga0137385_10614193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300012361|Ga0137360_11615290 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012363|Ga0137390_10220057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1885 | Open in IMG/M |
| 3300012683|Ga0137398_10082567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1985 | Open in IMG/M |
| 3300012683|Ga0137398_10289394 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300012918|Ga0137396_10169620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1596 | Open in IMG/M |
| 3300012918|Ga0137396_10184312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1531 | Open in IMG/M |
| 3300012918|Ga0137396_10189181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1511 | Open in IMG/M |
| 3300012922|Ga0137394_10722168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300012927|Ga0137416_10626688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300012927|Ga0137416_10673596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300012927|Ga0137416_11409663 | Not Available | 631 | Open in IMG/M |
| 3300012927|Ga0137416_11797442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300012930|Ga0137407_10630294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300012960|Ga0164301_11506303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300012971|Ga0126369_11447802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300014165|Ga0181523_10011634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6288 | Open in IMG/M |
| 3300014165|Ga0181523_10081715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1956 | Open in IMG/M |
| 3300015054|Ga0137420_1066949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300015241|Ga0137418_10159673 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300015241|Ga0137418_10403266 | Not Available | 1115 | Open in IMG/M |
| 3300015241|Ga0137418_11099290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300015264|Ga0137403_10071041 | All Organisms → cellular organisms → Bacteria | 3535 | Open in IMG/M |
| 3300016357|Ga0182032_11766428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300016357|Ga0182032_11905193 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300016387|Ga0182040_10475862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300017927|Ga0187824_10350730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 532 | Open in IMG/M |
| 3300017932|Ga0187814_10214212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300017933|Ga0187801_10041350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300017934|Ga0187803_10406188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300017943|Ga0187819_10239537 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300017955|Ga0187817_10633082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300017972|Ga0187781_10583783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300018013|Ga0187873_1278935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300018018|Ga0187886_1126671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300018088|Ga0187771_10144381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1951 | Open in IMG/M |
| 3300018090|Ga0187770_10703889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 806 | Open in IMG/M |
| 3300018433|Ga0066667_11968907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300019788|Ga0182028_1299265 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
| 3300020579|Ga0210407_10665642 | Not Available | 809 | Open in IMG/M |
| 3300020580|Ga0210403_10565376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 920 | Open in IMG/M |
| 3300020581|Ga0210399_11389925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300020582|Ga0210395_10193704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1524 | Open in IMG/M |
| 3300020583|Ga0210401_10213364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1788 | Open in IMG/M |
| 3300020583|Ga0210401_11101976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300020583|Ga0210401_11440692 | Not Available | 546 | Open in IMG/M |
| 3300021086|Ga0179596_10160884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300021168|Ga0210406_10527893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300021168|Ga0210406_10886618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300021170|Ga0210400_10163408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1798 | Open in IMG/M |
| 3300021170|Ga0210400_10283807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1357 | Open in IMG/M |
| 3300021178|Ga0210408_10947377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300021181|Ga0210388_10638522 | Not Available | 930 | Open in IMG/M |
| 3300021405|Ga0210387_10151801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1982 | Open in IMG/M |
| 3300021405|Ga0210387_10463487 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300021405|Ga0210387_10666142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300021406|Ga0210386_11109951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300021406|Ga0210386_11294216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300021407|Ga0210383_11421017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300021407|Ga0210383_11543195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300021477|Ga0210398_11555873 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300021478|Ga0210402_10618975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1003 | Open in IMG/M |
| 3300021479|Ga0210410_11508422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300021559|Ga0210409_10447500 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300026277|Ga0209350_1124738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300026285|Ga0209438_1105110 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300026300|Ga0209027_1225772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300026304|Ga0209240_1106032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300026319|Ga0209647_1227665 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300026322|Ga0209687_1098888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300026507|Ga0257165_1112311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300026515|Ga0257158_1054148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300026551|Ga0209648_10120322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2120 | Open in IMG/M |
| 3300026557|Ga0179587_10110825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1672 | Open in IMG/M |
| 3300026800|Ga0207742_108445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300026869|Ga0207821_1010869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300026959|Ga0207852_1026112 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300027003|Ga0207722_1001143 | All Organisms → cellular organisms → Bacteria | 3460 | Open in IMG/M |
| 3300027376|Ga0209004_1021110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1033 | Open in IMG/M |
| 3300027562|Ga0209735_1140160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300027605|Ga0209329_1069335 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300027610|Ga0209528_1064268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300027643|Ga0209076_1148617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300027725|Ga0209178_1058189 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1248 | Open in IMG/M |
| 3300027729|Ga0209248_10102573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300027829|Ga0209773_10200401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
| 3300027846|Ga0209180_10145122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 1366 | Open in IMG/M |
| 3300027862|Ga0209701_10052165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2622 | Open in IMG/M |
| 3300027862|Ga0209701_10541792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300027905|Ga0209415_10118077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2814 | Open in IMG/M |
| 3300028906|Ga0308309_10385635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300029636|Ga0222749_10656591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300031234|Ga0302325_12492646 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031474|Ga0170818_109692268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300031708|Ga0310686_117997765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 883 | Open in IMG/M |
| 3300031718|Ga0307474_10029682 | All Organisms → cellular organisms → Bacteria | 4006 | Open in IMG/M |
| 3300031720|Ga0307469_10383796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
| 3300031754|Ga0307475_10164669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1766 | Open in IMG/M |
| 3300031754|Ga0307475_10279731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
| 3300031771|Ga0318546_11254700 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031794|Ga0318503_10174859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300031819|Ga0318568_10146786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1439 | Open in IMG/M |
| 3300031823|Ga0307478_11040735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300031890|Ga0306925_11055322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300031947|Ga0310909_10038710 | All Organisms → cellular organisms → Bacteria | 3591 | Open in IMG/M |
| 3300031954|Ga0306926_12057034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300032054|Ga0318570_10582904 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300032091|Ga0318577_10214004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300032160|Ga0311301_10061816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8159 | Open in IMG/M |
| 3300032174|Ga0307470_10023357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2828 | Open in IMG/M |
| 3300032180|Ga0307471_100342229 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300032828|Ga0335080_11429774 | Not Available | 686 | Open in IMG/M |
| 3300033134|Ga0335073_10293488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1955 | Open in IMG/M |
| 3300033561|Ga0371490_1088514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300033758|Ga0314868_037544 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300033829|Ga0334854_104941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.12% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.12% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.56% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026959 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1006601481 | 3300004152 | Bog Forest Soil | QLLELARKEAFALAEQPAQKEALQRVLRLLPGEWQRRYHLARVG* |
| Ga0066388_1067017182 | 3300005332 | Tropical Forest Soil | TLLELARKEAFSIVEDPRQKDSLQKLLRVLPPLWQRRYYLAHVG* |
| Ga0070680_1011855752 | 3300005336 | Corn Rhizosphere | DLLEVARREAFSLADDAQQSSALQRLLHQLPKEWQRRYHLARIG* |
| Ga0066681_100077281 | 3300005451 | Soil | LLELARREAFALAADSAQQDAMQRLLRQLPSEWQRRYHLARIG* |
| Ga0066687_102780352 | 3300005454 | Soil | LLELARREAFTLAADSAQQDTMQRLLRLLPAEWQRRYHLARIG* |
| Ga0066697_107896252 | 3300005540 | Soil | ARREAFTLADDSAQKETLQRILRTLPAEWQRRYHLAHIG* |
| Ga0066661_100235481 | 3300005554 | Soil | ELLELARREAFALAADSAQQDAMQRLLRQLPSEWQRRYHLARIG* |
| Ga0066692_106152231 | 3300005555 | Soil | ELLELARREAFALAADSAQQDAMQRLLCQLPAEWQRRYHLARIG* |
| Ga0066707_108939402 | 3300005556 | Soil | FLELARREAFVLADDAAQQETLQLLLRMLPTEWQRRYHLAHIG* |
| Ga0066670_106498441 | 3300005560 | Soil | DRELLELARREAFALAEDSAQSAALQQLLRVLPGEWQRRYHLARIG* |
| Ga0066702_109650962 | 3300005575 | Soil | ELGFHIANPLRDKELLELARKEAFALVGDIAKREELERVLRILPGEWQRRYHLAKVG* |
| Ga0070763_101775133 | 3300005610 | Soil | EAFALAEDARQSTSLQRLLRQLPAEWQRRYHLARIG* |
| Ga0075028_1003616221 | 3300006050 | Watersheds | FHLADEPGQKETLQQVMRLLPPQWQRRYQLAKVG* |
| Ga0075015_1004814161 | 3300006102 | Watersheds | LELARREAFSLAADSAQSADSAQRADLQRLLRQLPPEWQRRYHLARIG* |
| Ga0075014_1001402441 | 3300006174 | Watersheds | VLEVARREAFALAEDADQSASLQRLLRQLPKEWQRRYHLARIG* |
| Ga0075014_1002107343 | 3300006174 | Watersheds | ADSAQSADSAQRADLQRLLRQLPPEWQRRYHLARIG* |
| Ga0070712_1003008243 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RAVLELARQEAFAIVEQASDSAASGRGELDRILRRLPGEWQRRYHLARVG* |
| Ga0066658_101328942 | 3300006794 | Soil | DREFLELARREAFVLADDAGQQETLQRLLRMLPPEWQRRYHLAHIG* |
| Ga0066665_103877261 | 3300006796 | Soil | DKELLELARREAFALAADSAQQDAMQRLLRMLPTEWQRRYHLARIG* |
| Ga0066660_110466991 | 3300006800 | Soil | KEAFALVEDGTQREELQRMLRMLPGEWQRRYHLAKVG* |
| Ga0066660_112219692 | 3300006800 | Soil | REFLELARREAFVLADDAGQQETLQRLLRMLPPEWQRRYHLAHIG* |
| Ga0074063_103294002 | 3300006953 | Soil | LRDRTLLELARKEAFSIVEDPGQKDSLQKMLRLLPPLWQRRYYLAHVG* |
| Ga0066710_1023443272 | 3300009012 | Grasslands Soil | ARREAFALAADSAQQDAMQRLLRQLPPEWQRRYHLARIG |
| Ga0099829_105681383 | 3300009038 | Vadose Zone Soil | LELARREAFALAADSAQHETMQRLLRQLPPEWQRRYHLASIG* |
| Ga0099830_104175743 | 3300009088 | Vadose Zone Soil | FTLAADSAHHETMQRLLRQLPPEWQRRYHLARIG* |
| Ga0099830_104824091 | 3300009088 | Vadose Zone Soil | RREAFALAADSAQHETMQRLLRQLPPEWQRRYHLASIG* |
| Ga0099830_113348621 | 3300009088 | Vadose Zone Soil | AFTLAADSAHHETMQRLLRQLPPEWQRRYHLARIG* |
| Ga0099828_119553832 | 3300009089 | Vadose Zone Soil | LARREAFALAEDSAGSPDLQHILRLLPGEWQRRYHLARVG* |
| Ga0116218_15166801 | 3300009522 | Peatlands Soil | KEAFALAEQPAQKESLQRVLRLLPGEWQRRYHLARVG* |
| Ga0116217_109791571 | 3300009700 | Peatlands Soil | PLRDRQLLELARKEAFALAEQPAQKEALQRVLRLLPGEWQRRYHLAHVG* |
| Ga0126374_111544781 | 3300009792 | Tropical Forest Soil | AFALTTDSAQKGTLQGIMRVLPAEWQRRYHLARIG* |
| Ga0116223_108281602 | 3300009839 | Peatlands Soil | ELARKEAFALAEQPAQKESLQRVLRLLPGEWQRRYHLARVG* |
| Ga0126373_126422252 | 3300010048 | Tropical Forest Soil | KEAFRLVEEPAACESLQKMLRQLPPQWQRRYHLARIG* |
| Ga0134080_106325071 | 3300010333 | Grasslands Soil | RREAFHLVEDPNQSPLLQQILGALPAHWQRRYHLARVG* |
| Ga0074045_100858021 | 3300010341 | Bog Forest Soil | RDRELLELARKEAFALAEEPAQKDALQRVLRLLPGEWQRRYHLAHVG* |
| Ga0126370_116929341 | 3300010358 | Tropical Forest Soil | QSGELGFHIANPIRDKELLELARKEAFALVDGAQREELQRVLRMLPGEWQRRYHLAKVG* |
| Ga0126372_131804591 | 3300010360 | Tropical Forest Soil | PLRDKELLELARKEALALVEDGTAREELQRVLGILPGEWRRRYHLAKVG* |
| Ga0126381_1014559261 | 3300010376 | Tropical Forest Soil | RDRELLECARKEAFHLVEDPGTRESLERTLRQLPPHWQRRYHLARIG* |
| Ga0126381_1043753001 | 3300010376 | Tropical Forest Soil | LELARKEAFALVEDGTQREELQRVLRMLPGEWQRRYHLAKVG* |
| Ga0126381_1047536211 | 3300010376 | Tropical Forest Soil | LLELARKEAFALVEDGTQREELQRVLRLLPGEWQRRYHLAKVG* |
| Ga0136449_1000410931 | 3300010379 | Peatlands Soil | LLEVARREAFALADDSGQTETLQGILRALPGEWQRRYHLARVG* |
| Ga0136449_1029910791 | 3300010379 | Peatlands Soil | RREAFALASDSDQHDTLHRLLRQLPTEWQRRYHLARIG* |
| Ga0126350_113025381 | 3300010880 | Boreal Forest Soil | EAFALAEDAQQSASLQRLLRLLPKEWQRRYHLARIG* |
| Ga0137392_100586081 | 3300011269 | Vadose Zone Soil | DRELLELARREAFALADDSAQKETLQRILRTLPAEWQRRYHLARIG* |
| Ga0137392_105321371 | 3300011269 | Vadose Zone Soil | RELLELARREAFSLAADSAQQDTMQRLLRQLPAEWQRRYHLARIG* |
| Ga0137392_110856132 | 3300011269 | Vadose Zone Soil | DRELLELARREAFALADDSAQKETLQRILRTLPAEWQRRYHLAHIG* |
| Ga0137391_106715641 | 3300011270 | Vadose Zone Soil | DKELLELARREAFALAADNAQQDAMQRLLRQLPPEWQRRYHLAHIG* |
| Ga0137391_111742602 | 3300011270 | Vadose Zone Soil | ELLELARREAFALAADSAQQDSMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137388_101330381 | 3300012189 | Vadose Zone Soil | LARREAFALAADNAQQDTMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137383_101620373 | 3300012199 | Vadose Zone Soil | ARREAFALAADSAQQDAMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137365_108495553 | 3300012201 | Vadose Zone Soil | RREAFALASDSAQQDTMQRLLRMLPAEWQRRYHLARIG* |
| Ga0137363_103388171 | 3300012202 | Vadose Zone Soil | ARKEAFLLVEEPAQKEILQHMLWLLPPQWQRRYHLARIG* |
| Ga0137363_103972814 | 3300012202 | Vadose Zone Soil | VARREAFSLAEDAQQSSDLQRVLRQLPAEWQRRYNLARIG* |
| Ga0137363_109000212 | 3300012202 | Vadose Zone Soil | LELDRREAFTLADDSAQKETLQRILRTLPAEWQRRYHLAHIG* |
| Ga0137362_100949481 | 3300012205 | Vadose Zone Soil | AFALADDSAQKETLQRILRTLPAEWQRRYHLARIG* |
| Ga0137380_113019881 | 3300012206 | Vadose Zone Soil | ELLELARREAFALVDDSAQRQALEHTLRALPGQWQQRYHLARVG* |
| Ga0137381_101917173 | 3300012207 | Vadose Zone Soil | ARREAFALASDNAQQDEMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137381_102584221 | 3300012207 | Vadose Zone Soil | AFALAADNVQQDIMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137381_111463781 | 3300012207 | Vadose Zone Soil | DRELLELARREAFALVDDSAQQHALEHTLRALPGQWQQRYHLARVG* |
| Ga0137377_105189863 | 3300012211 | Vadose Zone Soil | EAFALAADSAQQDAMQRLLRQLPAEWQRRYHLARIG* |
| Ga0137387_100926813 | 3300012349 | Vadose Zone Soil | ELARREAFQLVENPNQSPLLQQILGALPPHWQRRYHLARVG* |
| Ga0137385_106141932 | 3300012359 | Vadose Zone Soil | LELARREAFALVDDSAQRQALEYTLRALPGQWQQRYHLARVG* |
| Ga0137360_116152901 | 3300012361 | Vadose Zone Soil | EAFALADDPARSSGLQRVLRMLPGEWQRRYHLAKVG* |
| Ga0137390_102200571 | 3300012363 | Vadose Zone Soil | FTLAADAAQPETMQRLLRLLPPEWQRRYHLARIG* |
| Ga0137398_100825673 | 3300012683 | Vadose Zone Soil | KELLELARREAFALAADSAQHETMQRLLRQLPPEWQRRYHLASIG* |
| Ga0137398_102893941 | 3300012683 | Vadose Zone Soil | REAFALAADSAQHETMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137396_101696203 | 3300012918 | Vadose Zone Soil | REAFTLAADSAQHETMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137396_101843121 | 3300012918 | Vadose Zone Soil | LARREAFTLAADSAQHETMQRLLRQLPPEWQRRYHLARIA* |
| Ga0137396_101891813 | 3300012918 | Vadose Zone Soil | ELARREAFALAADSAQQDTMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137394_107221681 | 3300012922 | Vadose Zone Soil | ELLELARREAFALAEDSPQSADLQRILHLLPGEWQRRYHLAHIG* |
| Ga0137416_106266882 | 3300012927 | Vadose Zone Soil | FALAADSAQQDAMQRLLRQLPSEWQRRYHLARIG* |
| Ga0137416_106735961 | 3300012927 | Vadose Zone Soil | EAFTLAADSAQHETMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137416_114096632 | 3300012927 | Vadose Zone Soil | ELARREAFTLVDDSAQKETLQRILRTLPTEWQRRYHLAHIG* |
| Ga0137416_117974421 | 3300012927 | Vadose Zone Soil | LEQARHEAFALADDPAASVALQRVLRMLPGEWQRRYHLAKVG* |
| Ga0137407_106302943 | 3300012930 | Vadose Zone Soil | LLELARREAFTLADDSAQKETLQRILRTLPAEWQRRYHLAHIG* |
| Ga0164301_115063031 | 3300012960 | Soil | AFALAEDPARAPELDRVLRRLPGEWQRRYHLARVG* |
| Ga0126369_114478022 | 3300012971 | Tropical Forest Soil | ARKEAFALVEDEEQREELQRVLRLLPGEWQRRYHLAKVG* |
| Ga0181523_100116347 | 3300014165 | Bog | RDRQLLELARKEAFTLAEDPARKDALQGVLRVLPVEWQRRYYLARIG* |
| Ga0181523_100817153 | 3300014165 | Bog | RDRQLLELARKEAFTLAEDPARKDALQGVLRVLPVEWQRRYHLARIG* |
| Ga0182019_100058691 | 3300014498 | Fen | AFSLAEEPRQKESLQRMLRLLPPQWQRRYHLAHIG* |
| Ga0137420_10669491 | 3300015054 | Vadose Zone Soil | RELLELARREAFTLAADSAQHETMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137418_101596731 | 3300015241 | Vadose Zone Soil | REAFALAADSPQHETMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137418_104032664 | 3300015241 | Vadose Zone Soil | RHEAFSLAADSAQQDTMQRLLRQLPPEWQRRYHLARIG* |
| Ga0137418_110992902 | 3300015241 | Vadose Zone Soil | REAFALAADNAQQDTMQRLLCQLPPEWQRRYHLARIG* |
| Ga0137403_100710411 | 3300015264 | Vadose Zone Soil | ELARREAFTLADDSAQKETLQRILRTLPAEWQRRYHLAHIG* |
| Ga0182032_117664282 | 3300016357 | Soil | DLARKEAFALVEDTEQREELQRVLRLLPGEWQRRYHLAKVG |
| Ga0182032_119051931 | 3300016357 | Soil | EAFLLVEDPAKEEALQRTLRLLPGEWQRRYHLARVG |
| Ga0182040_104758623 | 3300016387 | Soil | ESARREAFLLVEDAAKKEALQRTLRLLPGEWQRRYHLARVG |
| Ga0187824_103507301 | 3300017927 | Freshwater Sediment | ARREAFALAEDSDQSASLQHLLRQLPAEWQRRYHLARIG |
| Ga0187814_102142121 | 3300017932 | Freshwater Sediment | KELLELARREAFALAGDTAQKDELQGILRALPGQWQRRYHLAHIG |
| Ga0187801_100413501 | 3300017933 | Freshwater Sediment | ELARKEAFTLAEDPAKKDTLQGVLRVLPGEWQRRYHLAHIG |
| Ga0187803_104061881 | 3300017934 | Freshwater Sediment | RDRELLEQARKEAFALAEEPAKKELLQGVLRLLPGEWQRRYHLARIG |
| Ga0187819_102395373 | 3300017943 | Freshwater Sediment | ARKEAFALVEEPAKKSALQGMLRILPGEWQRRYHLAHIG |
| Ga0187817_106330822 | 3300017955 | Freshwater Sediment | LEVARKEAFALAEEPGKKNALQGMLRVLPGEWQRRYHLAHIG |
| Ga0187781_105837832 | 3300017972 | Tropical Peatland | TRQSGQLGFQVANPIRDRQLLEFARKEAFTLAEQPAQKDALQRVLRLLPGEWQRRYHLARVG |
| Ga0187873_12789352 | 3300018013 | Peatland | ELARREAFALAEDAPRAGELDRVLRRLPGEWQRRYHLARVG |
| Ga0187886_11266713 | 3300018018 | Peatland | ARKEAFALAEQPAQKEALQRVLRLLPGEWQRRYHLARVG |
| Ga0187771_101443813 | 3300018088 | Tropical Peatland | GFHVANPIRDRRLLELARKEAFALAEQPAQKDALQRVLRLLPGEWQRRYHLARVG |
| Ga0187770_107038892 | 3300018090 | Tropical Peatland | RQSGQLGFQVANPLRDRQLLELARKEAFALAEQPAQREALQRVLRLLPGEWQRRYHLARV |
| Ga0066667_119689071 | 3300018433 | Grasslands Soil | ARREALALAADSAQQDAMQCLLRLLPSEWQRRYHLARIG |
| Ga0182028_12992653 | 3300019788 | Fen | MWPTRFRDRELLELARKEAFALAEQPAQKEALQRVLRLLSWRMQRRYHLARVG |
| Ga0210407_106656421 | 3300020579 | Soil | LLRRDALTLADDSEQKQTLQRILRTLPEQWQRRYHLARVG |
| Ga0210403_105653761 | 3300020580 | Soil | DKELLELARREAFALAADNAQQDAMQRLLRQLPHEWQRRYHLARIG |
| Ga0210399_113899252 | 3300020581 | Soil | LLELARREAFALADDPAQSAALQRLLRGLPGEWQRRYHLAHVG |
| Ga0210395_101937041 | 3300020582 | Soil | LELARREAFALAADSAQQDAMQRLLRQLPPEWQRRYHLAHIG |
| Ga0210401_102133641 | 3300020583 | Soil | ERARKEAFSLVEDSAQKESLQRMLRLLPPQWQRRYHLARIG |
| Ga0210401_111019761 | 3300020583 | Soil | ELARREAFSIAEDSAKARDLDRILRHLPGEWQRRYHLARVG |
| Ga0210401_114406921 | 3300020583 | Soil | EAFALAEDAGQSVALQSLLRQLPKEWQRRYHLARIG |
| Ga0179596_101608841 | 3300021086 | Vadose Zone Soil | LLELARREAFALAADSAQHETMQRLLRQLPPEWQRRYHLARIG |
| Ga0210406_105278933 | 3300021168 | Soil | DRELLETARKEAFSLVEDAGKKESLQRMLRLLPPQWQRRYHLARIG |
| Ga0210406_108866181 | 3300021168 | Soil | KEAFPLVEEPAQKEALQRMLRLLPPQWQRRYHLARIG |
| Ga0210400_101634083 | 3300021170 | Soil | DRELLERARKEALFLVEDPAQKEPLQRILRLLPPQWQRRYHLARIG |
| Ga0210400_102838072 | 3300021170 | Soil | LLELARREAFTLAADSAQQDAMQRLLRQLPPEWQRRYHLARIG |
| Ga0210408_109473772 | 3300021178 | Soil | RKEAFSIVEDPGQKDSLQKMLRLLPPLWQRRYYLAHVG |
| Ga0210388_106385223 | 3300021181 | Soil | DRELLERARKEAFQLVEEPAQKDSLQRTLRLLPPLWQRRYHLARIG |
| Ga0210387_101518011 | 3300021405 | Soil | ELARREAFALAEDAQQSSSLQRLLRQLPPEWQRRYHLARIG |
| Ga0210387_104634871 | 3300021405 | Soil | LEVARREAFALAEDAQQSPALHQLLRQLPTEWQRRYHLAKIG |
| Ga0210387_106661421 | 3300021405 | Soil | RREAFAFVDEAQQATALEGLLRMLPAEWQRRYHLARIG |
| Ga0210386_111099511 | 3300021406 | Soil | KEAFSIVEDPGQKDSLQKMLRLLPPLWQRRYYLAHVG |
| Ga0210386_112942161 | 3300021406 | Soil | LRDRELLERARKEAFQLVEDPAQKEALQRTLRLLPSQWQRRYHLARIG |
| Ga0210383_114210171 | 3300021407 | Soil | RREAFALAEDSDQSASLQRLLRQLPKEWQRRYHLARIG |
| Ga0210383_115431952 | 3300021407 | Soil | RREAFSFVDEAQQATALEGLLRMLPVEWQRRYHLARIG |
| Ga0210398_115558732 | 3300021477 | Soil | IRDKDLLEVARREAFALAEDAQQSPALHQLLRQLPTEWQRRYHLAKIG |
| Ga0210402_106189751 | 3300021478 | Soil | ELARREAFTLAEDSEQKETLQRILRTLPEQWQRRYHLARIG |
| Ga0210410_115084222 | 3300021479 | Soil | EAFTLAEDPAQQDTMQRILRQLPAEWQRRYHLARIG |
| Ga0210409_104475001 | 3300021559 | Soil | DFLEQARREAFALAEDSDQAATLERTLHTLPAHWQRRYHLARVG |
| Ga0209350_11247382 | 3300026277 | Grasslands Soil | RREAFALAADSAQQDAMQRLLRQLPSEWQRRYHLARIG |
| Ga0209438_11051103 | 3300026285 | Grasslands Soil | ARKEAFLLVEDPTQKESLQHMLRLLPPQWQRRYHLARIG |
| Ga0209027_12257721 | 3300026300 | Grasslands Soil | LLELARREAFALAEDSAHSSILQQLLRVLPGEWQRRYHLAHIG |
| Ga0209240_11060322 | 3300026304 | Grasslands Soil | LELARREAFALAADSAQHETMQRLLRQLPPEWQRRYHLARIG |
| Ga0209647_12276651 | 3300026319 | Grasslands Soil | LARREAFALAADSTQHDTMQRLLRQLPPEWQRRYHLARIG |
| Ga0209687_10988882 | 3300026322 | Soil | LLELARREAFTLAADSAQQDTMQRLLRLLPAEWQRRYHLARIG |
| Ga0257165_11123112 | 3300026507 | Soil | PVRDRELLERARKEAFLLVEEPAQKEILQHMLWLLPPQWQRRYHLARIG |
| Ga0257158_10541481 | 3300026515 | Soil | LARREAFTLAADSAQHETMQRLLRQLPPEWQRRYHLARIG |
| Ga0209648_101203224 | 3300026551 | Grasslands Soil | ELLELARREAFALAADSAQHETMQRLLRQLPPEWQRRYHLARIG |
| Ga0179587_101108253 | 3300026557 | Vadose Zone Soil | VSPIPCANCELLELARREAFTVAADNAQQEAMQRLLRQLPPEWQRRYHLVRIG |
| Ga0207742_1084451 | 3300026800 | Tropical Forest Soil | GMLEIARKEAFALTGDPAQKDALQNVLRVLPGEWQRRYHLARVG |
| Ga0207821_10108691 | 3300026869 | Tropical Forest Soil | VANPLRDRPMLELARKEAFALAGDPAQKDALQNVLRVLPGEWQRRYHLARVG |
| Ga0207852_10261123 | 3300026959 | Tropical Forest Soil | MLELARKEAFAFAGDPTQKEALQGILRKLPGEWQRRYQLARVG |
| Ga0207722_10011431 | 3300027003 | Tropical Forest Soil | RQSGELGFHLASPLRDGELLESARKEAFLLVEDPAKEEALQRTLRLLSGEWQRRYHLARV |
| Ga0209004_10211101 | 3300027376 | Forest Soil | ARKEAFTLAEDPASKETLQGTLRLLPGEWQRRYHLARIG |
| Ga0209735_11401601 | 3300027562 | Forest Soil | EQARREAFSFVDEAQQATALEGLLRMLPAEWQRRYHLARIG |
| Ga0209329_10693352 | 3300027605 | Forest Soil | AFSLADDSAQKETLQRILRTLPAEWQRRYHLAHIG |
| Ga0209528_10642682 | 3300027610 | Forest Soil | ARREAFALVDDAQQSTALQRLLRQLPAEWQRRYHLARIG |
| Ga0209076_11486171 | 3300027643 | Vadose Zone Soil | ARREAFNLAADSAQHETMQRLLRQLPPEWQRRYHLARIG |
| Ga0209178_10581891 | 3300027725 | Agricultural Soil | EAARREAFALTEDADRSAALKRTLTQLPAEWQRRYHLARIG |
| Ga0209248_101025732 | 3300027729 | Bog Forest Soil | ANPIRDKELLESARREAFALAEDSTQKPALTQILRTLPEEWQRRYNLARIA |
| Ga0209773_102004011 | 3300027829 | Bog Forest Soil | VARTEAFALAEDPNKKDTLRAVLKLLPGEWQRRYHLARIG |
| Ga0209180_101451223 | 3300027846 | Vadose Zone Soil | ELARREAFALAADSAQHETMQRLLRQLPPEWQRRYHLASIG |
| Ga0209701_100521651 | 3300027862 | Vadose Zone Soil | KELLELARREAFALAADGAQQDAMQRLLRQLPPEWQRRYHLARIG |
| Ga0209701_105417922 | 3300027862 | Vadose Zone Soil | RELLELARREAFTLAADSAQQDAMQRLLRQLPPEWQRRYHLARIG |
| Ga0209415_101180771 | 3300027905 | Peatlands Soil | RDRQLLELARKEAFALAEQPAQKESLQRVLRLLPGEWQRRYHLARVG |
| Ga0308309_103856351 | 3300028906 | Soil | NPLRARELLELACKEAFAIAGDPAQKDSLQRILRLLPVEWQRRYHLAHIG |
| Ga0222749_106565911 | 3300029636 | Soil | RELLEQARREAFALADDRARSVSLQRVLQMLPGEWQRRYHLAKVG |
| Ga0302325_124926461 | 3300031234 | Palsa | LESARREAFALADDTTQKPALNQILRTLPAEWQRRYHLAHIG |
| Ga0170818_1096922682 | 3300031474 | Forest Soil | DRELLELARKEAFSIAEDPGQVDSLQKMLRLLPPLWQRRYHLAHVG |
| Ga0310686_1179977652 | 3300031708 | Soil | RDKDLLEVARREAFALAEDTQQSTSLQRLLHQLPKEWQCRYHLARIG |
| Ga0307474_100296821 | 3300031718 | Hardwood Forest Soil | LERARKEAFSLVEDPAQKDSLQHMLRLLPPQWQRRYHLARIG |
| Ga0307469_103837961 | 3300031720 | Hardwood Forest Soil | LARREAFALAEVSPQSADLQRILHLLPGEWQRRYHLAHIG |
| Ga0307475_101646693 | 3300031754 | Hardwood Forest Soil | REAFALAADSAQHETMQRLLHQLPPEWQRRYHLARIG |
| Ga0307475_102797311 | 3300031754 | Hardwood Forest Soil | REVLELARREAFSIADDSAKTRELDRILRQLPGEWQRRYHLARVG |
| Ga0318546_112547001 | 3300031771 | Soil | DRELLELARKEAFALTDEPAKKDALQKVLRILPAEWQRRYHLAHIG |
| Ga0318503_101748591 | 3300031794 | Soil | EEAFLLVEDLTKKEALERTLGLLPGQWQRRYHLARVG |
| Ga0318568_101467863 | 3300031819 | Soil | PLRDRPMLELARKEAFALAGDPRQKDALQCMLRLLPAEWQRRYHLARVG |
| Ga0307478_110407352 | 3300031823 | Hardwood Forest Soil | DVLEVARREAFALAEDSDQSASLQRLLRQLPKEWQRRYHLARIG |
| Ga0306925_110553221 | 3300031890 | Soil | KEAFLLVEDPAKKEALQRTLRLLPGEWQRRYHLARVG |
| Ga0310909_100387104 | 3300031947 | Soil | LELARKGAFALVEDGIQRGELQRVLGMLPGEWQRRYHLAKVG |
| Ga0306926_120570341 | 3300031954 | Soil | AMLELARKEAFAFAGDPTQKEALQGILRKLPGEWQRRYQLARVG |
| Ga0318570_105829041 | 3300032054 | Soil | ESAREEAFLLVEDLTKKEALERTLGLLPGEWQRRYHLARVG |
| Ga0318577_102140041 | 3300032091 | Soil | LELARKGAFALVEDGTQRGELQRVLGMLPAEWQRRYHLAKVG |
| Ga0311301_100618161 | 3300032160 | Peatlands Soil | DRELLEVARREAFALADDSGQTETLQGILRALPGEWQRRYHLARVG |
| Ga0307470_100233573 | 3300032174 | Hardwood Forest Soil | LRDRELLERARKEAFSLVEDSAQKESLQRMLRLLPPQWQRRYHLARIG |
| Ga0307471_1003422291 | 3300032180 | Hardwood Forest Soil | LARREAFALAADSAQQDAMQRLLRQLPPEWQRRYHLARIG |
| Ga0335080_114297741 | 3300032828 | Soil | EAFRLVEDPAEMDSLQRTLRMLPPQWQRRYHLARIG |
| Ga0335073_102934883 | 3300033134 | Soil | KEAFAVAEDPTKNDSLQGMLRILPGEWQRRYHLARIG |
| Ga0371490_10885141 | 3300033561 | Peat Soil | LELARKEAFALAEQPAQKEALQRVLRLLPGEWQRRYHLARVG |
| Ga0314868_037544_2_187 | 3300033758 | Peatland | RQSGELGFHVANPLRDRSMLELARKEAFALTGDPGQKDVLQAILRLLTGEWQRRYHLARI |
| Ga0334854_104941_552_677 | 3300033829 | Soil | ESARREAFALAEDANQKSALQVILLALPAEWQRRYHLAHIG |
| ⦗Top⦘ |